Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8326
Gene name
LocationContig_536:265..517
Strand-
Gene length (bp)252
Transcript length (bp)252
Coding sequence length (bp)252
Protein length (aa) 84

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05091 eIF-3_zeta Eukaryotic translation initiation factor 3 subunit 7 (eIF-3) 3.6E-13 18 66

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RFH6|EIF3D_MAGO7 Eukaryotic translation initiation factor 3 subunit D OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_00341 PE=3 SV=1 4 74 2.0E-25
sp|Q5AVZ0|EIF3D_EMENI Eukaryotic translation initiation factor 3 subunit D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7540 PE=3 SV=1 10 74 1.0E-22
sp|Q0UVG7|EIF3D_PHANO Eukaryotic translation initiation factor 3 subunit D OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_04247 PE=3 SV=1 8 74 3.0E-22
sp|Q2H5T8|EIF3D_CHAGB Eukaryotic translation initiation factor 3 subunit D OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05977 PE=3 SV=1 8 74 6.0E-22
sp|Q7S2I2|EIF3D_NEUCR Eukaryotic translation initiation factor 3 subunit D OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU07380 PE=3 SV=1 8 74 6.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RFH6|EIF3D_MAGO7 Eukaryotic translation initiation factor 3 subunit D OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_00341 PE=3 SV=1 4 74 2.0E-25
sp|Q5AVZ0|EIF3D_EMENI Eukaryotic translation initiation factor 3 subunit D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7540 PE=3 SV=1 10 74 1.0E-22
sp|Q0UVG7|EIF3D_PHANO Eukaryotic translation initiation factor 3 subunit D OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_04247 PE=3 SV=1 8 74 3.0E-22
sp|Q2H5T8|EIF3D_CHAGB Eukaryotic translation initiation factor 3 subunit D OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05977 PE=3 SV=1 8 74 6.0E-22
sp|Q7S2I2|EIF3D_NEUCR Eukaryotic translation initiation factor 3 subunit D OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU07380 PE=3 SV=1 8 74 6.0E-22
sp|A1DI25|EIF3D_NEOFI Eukaryotic translation initiation factor 3 subunit D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_089900 PE=3 SV=1 10 74 1.0E-21
sp|A1C777|EIF3D_ASPCL Eukaryotic translation initiation factor 3 subunit D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_072810 PE=3 SV=1 10 74 3.0E-21
sp|Q4X054|EIF3D_ASPFU Eukaryotic translation initiation factor 3 subunit D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G14670 PE=3 SV=1 10 74 4.0E-21
sp|B0XU47|EIF3D_ASPFC Eukaryotic translation initiation factor 3 subunit D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_030310 PE=3 SV=1 10 74 4.0E-21
sp|A5ABX6|EIF3D_ASPNC Eukaryotic translation initiation factor 3 subunit D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An15g03780 PE=3 SV=1 10 74 8.0E-21
sp|Q2UE04|EIF3D_ASPOR Eukaryotic translation initiation factor 3 subunit D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090026000811 PE=3 SV=1 10 74 6.0E-20
sp|Q1E4Z3|EIF3D_COCIM Eukaryotic translation initiation factor 3 subunit D OS=Coccidioides immitis (strain RS) GN=CIMG_02370 PE=3 SV=1 18 74 4.0E-19
sp|A7F8K7|EIF3D_SCLS1 Eukaryotic translation initiation factor 3 subunit D OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_13938 PE=3 SV=1 9 74 1.0E-18
sp|A6SJW6|EIF3D_BOTFB Eukaryotic translation initiation factor 3 subunit D OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_12797 PE=3 SV=2 10 74 2.0E-18
sp|Q6C1N1|EIF3D_YARLI Eukaryotic translation initiation factor 3 subunit D OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F14839g PE=3 SV=1 20 70 4.0E-11
sp|O94236|EIF3D_SCHPO Eukaryotic translation initiation factor 3 subunit D OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=moe1 PE=1 SV=1 9 67 9.0E-08
sp|Q554U9|EIF3D_DICDI Eukaryotic translation initiation factor 3 subunit D OS=Dictyostelium discoideum GN=eif3d PE=3 SV=1 19 59 1.0E-06
sp|A8X371|EIF3D_CAEBR Eukaryotic translation initiation factor 3 subunit D OS=Caenorhabditis briggsae GN=eif-3.D PE=3 SV=1 19 80 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0003743 translation initiation factor activity Yes
GO:0005852 eukaryotic translation initiation factor 3 complex Yes
GO:0044464 cell part No
GO:0005488 binding No
GO:0045182 translation regulator activity No
GO:0003674 molecular_function No
GO:0044424 intracellular part No
GO:0003676 nucleic acid binding No
GO:0032991 protein-containing complex No
GO:0008135 translation factor activity, RNA binding No
GO:0097159 organic cyclic compound binding No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0003723 RNA binding No
GO:0044444 cytoplasmic part No
GO:1901363 heterocyclic compound binding No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8326
MADSPDYVKICESCPPGDGWGPPVTLETTLNGVPYAPFSKGDKLGRMADWTTEGKDRERGGRMQYNRNYRGQSLL
AGPDFGPR*
Coding >Hirsu2|8326
ATGGCCGACTCGCCCGACTACGTCAAGATCTGTGAGAGCTGCCCGCCGGGCGACGGCTGGGGCCCTCCGGTCACG
CTGGAAACGACGCTCAACGGCGTGCCCTACGCTCCCTTCTCCAAGGGCGACAAGCTGGGCCGCATGGCCGACTGG
ACGACCGAGGGCAAAGACCGCGAGCGCGGCGGGCGCATGCAGTACAACCGCAACTACAGAGGTCAGTCACTCCTG
GCCGGCCCTGATTTTGGGCCTCGATGA
Transcript >Hirsu2|8326
ATGGCCGACTCGCCCGACTACGTCAAGATCTGTGAGAGCTGCCCGCCGGGCGACGGCTGGGGCCCTCCGGTCACG
CTGGAAACGACGCTCAACGGCGTGCCCTACGCTCCCTTCTCCAAGGGCGACAAGCTGGGCCGCATGGCCGACTGG
ACGACCGAGGGCAAAGACCGCGAGCGCGGCGGGCGCATGCAGTACAACCGCAACTACAGAGGTCAGTCACTCCTG
GCCGGCCCTGATTTTGGGCCTCGATGA
Gene >Hirsu2|8326
ATGGCCGACTCGCCCGACTACGTCAAGATCTGTGAGAGCTGCCCGCCGGGCGACGGCTGGGGCCCTCCGGTCACG
CTGGAAACGACGCTCAACGGCGTGCCCTACGCTCCCTTCTCCAAGGGCGACAAGCTGGGCCGCATGGCCGACTGG
ACGACCGAGGGCAAAGACCGCGAGCGCGGCGGGCGCATGCAGTACAACCGCAACTACAGAGGTCAGTCACTCCTG
GCCGGCCCTGATTTTGGGCCTCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail