Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8334
Gene name
LocationContig_537:8472..10762
Strand-
Gene length (bp)2290
Transcript length (bp)2073
Coding sequence length (bp)2073
Protein length (aa) 691

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 7.2E-48 111 561
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 1.1E-07 583 653

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZLG0|AACS_CHICK Acetoacetyl-CoA synthetase OS=Gallus gallus GN=AACS PE=2 SV=1 12 684 2.0E-173
sp|A3QK15|AACS_DANRE Acetoacetyl-CoA synthetase OS=Danio rerio GN=aacs PE=2 SV=1 12 684 1.0E-171
sp|Q9JMI1|AACS_RAT Acetoacetyl-CoA synthetase OS=Rattus norvegicus GN=Aacs PE=1 SV=1 14 684 2.0E-169
sp|Q9D2R0|AACS_MOUSE Acetoacetyl-CoA synthetase OS=Mus musculus GN=Aacs PE=1 SV=1 14 684 5.0E-169
sp|Q9N0E1|AACS_MACFA Acetoacetyl-CoA synthetase OS=Macaca fascicularis GN=AACS PE=2 SV=1 13 684 1.0E-167
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZLG0|AACS_CHICK Acetoacetyl-CoA synthetase OS=Gallus gallus GN=AACS PE=2 SV=1 12 684 2.0E-173
sp|A3QK15|AACS_DANRE Acetoacetyl-CoA synthetase OS=Danio rerio GN=aacs PE=2 SV=1 12 684 1.0E-171
sp|Q9JMI1|AACS_RAT Acetoacetyl-CoA synthetase OS=Rattus norvegicus GN=Aacs PE=1 SV=1 14 684 2.0E-169
sp|Q9D2R0|AACS_MOUSE Acetoacetyl-CoA synthetase OS=Mus musculus GN=Aacs PE=1 SV=1 14 684 5.0E-169
sp|Q9N0E1|AACS_MACFA Acetoacetyl-CoA synthetase OS=Macaca fascicularis GN=AACS PE=2 SV=1 13 684 1.0E-167
sp|Q28BL6|AACS_XENTR Acetoacetyl-CoA synthetase OS=Xenopus tropicalis GN=aacs PE=2 SV=1 12 684 2.0E-167
sp|Q86V21|AACS_HUMAN Acetoacetyl-CoA synthetase OS=Homo sapiens GN=AACS PE=1 SV=1 13 684 1.0E-166
sp|Q9Z3R3|AACS_RHIME Acetoacetyl-coenzyme A synthetase OS=Rhizobium meliloti (strain 1021) GN=acsA2 PE=3 SV=2 24 683 2.0E-152
sp|Q21166|SUR5_CAEEL Acetoacetyl-CoA synthetase OS=Caenorhabditis elegans GN=sur-5 PE=2 SV=1 28 683 4.0E-130
sp|A3QD52|ACSA_SHELP Acetyl-coenzyme A synthetase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=acsA PE=3 SV=1 44 681 5.0E-39
sp|A8H5P1|ACSA_SHEPA Acetyl-coenzyme A synthetase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=acsA PE=3 SV=1 44 681 3.0E-37
sp|B0TPY4|ACSA_SHEHH Acetyl-coenzyme A synthetase OS=Shewanella halifaxensis (strain HAW-EB4) GN=acsA PE=3 SV=1 44 681 8.0E-37
sp|B2JD61|ACSA_BURP8 Acetyl-coenzyme A synthetase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=acsA PE=3 SV=1 126 681 2.0E-36
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 126 684 6.0E-36
sp|A8FUF1|ACSA_SHESH Acetyl-coenzyme A synthetase OS=Shewanella sediminis (strain HAW-EB3) GN=acsA PE=3 SV=1 44 681 8.0E-36
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 82 681 9.0E-36
sp|Q2T3N9|ACSA_BURTA Acetyl-coenzyme A synthetase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=acsA PE=3 SV=1 86 681 1.0E-35
sp|Q63NC4|ACSA_BURPS Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain K96243) GN=acsA PE=3 SV=1 86 681 1.0E-35
sp|A3NH07|ACSA_BURP6 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 668) GN=acsA PE=3 SV=1 86 681 1.0E-35
sp|Q3JH62|ACSA_BURP1 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1710b) GN=acsA PE=3 SV=1 86 681 1.0E-35
sp|A3P2K7|ACSA_BURP0 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1106a) GN=acsA PE=3 SV=1 86 681 1.0E-35
sp|A1UWN5|ACSA_BURMS Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain SAVP1) GN=acsA PE=3 SV=1 86 681 1.0E-35
sp|Q62AD1|ACSA_BURMA Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain ATCC 23344) GN=acsA PE=3 SV=1 86 681 1.0E-35
sp|A2RYW5|ACSA_BURM9 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10229) GN=acsA PE=3 SV=1 86 681 1.0E-35
sp|A3MG40|ACSA_BURM7 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10247) GN=acsA PE=3 SV=1 86 681 1.0E-35
sp|A1RIK1|ACSA_SHESW Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain W3-18-1) GN=acsA PE=3 SV=1 44 681 1.0E-35
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 128 681 1.0E-35
sp|A4YGR1|HPCAS_METS5 3-hydroxypropionyl-coenzyme A synthetase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1456 PE=1 SV=1 117 684 2.0E-35
sp|A4Y7Y7|ACSA_SHEPC Acetyl-coenzyme A synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=acsA PE=3 SV=1 44 681 3.0E-35
sp|A1S7C8|ACSA_SHEAM Acetyl-coenzyme A synthetase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=acsA PE=3 SV=1 44 681 4.0E-35
sp|Q9I558|ACSA1_PSEAE Acetyl-coenzyme A synthetase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA1 PE=3 SV=1 44 662 4.0E-35
sp|A9KY56|ACSA_SHEB9 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS195) GN=acsA PE=3 SV=1 44 681 4.0E-35
sp|Q0HHN4|ACSA_SHESM Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-4) GN=acsA PE=3 SV=1 44 681 5.0E-35
sp|Q0HTY6|ACSA_SHESR Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-7) GN=acsA PE=3 SV=1 44 681 5.0E-35
sp|Q3SLF4|ACSA_THIDA Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 25 684 5.0E-35
sp|A6WM52|ACSA_SHEB8 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS185) GN=acsA PE=3 SV=1 44 681 8.0E-35
sp|A3D3E8|ACSA_SHEB5 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=acsA PE=3 SV=1 44 681 8.0E-35
sp|Q8EDK3|ACSA_SHEON Acetyl-coenzyme A synthetase OS=Shewanella oneidensis (strain MR-1) GN=acsA PE=3 SV=1 44 681 8.0E-35
sp|Q88EH6|ACSA1_PSEPK Acetyl-coenzyme A synthetase 1 OS=Pseudomonas putida (strain KT2440) GN=acsA1 PE=3 SV=1 44 665 1.0E-34
sp|A0KY83|ACSA_SHESA Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain ANA-3) GN=acsA PE=3 SV=1 44 681 1.0E-34
sp|Q0AFF1|ACSA_NITEC Acetyl-coenzyme A synthetase OS=Nitrosomonas eutropha (strain C91) GN=acsA PE=3 SV=1 86 683 2.0E-34
sp|Q973W5|HPCAS_SULTO 3-hydroxypropionyl-coenzyme A synthetase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_07830 PE=1 SV=1 31 684 3.0E-34
sp|Q12MK0|ACSA_SHEDO Acetyl-coenzyme A synthetase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=acsA PE=3 SV=1 32 681 4.0E-34
sp|Q885K7|ACSA_PSESM Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=acsA PE=3 SV=1 44 662 5.0E-34
sp|Q82SI5|ACSA_NITEU Acetyl-coenzyme A synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=acsA PE=3 SV=1 86 681 2.0E-33
sp|A4TS06|ACSA_YERPP Acetyl-coenzyme A synthetase OS=Yersinia pestis (strain Pestoides F) GN=acs PE=3 SV=1 44 681 2.0E-33
sp|Q1CE37|ACSA_YERPN Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acs PE=3 SV=1 44 681 2.0E-33
sp|Q8D1G8|ACSA_YERPE Acetyl-coenzyme A synthetase OS=Yersinia pestis GN=acs PE=3 SV=2 44 681 2.0E-33
sp|Q1C0N0|ACSA_YERPA Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acs PE=3 SV=1 44 681 2.0E-33
sp|Q66FM8|ACSA_YERPS Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acs PE=3 SV=1 44 681 3.0E-33
sp|A7FNG1|ACSA_YERP3 Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acs PE=3 SV=1 44 681 3.0E-33
sp|Q8ZKF6|ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 44 677 3.0E-33
sp|Q6LLZ1|ACSA_PHOPR Acetyl-coenzyme A synthetase OS=Photobacterium profundum GN=acsA PE=3 SV=1 44 681 4.0E-33
sp|A1JIK3|ACSA_YERE8 Acetyl-coenzyme A synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acs PE=3 SV=1 44 681 5.0E-33
sp|Q48G09|ACSA_PSE14 Acetyl-coenzyme A synthetase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=acsA PE=3 SV=1 44 662 5.0E-33
sp|Q39EK2|ACSA_BURL3 Acetyl-coenzyme A synthetase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=acsA PE=3 SV=1 126 681 6.0E-33
sp|Q1LL27|ACSA_CUPMC Acetyl-coenzyme A synthetase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=acsA PE=3 SV=1 126 684 7.0E-33
sp|Q4ZQG8|ACSA_PSEU2 Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1 44 662 7.0E-33
sp|O93730|ACSA_PYRAE Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 44 665 8.0E-33
sp|B7KPN8|ACSA_METC4 Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=acsA PE=3 SV=1 30 662 8.0E-33
sp|Q8Z1R0|ACSA_SALTI Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 44 677 9.0E-33
sp|B2U6V1|ACSA_RALPJ Acetyl-coenzyme A synthetase OS=Ralstonia pickettii (strain 12J) GN=acsA PE=3 SV=1 86 684 1.0E-32
sp|A7MPJ7|ACSA_CROS8 Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 17 677 1.0E-32
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 44 677 2.0E-32
sp|B2IB12|ACSA_BEII9 Acetyl-coenzyme A synthetase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=acsA PE=3 SV=1 34 681 2.0E-32
sp|Q9VP61|ACSA_DROME Acetyl-coenzyme A synthetase OS=Drosophila melanogaster GN=AcCoAS PE=2 SV=1 43 681 2.0E-32
sp|A9W5V0|ACSA_METEP Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain PA1) GN=acsA PE=3 SV=1 30 662 2.0E-32
sp|P31638|ACSA_CUPNH Acetyl-coenzyme A synthetase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acsA PE=3 SV=1 126 684 3.0E-32
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 18 681 3.0E-32
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 18 681 3.0E-32
sp|Q46Z41|ACSA_CUPPJ Acetyl-coenzyme A synthetase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=acsA PE=3 SV=1 126 684 4.0E-32
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 18 681 4.0E-32
sp|A0B8F1|ACSA_METTP Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 47 681 5.0E-32
sp|Q15YI8|ACSA_PSEA6 Acetyl-coenzyme A synthetase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=acsA PE=3 SV=1 34 681 5.0E-32
sp|Q8XY11|ACSA_RALSO Acetyl-coenzyme A synthetase OS=Ralstonia solanacearum (strain GMI1000) GN=acsA PE=3 SV=1 126 684 5.0E-32
sp|B3R1X2|ACSA_CUPTR Acetyl-coenzyme A synthetase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=acsA PE=3 SV=1 126 684 7.0E-32
sp|Q8EYG2|ACSA_LEPIN Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=acsA PE=3 SV=1 32 665 7.0E-32
sp|B1ZB59|ACSA_METPB Acetyl-coenzyme A synthetase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=acsA PE=3 SV=1 35 662 8.0E-32
sp|A1W1D6|ACSA_CAMJJ Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=acsA PE=3 SV=1 37 673 8.0E-32
sp|Q9PMD2|ACSA_CAMJE Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=acsA PE=3 SV=1 37 673 8.0E-32
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 44 677 1.0E-31
sp|Q084J4|ACSA_SHEFN Acetyl-coenzyme A synthetase OS=Shewanella frigidimarina (strain NCIMB 400) GN=acsA PE=3 SV=1 44 681 1.0E-31
sp|Q7MGU3|ACSA_VIBVY Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 44 681 1.0E-31
sp|P16929|ACSA_NEUCR Acetyl-coenzyme A synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-5 PE=2 SV=2 19 667 1.0E-31
sp|Q8X5T5|ACSA_ECO57 Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 44 677 2.0E-31
sp|Q72LY9|ACSA_LEPIC Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=acsA PE=3 SV=1 32 665 2.0E-31
sp|Q8P3L1|ACSA_XANCP Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 44 681 2.0E-31
sp|Q4UP35|ACSA_XANC8 Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 44 681 2.0E-31
sp|A8FNJ7|ACSA_CAMJ8 Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=acsA PE=3 SV=1 37 673 2.0E-31
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 44 677 3.0E-31
sp|Q8DCZ9|ACSA_VIBVU Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 44 681 3.0E-31
sp|Q72J95|ACSA_THET2 Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=acsA PE=3 SV=1 43 673 3.0E-31
sp|Q9RRL7|ACSA_DEIRA Acetyl-coenzyme A synthetase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=acsA PE=3 SV=1 42 681 4.0E-31
sp|P16928|ACSA_EMENI Acetyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=facA PE=2 SV=2 41 665 4.0E-31
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 82 673 4.0E-31
sp|Q5SIW6|ACSA_THET8 Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=acsA PE=3 SV=1 43 673 4.0E-31
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 86 680 8.0E-31
sp|Q0AAW0|ACSA_ALKEH Acetyl-coenzyme A synthetase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=acsA PE=3 SV=1 44 681 8.0E-31
sp|A4SJM6|ACSA_AERS4 Acetyl-coenzyme A synthetase OS=Aeromonas salmonicida (strain A449) GN=acsA PE=3 SV=1 39 665 8.0E-31
sp|A8G8G7|ACSA_SERP5 Acetyl-coenzyme A synthetase OS=Serratia proteamaculans (strain 568) GN=acs PE=3 SV=1 90 681 9.0E-31
sp|Q27549|ACSA_CRYPV Acetyl-coenzyme A synthetase OS=Cryptosporidium parvum GN=ACS PE=3 SV=1 44 680 1.0E-30
sp|A4VKA0|ACSA_PSEU5 Acetyl-coenzyme A synthetase OS=Pseudomonas stutzeri (strain A1501) GN=acsA PE=3 SV=1 44 681 1.0E-30
sp|A0KNI2|ACSA_AERHH Acetyl-coenzyme A synthetase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=acsA PE=3 SV=1 39 665 2.0E-30
sp|Q3IFM6|ACSA_PSEHT Acetyl-coenzyme A synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=acsA PE=3 SV=1 44 681 2.0E-30
sp|C1AA44|ACSA_GEMAT Acetyl-coenzyme A synthetase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acsA PE=3 SV=1 86 680 2.0E-30
sp|Q2NXE2|ACSA_XANOM Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 44 681 2.0E-30
sp|Q7MBA6|ACSA_PHOLL Acetyl-coenzyme A synthetase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=acs PE=3 SV=1 44 665 3.0E-30
sp|Q9F7R5|ACSA_PRB01 Acetyl-coenzyme A synthetase OS=Gamma-proteobacterium EBAC31A08 GN=acsA PE=3 SV=1 43 662 5.0E-30
sp|Q758X0|ACS1_ASHGO Acetyl-coenzyme A synthetase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS1 PE=3 SV=1 81 665 6.0E-30
sp|Q9KV59|ACSA_VIBCH Acetyl-coenzyme A synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=acsA PE=3 SV=2 44 681 8.0E-30
sp|Q04P35|ACSA_LEPBJ Acetyl-coenzyme A synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=acsA PE=3 SV=1 32 665 9.0E-30
sp|A4G3L8|ACSA_HERAR Acetyl-coenzyme A synthetase OS=Herminiimonas arsenicoxydans GN=acsA PE=3 SV=1 126 684 1.0E-29
sp|Q8PF09|ACSA_XANAC Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 44 681 1.0E-29
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 86 676 1.0E-29
sp|A4WJG1|ACSA_PYRAR Acetyl-coenzyme A synthetase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=acsA PE=3 SV=1 44 665 1.0E-29
sp|P36333|ACSA_PENCH Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 40 681 1.0E-29
sp|Q17WR1|ACSA_HELAH Acetyl-coenzyme A synthetase OS=Helicobacter acinonychis (strain Sheeba) GN=acsA PE=3 SV=1 35 664 1.0E-29
sp|Q056J9|ACSA_LEPBL Acetyl-coenzyme A synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=acsA PE=3 SV=1 32 665 2.0E-29
sp|Q2NR28|ACSA_SODGM Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 17 665 2.0E-29
sp|Q7M9Y2|ACSA_WOLSU Acetyl-coenzyme A synthetase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=acsA PE=3 SV=1 37 680 3.0E-29
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 44 673 3.0E-29
sp|Q89WV5|ACSA_BRADU Acetyl-coenzyme A synthetase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=acsA PE=1 SV=2 35 681 4.0E-29
sp|B1M0M1|ACSA_METRJ Acetyl-coenzyme A synthetase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=acsA PE=3 SV=1 36 662 5.0E-29
sp|Q55404|ACSA_SYNY3 Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 28 674 7.0E-29
sp|A1SZA2|ACSA_PSYIN Acetyl-coenzyme A synthetase OS=Psychromonas ingrahamii (strain 37) GN=acsA PE=3 SV=1 43 665 8.0E-29
sp|Q0VSR6|ACSA_ALCBS Acetyl-coenzyme A synthetase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=acsA PE=3 SV=1 18 681 9.0E-29
sp|Q6BQF2|ACS1_DEBHA Acetyl-coenzyme A synthetase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS1 PE=3 SV=1 44 677 9.0E-29
sp|Q1H0J2|ACSA_METFK Acetyl-coenzyme A synthetase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=acsA PE=3 SV=1 90 684 1.0E-28
sp|Q8KBY0|ACSA_CHLTE Acetyl-coenzyme A synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acsA PE=3 SV=2 86 673 1.0E-28
sp|A7IFD4|ACSA_XANP2 Acetyl-coenzyme A synthetase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acsA PE=3 SV=1 23 662 1.0E-28
sp|Q9X928|ACSA_STRCO Acetyl-coenzyme A synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=acsA PE=3 SV=1 126 681 2.0E-28
sp|B5Z6E9|ACSA_HELPG Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain G27) GN=acsA PE=3 SV=1 35 662 2.0E-28
sp|P78773|ACSA_SCHPO Probable acetyl-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC191.02c PE=1 SV=2 41 681 2.0E-28
sp|B6JKX8|ACSA_HELP2 Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain P12) GN=acsA PE=3 SV=1 35 662 2.0E-28
sp|Q1CUA3|ACSA_HELPH Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain HPAG1) GN=acsA PE=3 SV=1 35 662 3.0E-28
sp|Q87C00|ACSA_XYLFT Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=acsA PE=3 SV=1 39 681 3.0E-28
sp|O25686|ACSA_HELPY Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=acsA PE=3 SV=1 35 662 6.0E-28
sp|A0L576|ACSA_MAGMM Acetyl-coenzyme A synthetase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=acsA PE=3 SV=1 44 662 9.0E-28
sp|Q2G512|ACSA_NOVAD Acetyl-coenzyme A synthetase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=acsA PE=3 SV=1 44 681 1.0E-27
sp|Q87KU7|ACSA_VIBPA Acetyl-coenzyme A synthetase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=acsA PE=3 SV=1 44 681 1.0E-27
sp|A7HSR8|ACSA_PARL1 Acetyl-coenzyme A synthetase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=acsA PE=3 SV=1 117 662 1.0E-27
sp|A1U2S9|ACSA_MARHV Acetyl-coenzyme A synthetase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=acsA PE=3 SV=1 32 681 2.0E-27
sp|Q96VC7|ACS2_ZYGBA Acetyl-coenzyme A synthetase 2 OS=Zygosaccharomyces bailii GN=ACS2 PE=3 SV=1 90 664 2.0E-27
sp|O68040|ACSA_RHOCB Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 44 662 2.0E-27
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 113 665 2.0E-27
sp|Q6MNF1|ACSA_BDEBA Acetyl-coenzyme A synthetase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=acsA PE=3 SV=1 32 662 2.0E-27
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 45 684 3.0E-27
sp|Q6BS00|ACS2_DEBHA Acetyl-coenzyme A synthetase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS2 PE=3 SV=1 23 680 4.0E-27
sp|A1WY97|ACSA_HALHL Acetyl-coenzyme A synthetase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=acsA PE=3 SV=1 22 681 4.0E-27
sp|A8PDE3|ACSA_COPC7 Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACS-1 PE=3 SV=1 113 665 5.0E-27
sp|Q9PB89|ACSA_XYLFA Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain 9a5c) GN=acsA PE=3 SV=1 132 681 5.0E-27
sp|O60011|ACS1_KLULA Acetyl-coenzyme A synthetase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS1 PE=3 SV=2 43 665 6.0E-27
sp|Q07VK4|ACSA_RHOP5 Acetyl-coenzyme A synthetase OS=Rhodopseudomonas palustris (strain BisA53) GN=acsA PE=3 SV=1 35 662 8.0E-27
sp|Q9HV66|ACSA2_PSEAE Acetyl-coenzyme A synthetase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA2 PE=3 SV=1 18 662 2.0E-26
sp|A6VZN8|ACSA_MARMS Acetyl-coenzyme A synthetase OS=Marinomonas sp. (strain MWYL1) GN=acsA PE=3 SV=1 90 681 9.0E-26
sp|A4YK73|ACSA_BRASO Acetyl-coenzyme A synthetase OS=Bradyrhizobium sp. (strain ORS278) GN=acsA PE=3 SV=1 35 662 1.0E-25
sp|Q98ET8|ACSA_RHILO Acetyl-coenzyme A synthetase OS=Rhizobium loti (strain MAFF303099) GN=acsA PE=3 SV=1 117 681 2.0E-25
sp|B9DGD6|ACS_ARATH Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal OS=Arabidopsis thaliana GN=ACS PE=1 SV=1 44 681 4.0E-25
sp|Q6FXI2|ACS2_CANGA Acetyl-coenzyme A synthetase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS2 PE=3 SV=1 28 664 4.0E-25
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 44 677 5.0E-25
sp|B8EPJ0|ACSA_METSB Acetyl-coenzyme A synthetase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=acsA PE=3 SV=1 39 681 7.0E-25
sp|Q21LV0|ACSA_SACD2 Acetyl-coenzyme A synthetase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=acsA PE=3 SV=1 90 681 7.0E-25
sp|Q54Z60|ACSA_DICDI Acetyl-coenzyme A synthetase OS=Dictyostelium discoideum GN=acsA PE=3 SV=1 43 690 1.0E-24
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 90 665 2.0E-24
sp|Q6FLU2|ACS1_CANGA Acetyl-coenzyme A synthetase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS1 PE=3 SV=1 41 665 2.0E-24
sp|Q9QXG4|ACSA_MOUSE Acetyl-coenzyme A synthetase, cytoplasmic OS=Mus musculus GN=Acss2 PE=1 SV=2 125 681 3.0E-24
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 41 662 3.0E-24
sp|Q750T7|ACS2_ASHGO Acetyl-coenzyme A synthetase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS2 PE=3 SV=1 23 680 4.0E-24
sp|Q9NR19|ACSA_HUMAN Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo sapiens GN=ACSS2 PE=1 SV=1 125 680 4.0E-24
sp|B0SRX5|ACSA_LEPBP Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=acsA PE=3 SV=1 31 662 4.0E-24
sp|B0S8X7|ACSA_LEPBA Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=acsA PE=3 SV=1 31 662 4.0E-24
sp|Q1QEB6|ACSA_PSYCK Acetyl-coenzyme A synthetase OS=Psychrobacter cryohalolentis (strain K5) GN=acsA PE=3 SV=1 44 668 6.0E-24
sp|Q8NJN3|ACS2_CANAL Acetyl-coenzyme A synthetase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACS2 PE=3 SV=2 23 681 7.0E-24
sp|A6WXV8|ACSA_OCHA4 Acetyl-coenzyme A synthetase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=acsA PE=3 SV=1 117 662 7.0E-24
sp|Q88DW6|ACSA2_PSEPK Acetyl-coenzyme A synthetase 2 OS=Pseudomonas putida (strain KT2440) GN=acsA2 PE=3 SV=1 33 662 8.0E-24
sp|B8FIN2|ACSA_DESAA Acetyl-coenzyme A synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acsA PE=3 SV=1 42 680 1.0E-23
sp|Q9A2I0|ACSA_CAUCR Acetyl-coenzyme A synthetase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=acsA PE=3 SV=1 85 681 1.0E-23
sp|Q4FVA1|ACSA_PSYA2 Acetyl-coenzyme A synthetase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=acsA PE=3 SV=1 87 668 1.0E-23
sp|Q2LW77|ACSA_SYNAS Acetyl-coenzyme A synthetase OS=Syntrophus aciditrophicus (strain SB) GN=acsA PE=3 SV=1 87 681 2.0E-23
sp|P52910|ACS2_YEAST Acetyl-coenzyme A synthetase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS2 PE=1 SV=1 90 680 4.0E-23
sp|Q6G1W0|ACSA_BARHE Acetyl-coenzyme A synthetase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=acsA PE=3 SV=1 117 681 1.0E-22
sp|Q8FYQ3|ACSA_BRUSU Acetyl-coenzyme A synthetase OS=Brucella suis biovar 1 (strain 1330) GN=acsA PE=3 SV=1 117 662 3.0E-22
sp|A9M849|ACSA_BRUC2 Acetyl-coenzyme A synthetase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=acsA PE=3 SV=1 117 662 3.0E-22
sp|Q57B76|ACSA_BRUAB Acetyl-coenzyme A synthetase OS=Brucella abortus biovar 1 (strain 9-941) GN=acsA PE=3 SV=1 117 662 3.0E-22
sp|Q2YLH5|ACSA_BRUA2 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain 2308) GN=acsA PE=3 SV=1 117 662 3.0E-22
sp|B2S7N5|ACSA_BRUA1 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain S19) GN=acsA PE=3 SV=1 117 662 3.0E-22
sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=acsA PE=3 SV=1 117 681 4.0E-22
sp|A9WWT6|ACSA_BRUSI Acetyl-coenzyme A synthetase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=acsA PE=3 SV=1 117 662 4.0E-22
sp|Q8YJ48|ACSA_BRUME Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=acsA PE=3 SV=2 117 662 4.0E-22
sp|C0RF62|ACSA_BRUMB Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=acsA PE=3 SV=1 117 662 4.0E-22
sp|Q92KX2|ACSA_RHIME Acetyl-coenzyme A synthetase OS=Rhizobium meliloti (strain 1021) GN=acsA1 PE=3 SV=1 117 662 2.0E-21
sp|P28812|Y3568_PSEAE Uncharacterized protein PA3568 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3568 PE=3 SV=2 90 680 2.0E-21
sp|Q9KWA3|ACSA_AGRRH Acetyl-coenzyme A synthetase OS=Agrobacterium rhizogenes GN=acsA PE=3 SV=1 90 681 2.0E-21
sp|Q8UBV5|ACSA_AGRFC Acetyl-coenzyme A synthetase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=acsA PE=3 SV=2 117 662 3.0E-21
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 125 674 6.0E-21
sp|Q01574|ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS1 PE=1 SV=2 41 665 2.0E-20
sp|Q554Z5|ACSB_DICDI Acyl-CoA synthetase short-chain family member B, mitochondrial OS=Dictyostelium discoideum GN=aslB PE=3 SV=1 87 680 3.0E-20
sp|Q9Y7B5|ACS2_KLULA Acetyl-coenzyme A synthetase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS2 PE=3 SV=2 10 664 4.0E-20
sp|P77495|PRPE_ECOLI Propionate--CoA ligase OS=Escherichia coli (strain K12) GN=prpE PE=3 SV=1 44 684 4.0E-20
sp|P55912|PRPE_SALTY Propionate--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpE PE=3 SV=2 44 684 6.0E-20
sp|B9JV43|ACSA_AGRVS Acetyl-coenzyme A synthetase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=acsA PE=3 SV=1 117 662 7.0E-20
sp|Q6FYL4|ACSA_BARQU Acetyl-coenzyme A synthetase OS=Bartonella quintana (strain Toulouse) GN=acsA PE=3 SV=1 117 681 1.0E-19
sp|A6UED8|ACSA_SINMW Acetyl-coenzyme A synthetase OS=Sinorhizobium medicae (strain WSM419) GN=acsA PE=3 SV=1 90 681 1.0E-19
sp|A9IYZ3|ACSA_BART1 Acetyl-coenzyme A synthetase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=acsA PE=3 SV=1 31 662 2.0E-19
sp|A1UR36|ACSA_BARBK Acetyl-coenzyme A synthetase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=acsA PE=3 SV=1 117 681 3.0E-19
sp|C3MAS0|ACSA_RHISN Acetyl-coenzyme A synthetase OS=Rhizobium sp. (strain NGR234) GN=acsA PE=3 SV=1 117 681 7.0E-19
sp|B5ZV36|ACSA_RHILW Acetyl-coenzyme A synthetase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=acsA PE=3 SV=1 23 662 7.0E-19
sp|B3PS41|ACSA_RHIE6 Acetyl-coenzyme A synthetase OS=Rhizobium etli (strain CIAT 652) GN=acsA PE=3 SV=1 18 662 4.0E-18
sp|Q99NB1|ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 90 680 5.0E-18
sp|B9JEV4|ACSA_AGRRK Acetyl-coenzyme A synthetase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=acsA PE=3 SV=1 129 662 5.0E-18
sp|Q2K2T1|ACSA_RHIEC Acetyl-coenzyme A synthetase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=acsA PE=3 SV=1 18 662 4.0E-17
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 90 664 1.0E-16
sp|Q9H6R3|ACSS3_HUMAN Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Homo sapiens GN=ACSS3 PE=1 SV=1 117 677 2.0E-16
sp|Q5REB8|ACSS3_PONAB Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Pongo abelii GN=ACSS3 PE=2 SV=1 117 677 6.0E-15
sp|Q84P17|AEE18_ARATH Probable acyl-activating enzyme 18, peroxisomal OS=Arabidopsis thaliana GN=AAE18 PE=2 SV=1 49 632 2.0E-14
sp|Q14DH7|ACSS3_MOUSE Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Mus musculus GN=Acss3 PE=1 SV=2 127 677 2.0E-13
sp|A7MB45|ACSS3_BOVIN Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Bos taurus GN=ACSS3 PE=2 SV=1 117 677 5.0E-12
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 132 660 2.0E-11
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 84 661 7.0E-10
sp|B2HHZ8|FAC17_MYCMM Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD17 PE=3 SV=1 241 656 1.0E-09
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 289 653 1.0E-08
sp|F4KBF3|AAE17_ARATH Probable acyl-activating enzyme 17, peroxisomal OS=Arabidopsis thaliana GN=AAE17 PE=2 SV=1 135 664 1.0E-08
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 109 653 6.0E-08
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 269 653 4.0E-07
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 132 576 5.0E-07
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 151 625 6.0E-07
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 132 497 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8334
MDHAIGGADDASDVLWRHPAPASTPMWHFVQQLNQRRGLELCDYPGLYRWSVDNVSAFWEELWDFVGIVASQRAD
KALAIGAPMFPRPDFFASARLNFAENLLFPPGAASVDPSSPAVITMTELPGDLRSTSWADLREAVRQLATALRAA
GLGRGQVVAGYVSNHVEALVAMLAAASLGAIWTGISPDSGVSAVLDRLSQIGPRVLFADNGTVYNGKEWSSAAKT
RDIVSELVKTGLHTVVVIDNIKSDLGISQLESLGVKVHEYGSFLAGTSSDPLEFEQLPPSHPLYILYSSGTTGLP
KPIVHTALGTLLQHKKEHLLHCSMSASSRMLYYTTTSWMMWHWSVGALAVGATLVVYSGSPFRPHSHLSLPRVLS
DLGVTHFGTSAAYLTALEANSVRPVEEPGLDLSKLQAIYSTASPLPPSTFRFVYDAFPKTVNLASITGGTDIISL
FGAPCPLLPVRTGEIQCAGLGMDIRVVDPVSGEEVAPGETGDLVCVKPFPCQPLTFFGPGGGQRYRAAYFERFRD
VCGAEGPVWHHGDFVKMPNAATGGLVMLGRSDGVLKPAGVRFGSAEIYNILTRFFGSEVEEAVCVGRRRPTDADE
TVCLFVVMAPGKRFDEEVRAQIKAKVRSELSPRHVPGVVEECGNGIPKTSNGKKIEVAVKQILSGMDVKTNASVA
NPEALDWFKVWAKTH*
Coding >Hirsu2|8334
ATGGACCACGCCATCGGCGGCGCAGACGATGCCTCGGACGTCCTGTGGCGGCATCCGGCCCCTGCCTCGACGCCC
ATGTGGCACTTTGTACAGCAGCTCAACCAGAGGCGTGGCCTGGAGCTCTGTGACTACCCGGGCCTCTACCGGTGG
TCCGTCGACAACGTCTCGGCCTTCTGGGAAGAGCTCTGGGACTTCGTCGGCATTGTCGCCTCGCAAAGGGCCGAC
AAGGCCCTTGCGATCGGCGCTCCCATGTTCCCTCGCCCCGACTTCTTCGCCTCGGCTCGCCTCAACTTCGCCGAG
AACCTCCTCTTCCCCCCGGGCGCCGCCTCCGTCGACCCCTCGTCCCCCGCCGTCATCACCATGACCGAGCTCCCC
GGCGACTTGCGCTCCACCTCGTGGGCCGACCTGCGTGAGGCCGTCCGCCAATTGGCCACTGCCCTCCGGGCCGCT
GGCCTCGGACGCGGCCAGGTCGTCGCCGGCTACGTCTCCAACCACGTCGAAGCTCTCGTCGCCATGCTCGCCGCC
GCCTCGTTGGGCGCCATCTGGACCGGCATCAGCCCGGACAGTGGCGTCTCGGCAGTCTTGGACCGCCTCAGCCAG
ATCGGGCCCAGGGTCTTGTTCGCCGACAACGGTACCGTGTACAATGGCAAGGAATGGTCGAGCGCGGCCAAGACC
AGGGACATCGTGTCGGAGTTGGTCAAGACTGGCTTGCACACTGTCGTCGTCATCGACAACATCAAGAGCGATCTG
GGCATTTCCCAGCTCGAGTCACTGGGCGTCAAAGTGCATGAATATGGTTCCTTCCTGGCCGGTACCTCGTCGGAC
CCTCTCGAGTTCGAGCAGCTTCCCCCATCCCATCCACTCTACATTCTCTACTCCAGCGGGACCACGGGACTGCCG
AAGCCCATCGTCCACACTGCATTGGGCACCCTCCTGCAGCACAAGAAGGAACACCTGCTGCATTGCTCCATGTCT
GCCTCGTCCCGCATGCTCTACTACACGACGACGTCGTGGATGATGTGGCACTGGAGCGTCGGCGCACTGGCCGTC
GGCGCTACCCTCGTCGTCTATTCGGGGTCGCCGTTCCGGCCACATTCGCATCTATCGTTGCCCCGAGTGCTTTCC
GACCTGGGCGTCACGCACTTCGGCACGTCGGCCGCCTACCTTACGGCTCTCGAAGCCAACAGCGTCCGTCCGGTC
GAGGAGCCGGGCCTGGATCTCTCGAAGTTGCAAGCCATCTATTCGACCGCCTCCCCGTTGCCGCCGTCGACCTTC
AGGTTCGTGTACGACGCGTTCCCCAAGACGGTCAACCTGGCCTCCATCACAGGCGGAACAGACATCATCTCGCTG
TTCGGCGCTCCCTGCCCACTGCTCCCGGTCCGGACGGGAGAGATTCAGTGTGCCGGGCTGGGCATGGACATTCGG
GTGGTGGACCCCGTTTCGGGGGAGGAGGTGGCCCCGGGCGAGACTGGGGACCTGGTCTGCGTCAAGCCCTTCCCC
TGCCAGCCGCTCACCTTCTTCGGCCCCGGGGGCGGCCAGAGGTACAGGGCGGCCTACTTCGAGCGGTTCCGGGAC
GTGTGTGGAGCGGAGGGGCCGGTGTGGCATCACGGAGACTTCGTCAAGATGCCCAATGCGGCGACGGGAGGCCTC
GTGATGCTCGGCAGGTCTGACGGGGTTCTCAAACCTGCGGGCGTGCGGTTTGGCTCGGCGGAAATATACAACATC
CTCACTCGGTTCTTCGGGTCGGAGGTGGAAGAGGCGGTGTGCGTTGGCCGGCGGCGTCCGACGGACGCAGACGAG
ACGGTCTGCCTCTTCGTCGTCATGGCTCCCGGAAAGAGGTTCGACGAGGAGGTCAGGGCACAGATCAAGGCCAAG
GTCCGGAGCGAGTTGAGTCCGAGGCACGTGCCCGGAGTGGTGGAGGAGTGCGGCAACGGGATACCCAAAACCAGC
AATGGCAAGAAGATCGAGGTCGCGGTGAAGCAGATTCTTTCGGGCATGGATGTCAAGACCAATGCCAGCGTTGCC
AATCCAGAGGCACTGGACTGGTTCAAGGTCTGGGCAAAGACACACTGA
Transcript >Hirsu2|8334
ATGGACCACGCCATCGGCGGCGCAGACGATGCCTCGGACGTCCTGTGGCGGCATCCGGCCCCTGCCTCGACGCCC
ATGTGGCACTTTGTACAGCAGCTCAACCAGAGGCGTGGCCTGGAGCTCTGTGACTACCCGGGCCTCTACCGGTGG
TCCGTCGACAACGTCTCGGCCTTCTGGGAAGAGCTCTGGGACTTCGTCGGCATTGTCGCCTCGCAAAGGGCCGAC
AAGGCCCTTGCGATCGGCGCTCCCATGTTCCCTCGCCCCGACTTCTTCGCCTCGGCTCGCCTCAACTTCGCCGAG
AACCTCCTCTTCCCCCCGGGCGCCGCCTCCGTCGACCCCTCGTCCCCCGCCGTCATCACCATGACCGAGCTCCCC
GGCGACTTGCGCTCCACCTCGTGGGCCGACCTGCGTGAGGCCGTCCGCCAATTGGCCACTGCCCTCCGGGCCGCT
GGCCTCGGACGCGGCCAGGTCGTCGCCGGCTACGTCTCCAACCACGTCGAAGCTCTCGTCGCCATGCTCGCCGCC
GCCTCGTTGGGCGCCATCTGGACCGGCATCAGCCCGGACAGTGGCGTCTCGGCAGTCTTGGACCGCCTCAGCCAG
ATCGGGCCCAGGGTCTTGTTCGCCGACAACGGTACCGTGTACAATGGCAAGGAATGGTCGAGCGCGGCCAAGACC
AGGGACATCGTGTCGGAGTTGGTCAAGACTGGCTTGCACACTGTCGTCGTCATCGACAACATCAAGAGCGATCTG
GGCATTTCCCAGCTCGAGTCACTGGGCGTCAAAGTGCATGAATATGGTTCCTTCCTGGCCGGTACCTCGTCGGAC
CCTCTCGAGTTCGAGCAGCTTCCCCCATCCCATCCACTCTACATTCTCTACTCCAGCGGGACCACGGGACTGCCG
AAGCCCATCGTCCACACTGCATTGGGCACCCTCCTGCAGCACAAGAAGGAACACCTGCTGCATTGCTCCATGTCT
GCCTCGTCCCGCATGCTCTACTACACGACGACGTCGTGGATGATGTGGCACTGGAGCGTCGGCGCACTGGCCGTC
GGCGCTACCCTCGTCGTCTATTCGGGGTCGCCGTTCCGGCCACATTCGCATCTATCGTTGCCCCGAGTGCTTTCC
GACCTGGGCGTCACGCACTTCGGCACGTCGGCCGCCTACCTTACGGCTCTCGAAGCCAACAGCGTCCGTCCGGTC
GAGGAGCCGGGCCTGGATCTCTCGAAGTTGCAAGCCATCTATTCGACCGCCTCCCCGTTGCCGCCGTCGACCTTC
AGGTTCGTGTACGACGCGTTCCCCAAGACGGTCAACCTGGCCTCCATCACAGGCGGAACAGACATCATCTCGCTG
TTCGGCGCTCCCTGCCCACTGCTCCCGGTCCGGACGGGAGAGATTCAGTGTGCCGGGCTGGGCATGGACATTCGG
GTGGTGGACCCCGTTTCGGGGGAGGAGGTGGCCCCGGGCGAGACTGGGGACCTGGTCTGCGTCAAGCCCTTCCCC
TGCCAGCCGCTCACCTTCTTCGGCCCCGGGGGCGGCCAGAGGTACAGGGCGGCCTACTTCGAGCGGTTCCGGGAC
GTGTGTGGAGCGGAGGGGCCGGTGTGGCATCACGGAGACTTCGTCAAGATGCCCAATGCGGCGACGGGAGGCCTC
GTGATGCTCGGCAGGTCTGACGGGGTTCTCAAACCTGCGGGCGTGCGGTTTGGCTCGGCGGAAATATACAACATC
CTCACTCGGTTCTTCGGGTCGGAGGTGGAAGAGGCGGTGTGCGTTGGCCGGCGGCGTCCGACGGACGCAGACGAG
ACGGTCTGCCTCTTCGTCGTCATGGCTCCCGGAAAGAGGTTCGACGAGGAGGTCAGGGCACAGATCAAGGCCAAG
GTCCGGAGCGAGTTGAGTCCGAGGCACGTGCCCGGAGTGGTGGAGGAGTGCGGCAACGGGATACCCAAAACCAGC
AATGGCAAGAAGATCGAGGTCGCGGTGAAGCAGATTCTTTCGGGCATGGATGTCAAGACCAATGCCAGCGTTGCC
AATCCAGAGGCACTGGACTGGTTCAAGGTCTGGGCAAAGACACACTGA
Gene >Hirsu2|8334
ATGGACCACGCCATCGGCGGCGCAGACGATGCCTCGGACGTCCTGTGGCGGCATCCGGCCCCTGCCTCGACGCCC
ATGTGGCACTTTGTACAGCAGCTCAACCAGAGGCGTGGCCTGGAGCTCTGTGACTACCCGGGCCTCTACCGGTGG
TCCGTCGACAACGTCTCGGCCTTCTGGGAAGAGCTCTGGGACTTCGTCGGCATTGTCGCCTCGCAAAGGGCCGAC
AAGGTGTGTCGCCGTCCAGACGGGCCTCCCCCGCCTTCGATGTGTGCTTCGCGAGGGCGCCCGGCCTCGGCCTCG
TCGCCATCACACCCGCTGCAGCCCATGCTCGGGAGCCCTCACATCTTCGCCGCGGGCGGCTAACGCGATGCCAAC
CCGCCCAGGCCCTTGCGATCGGCGCTCCCATGTTCCCTCGCCCCGACTTCTTCGCCTCGGCTCGCCTCAACTTCG
CCGAGAACCTCCTCTTCCCCCCGGGCGCCGCCTCCGTCGACCCCTCGTCCCCCGCCGTCATCACCATGACCGAGC
TCCCCGGCGACTTGCGCTCCACCTCGTGGGCCGACCTGCGTGAGGCCGTCCGCCAATTGGCCACTGCCCTCCGGG
CCGCTGGCCTCGGACGCGGCCAGGTCGTCGCCGGCTACGTCTCCAACCACGTCGAAGCTCTCGTCGCCATGCTCG
CCGCCGCCTCGTTGGGCGCCATCTGGACCGGCATCAGCCCGGACAGTGGCGTCTCGGCAGTCTTGGACCGCCTCA
GCCAGATCGGGCCCAGGGTCTTGTTCGCCGACAACGGTACCGTGTACAATGGCAAGGAATGGTCGAGCGCGGCCA
AGACCAGGGACATCGTGTCGGAGTTGGTCAAGACTGGCTTGCACACTGTCGTCGTCATCGACAACATCAAGAGCG
ATCTGGGCATTTCCCAGCTCGAGTCACTGGGCGTCAAAGTGCATGAATATGGTTCCTTCCTGGCCGGTACCTCGT
CGGACCCTCTCGAGTTCGAGCAGCTTCCCCCATCCCATCCACTCTACATTCTCTACTCCAGCGGGACCACGGGAC
TGCCGAAGCCCATCGTCCACACTGCATTGGGCACCCTCCTGCAGCACAAGAAGGAACACCTGCTGCATTGCTCCA
TGTCTGCCTCGTCCCGCATGCTCTACTACACGACGACGTCGTGGATGATGTGGCACTGGAGCGTCGGCGCACTGG
CCGTCGGCGCTACCCTCGTCGTCTATTCGGGGTCGCCGTTCCGGCCACATTCGCATCTATCGTTGCCCCGAGTGC
TTTCCGACCTGGGCGTCACGCACTTCGGCACGTCGGCCGCCTACCTTACGGCTCTCGAAGCCAACAGCGTCCGTC
CGGTCGAGGAGCCGGGCCTGGATCTCTCGAAGTTGCAAGCCATCTATTCGACCGCCTCCCCGTTGCCGCCGTCGA
CCTTCAGGTTCGTGTACGACGCGTTCCCCAAGACGGTCAACCTGGCCTCCATCACAGGCGGAACAGACATCATCT
CGCTGTTCGGCGCTCCCTGCCCACTGCTCCCGGTCCGGACGGGAGAGATTCAGTGTGCCGGGCTGGGCATGGACA
TTCGGGTGGTGGACCCCGTTTCGGGGGAGGAGGTGGCCCCGGGCGAGACTGGGGACCTGGTCTGCGTCAAGCCCT
TCCCCTGCCAGCCGCTCACCTTCTTCGGCCCCGGGGGCGGCCAGAGGTACAGGGCGGCCTACTTCGAGCGGTTCC
GGGACGTGTGTGGAGCGGAGGGGCCGGTGTGGCATCACGGAGACTTCGTCAAGATGCCCAATGCGGCGACGGGAG
GCCTCGTGATGCTCGGCAGGTCTGACGGGGTTCTCAAACCTGCGGGCGTGCGGTTTGGCTCGGCGGAAATATACA
ACATCCTCACTCGGTTCTTCGGGTCGGAGGTGGAAGAGGCGGTGTGCGTTGGCCGGCGGCGTCCGACGGACGCAG
ACGAGACGGTCTGCCTCTTCGTCGTCATGGCTCCCGGAAAGAGGTTCGACGAGGAGGTCAGGGCACAGATCAAGG
CCAAGGTCCGGAGCGAGTTGAGTCCGAGGCACGTGCCCGGAGTGGTGGAGGAGTGCGGCAACGGGATACCCAAAA
CCAGCAATGGCAAGAAGTAAGCTCGCCGTTCTCTTCGCCCTCGCCCTCGTCTTTTCACATACTCACCAGGCGAAA
CAGGATCGAGGTCGCGGTGAAGCAGATTCTTTCGGGCATGGATGTCAAGACCAATGCCAGCGTTGCCAATCCAGA
GGCACTGGACTGGTTCAAGGTCTGGGCAAAGACACACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail