Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8323
Gene name
LocationContig_535:10366..12354
Strand+
Gene length (bp)1988
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02913 FAD-oxidase_C FAD linked oxidases, C-terminal domain 2.2E-62 294 538
PF01565 FAD_binding_4 FAD binding domain 6.4E-36 121 256

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12627|DLD1_KLULA D-lactate dehydrogenase [cytochrome], mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DLD1 PE=3 SV=2 73 539 8.0E-136
sp|Q94AX4|DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana GN=DLD PE=1 SV=1 84 539 6.0E-133
sp|P32891|DLD1_YEAST D-lactate dehydrogenase [cytochrome] 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DLD1 PE=1 SV=2 82 539 1.0E-126
sp|Q86WU2|LDHD_HUMAN Probable D-lactate dehydrogenase, mitochondrial OS=Homo sapiens GN=LDHD PE=1 SV=1 84 539 3.0E-113
sp|Q7TNG8|LDHD_MOUSE Probable D-lactate dehydrogenase, mitochondrial OS=Mus musculus GN=Ldhd PE=1 SV=1 84 539 4.0E-112
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12627|DLD1_KLULA D-lactate dehydrogenase [cytochrome], mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DLD1 PE=3 SV=2 73 539 8.0E-136
sp|Q94AX4|DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana GN=DLD PE=1 SV=1 84 539 6.0E-133
sp|P32891|DLD1_YEAST D-lactate dehydrogenase [cytochrome] 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DLD1 PE=1 SV=2 82 539 1.0E-126
sp|Q86WU2|LDHD_HUMAN Probable D-lactate dehydrogenase, mitochondrial OS=Homo sapiens GN=LDHD PE=1 SV=1 84 539 3.0E-113
sp|Q7TNG8|LDHD_MOUSE Probable D-lactate dehydrogenase, mitochondrial OS=Mus musculus GN=Ldhd PE=1 SV=1 84 539 4.0E-112
sp|P94535|GLCD_BACSU Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) GN=glcD PE=3 SV=1 108 539 2.0E-70
sp|P0AEP9|GLCD_ECOLI Glycolate oxidase subunit GlcD OS=Escherichia coli (strain K12) GN=glcD PE=3 SV=1 76 537 1.0E-49
sp|P0AEQ0|GLCD_ECOL6 Glycolate oxidase subunit GlcD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glcD PE=3 SV=1 76 537 1.0E-49
sp|Q1JPD3|D2HDH_BOVIN D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Bos taurus GN=D2HGDH PE=2 SV=2 123 539 2.0E-43
sp|O29853|DLD_ARCFU D-lactate dehydrogenase (acceptor) OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=dld PE=1 SV=1 123 538 3.0E-43
sp|P46681|DLD2_YEAST D-lactate dehydrogenase [cytochrome] 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DLD2 PE=1 SV=1 10 537 5.0E-43
sp|Q7XI14|D2HDH_ORYSJ Probable D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Oryza sativa subsp. japonica GN=D2HGDH PE=3 SV=1 84 539 2.0E-42
sp|B8B7X6|D2HDH_ORYSI Probable D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Oryza sativa subsp. indica GN=D2HGDH PE=3 SV=1 84 539 2.0E-42
sp|Q8N465|D2HDH_HUMAN D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens GN=D2HGDH PE=1 SV=3 123 539 2.0E-42
sp|A1L258|D2HDH_DANRE D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Danio rerio GN=d2hgdh PE=2 SV=1 97 539 5.0E-42
sp|P9WIT1|Y2280_MYCTU Uncharacterized FAD-linked oxidoreductase Rv2280 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2280 PE=1 SV=1 104 539 1.0E-41
sp|P9WIT0|Y2280_MYCTO Uncharacterized FAD-linked oxidoreductase MT2338 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2338 PE=3 SV=1 104 539 1.0E-41
sp|P84850|D2HDH_RAT D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=D2hgdh PE=3 SV=1 110 539 3.0E-41
sp|Q8CIM3|D2HDH_MOUSE D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Mus musculus GN=D2hgdh PE=1 SV=3 110 539 8.0E-41
sp|Q9C1X2|YN53_SCHPO Putative D-lactate dehydrogenase C713.03, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.03 PE=3 SV=1 44 537 3.0E-39
sp|O23240|D2HDH_ARATH D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=D2HGDH PE=1 SV=3 82 539 7.0E-38
sp|P39976|DLD3_YEAST D-lactate dehydrogenase [cytochrome] 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DLD3 PE=1 SV=1 46 537 3.0E-35
sp|Q46911|YGCU_ECOLI Uncharacterized FAD-linked oxidoreductase YgcU OS=Escherichia coli (strain K12) GN=ygcU PE=3 SV=4 84 539 6.0E-24
sp|Q8X7S0|YGCU_ECO57 Uncharacterized FAD-linked oxidoreductase YgcU OS=Escherichia coli O157:H7 GN=ygcU PE=3 SV=1 84 290 7.0E-23
sp|Q9V778|ADAS_DROME Alkyldihydroxyacetonephosphate synthase OS=Drosophila melanogaster GN=CG10253 PE=2 SV=1 120 335 1.0E-22
sp|Q8C0I1|ADAS_MOUSE Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Mus musculus GN=Agps PE=1 SV=1 120 529 7.0E-22
sp|O45218|ADAS_CAEEL Alkyldihydroxyacetonephosphate synthase OS=Caenorhabditis elegans GN=ads-1 PE=2 SV=1 120 529 2.0E-21
sp|Q9EQR2|ADAS_RAT Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Rattus norvegicus GN=Agps PE=2 SV=1 120 529 1.0E-20
sp|P97275|ADAS_CAVPO Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Cavia porcellus GN=AGPS PE=1 SV=1 120 337 1.0E-20
sp|O00116|ADAS_HUMAN Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens GN=AGPS PE=1 SV=1 120 337 4.0E-20
sp|O96759|ADAS_DICDI Alkyldihydroxyacetonephosphate synthase OS=Dictyostelium discoideum GN=eapA PE=1 SV=1 120 331 1.0E-18
sp|P77748|YDIJ_ECOLI Uncharacterized protein YdiJ OS=Escherichia coli (strain K12) GN=ydiJ PE=3 SV=1 102 538 5.0E-18
sp|O97157|ADAS_TRYBB Alkyldihydroxyacetonephosphate synthase OS=Trypanosoma brucei brucei PE=3 SV=1 84 331 1.0E-16
sp|P09788|DH4C_PSEPU 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida GN=pchF PE=1 SV=3 82 294 7.0E-15
sp|P52073|GLCE_ECOLI Glycolate oxidase subunit GlcE OS=Escherichia coli (strain K12) GN=glcE PE=3 SV=1 152 299 2.0E-12
sp|Q57252|Y1163_HAEIN Uncharacterized protein HI_1163 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1163 PE=1 SV=1 120 538 2.0E-12
sp|Q9HDX8|ALO_SCHPO D-arabinono-1,4-lactone oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alo1 PE=3 SV=1 164 293 6.0E-07
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 69 297 7.0E-07
sp|Q7SGY1|ALO_NEUCR Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alo-1 PE=3 SV=1 106 320 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0003824 catalytic activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8323
MPKPPLGANRTASSTSSFPRGRRQQIALLAMGVVLGGATSAFAPGLTSPPTAAVETEPRWKVSGQRPVAAKSRYA
DRKTMLKAVDQIRNALGDDAVSMDETDLEEHGYSEWSTSNTDGRPVAIVRPASTEQVSAVAEICTRHRVPMVPFG
AGSSVEGNFSSPLSGICIDLGAMDRIVAFHPLDMDVVVQPGVNWARLNDDIKDSGLFLPLDPGPTASIGGMVGTN
CSGTNATRYGTMKDYVVNLTVVLADGSVIKTRKRPRKTSAGYNLNGLFVGSEGTLGIVTEITLKLATAPAQLSVA
MTSFPTIRQAADAASAIIRKGVSVTALELMDGVQMKVINRTGGAGGRTWAELPTLFIKFSGTDNGIAESVQSTRW
LAESHGCTSFEAADSADQIQTLWSARKQALWASLAVRPEGTQIWSTDVAVPLSRMAELIELSQERAAKLGLFNSI
LGHVGDGNFHQMIMYDPRVAEQRRGVEECVAAMVDDALDMEGTVSGEHGIGMGKKHCLAKEVDASTLGVMKALKD
ALDPHWLLNPGKVFDE*
Coding >Hirsu2|8323
ATGCCCAAACCACCTCTCGGGGCCAACCGCACGGCCTCCTCCACATCGTCCTTCCCGCGGGGCCGCCGCCAGCAG
ATTGCCTTGCTCGCGATGGGCGTGGTCCTGGGCGGCGCGACGAGCGCCTTTGCTCCCGGTTTGACGAGCCCCCCG
ACCGCGGCCGTAGAGACGGAGCCGCGGTGGAAGGTGAGCGGGCAACGCCCTGTAGCCGCCAAGTCTCGATATGCC
GACCGGAAGACGATGCTCAAGGCGGTCGATCAGATCCGCAATGCCTTGGGAGACGACGCCGTCAGCATGGATGAA
ACAGACTTGGAGGAGCATGGGTACTCGGAGTGGTCCACGTCCAACACGGACGGCAGGCCCGTCGCAATCGTCAGG
CCAGCATCGACCGAGCAGGTGTCGGCCGTGGCAGAGATATGCACCCGGCACAGGGTGCCGATGGTCCCGTTCGGA
GCCGGCTCCAGCGTCGAGGGAAACTTCAGCTCCCCTCTGTCCGGCATTTGTATAGACCTGGGCGCCATGGACAGG
ATAGTCGCCTTTCACCCACTCGACATGGATGTCGTGGTCCAGCCCGGGGTCAACTGGGCGAGGCTCAATGACGAC
ATCAAGGATTCTGGCCTGTTTCTGCCACTCGACCCGGGCCCGACGGCCTCGATCGGAGGCATGGTTGGCACGAAT
TGCAGCGGCACAAATGCCACCAGGTACGGCACCATGAAGGACTACGTTGTCAATCTGACGGTCGTCTTGGCCGAT
GGATCCGTCATCAAGACGAGAAAGCGGCCGCGGAAAACATCGGCGGGATACAACCTCAACGGACTGTTCGTCGGC
TCCGAGGGGACCCTGGGCATAGTTACGGAGATCACGCTCAAGTTGGCCACGGCGCCAGCCCAGCTCAGCGTGGCC
ATGACGTCGTTCCCGACGATTCGGCAAGCGGCAGACGCCGCCTCGGCCATCATCCGGAAGGGAGTGTCCGTCACG
GCCCTGGAGCTGATGGACGGCGTGCAGATGAAAGTCATCAACCGGACAGGAGGCGCCGGGGGCAGGACGTGGGCA
GAGCTCCCGACCCTGTTCATCAAGTTCTCCGGCACGGACAACGGCATCGCCGAGAGCGTCCAGTCGACCCGATGG
CTGGCCGAGTCGCACGGCTGCACGTCTTTCGAAGCTGCCGACTCGGCCGATCAGATACAGACTCTGTGGTCGGCG
AGAAAGCAGGCCTTGTGGGCGTCTCTCGCCGTCAGGCCCGAGGGCACGCAGATCTGGTCGACGGACGTGGCAGTG
CCTCTGTCAAGGATGGCCGAATTGATCGAGCTGTCGCAGGAGAGGGCGGCGAAGCTCGGCCTGTTCAACAGCATT
CTGGGCCACGTCGGCGACGGCAACTTTCACCAGATGATCATGTACGACCCGCGCGTCGCGGAACAGCGCAGAGGC
GTGGAAGAATGCGTCGCTGCCATGGTCGACGACGCGCTCGACATGGAGGGCACTGTATCGGGTGAGCATGGGATC
GGTATGGGGAAGAAGCACTGTCTCGCAAAGGAGGTGGACGCATCGACTCTGGGCGTCATGAAGGCCTTGAAAGAT
GCCCTCGATCCACATTGGCTGTTGAACCCAGGCAAGGTATTCGACGAATAA
Transcript >Hirsu2|8323
ATGCCCAAACCACCTCTCGGGGCCAACCGCACGGCCTCCTCCACATCGTCCTTCCCGCGGGGCCGCCGCCAGCAG
ATTGCCTTGCTCGCGATGGGCGTGGTCCTGGGCGGCGCGACGAGCGCCTTTGCTCCCGGTTTGACGAGCCCCCCG
ACCGCGGCCGTAGAGACGGAGCCGCGGTGGAAGGTGAGCGGGCAACGCCCTGTAGCCGCCAAGTCTCGATATGCC
GACCGGAAGACGATGCTCAAGGCGGTCGATCAGATCCGCAATGCCTTGGGAGACGACGCCGTCAGCATGGATGAA
ACAGACTTGGAGGAGCATGGGTACTCGGAGTGGTCCACGTCCAACACGGACGGCAGGCCCGTCGCAATCGTCAGG
CCAGCATCGACCGAGCAGGTGTCGGCCGTGGCAGAGATATGCACCCGGCACAGGGTGCCGATGGTCCCGTTCGGA
GCCGGCTCCAGCGTCGAGGGAAACTTCAGCTCCCCTCTGTCCGGCATTTGTATAGACCTGGGCGCCATGGACAGG
ATAGTCGCCTTTCACCCACTCGACATGGATGTCGTGGTCCAGCCCGGGGTCAACTGGGCGAGGCTCAATGACGAC
ATCAAGGATTCTGGCCTGTTTCTGCCACTCGACCCGGGCCCGACGGCCTCGATCGGAGGCATGGTTGGCACGAAT
TGCAGCGGCACAAATGCCACCAGGTACGGCACCATGAAGGACTACGTTGTCAATCTGACGGTCGTCTTGGCCGAT
GGATCCGTCATCAAGACGAGAAAGCGGCCGCGGAAAACATCGGCGGGATACAACCTCAACGGACTGTTCGTCGGC
TCCGAGGGGACCCTGGGCATAGTTACGGAGATCACGCTCAAGTTGGCCACGGCGCCAGCCCAGCTCAGCGTGGCC
ATGACGTCGTTCCCGACGATTCGGCAAGCGGCAGACGCCGCCTCGGCCATCATCCGGAAGGGAGTGTCCGTCACG
GCCCTGGAGCTGATGGACGGCGTGCAGATGAAAGTCATCAACCGGACAGGAGGCGCCGGGGGCAGGACGTGGGCA
GAGCTCCCGACCCTGTTCATCAAGTTCTCCGGCACGGACAACGGCATCGCCGAGAGCGTCCAGTCGACCCGATGG
CTGGCCGAGTCGCACGGCTGCACGTCTTTCGAAGCTGCCGACTCGGCCGATCAGATACAGACTCTGTGGTCGGCG
AGAAAGCAGGCCTTGTGGGCGTCTCTCGCCGTCAGGCCCGAGGGCACGCAGATCTGGTCGACGGACGTGGCAGTG
CCTCTGTCAAGGATGGCCGAATTGATCGAGCTGTCGCAGGAGAGGGCGGCGAAGCTCGGCCTGTTCAACAGCATT
CTGGGCCACGTCGGCGACGGCAACTTTCACCAGATGATCATGTACGACCCGCGCGTCGCGGAACAGCGCAGAGGC
GTGGAAGAATGCGTCGCTGCCATGGTCGACGACGCGCTCGACATGGAGGGCACTGTATCGGGTGAGCATGGGATC
GGTATGGGGAAGAAGCACTGTCTCGCAAAGGAGGTGGACGCATCGACTCTGGGCGTCATGAAGGCCTTGAAAGAT
GCCCTCGATCCACATTGGCTGTTGAACCCAGGCAAGGTATTCGACGAATAA
Gene >Hirsu2|8323
ATGCCCAAACCACCTCTCGGGGCCAACCGCACGGCCTCCTCCACATCGTCCTTCCCGCGGGGCCGCCGCCAGCAG
ATTGCCTTGCTCGCGATGGGCGTGGTCCTGGGCGGCGCGACGAGCGCCTTTGCTCCCGGTTTGACGAGCCCCCCG
ACCGCGGCCGTAGAGACGGAGCCGCGGTGGAAGGTGAGCGGGCAACGCCCTGTAGCCGCCAAGTCTCGATATGCC
GACCGGAAGACGATGCTCAAGGTACGTCGCCGGTGCTCCGTGAGCTGGTGCACGCGTGCTTAGGGCCGGCAGGCG
GTCGATCAGATCCGCAATGCCTTGGGAGACGACGCCGTCAGCATGGATGAAACAGACTTGGAGGAGCATGGGTAC
TCGGAGTGGTCCACGTCCAACACGGACGGCAGGCCCGTCGCAATCGTCAGGCCAGCATCGACCGAGCAGGTGTCG
GCCGTGGCAGAGATATGCACCCGGCACAGGGTGCCGATGGTCCCGTTCGGAGCCGGCTCCAGCGTCGAGGGAAAC
TTCAGCTCCCCTCTGTCCGGCATTTGTATAGACCTGGGCGCCATGGACAGGATAGTCGCCTTTCACCCACTCGAC
ATGGATGTCGTGGTCCAGCCCGGGGTCAACTGGGCGAGGCTCAATGACGACATCAAGGATTCTGGCCTGTTTCTG
CCACTCGACCCGGGCCCGACGGCCTCGATCGGAGGCATGGTTGGCACGAATTGCAGCGGCACAAATGCCACCAGG
TACGGCACCATGAAGGACTACGTTGTCAATCTGACGGTCGTCTTGGCCGATGGATCCGTCATCAAGACGAGAAAG
CGGCCGCGGAAAACATCGGCGGGATACAACCTCAACGGACTGTTCGTCGGCTCCGAGGGGACCCTGGGCATAGTT
ACGGAGATCACGCTCAAGTTGGCCACGGCGCCAGCCCAGCTCAGCGTGGCCATGACGTCGTTCCCGACGATTCGG
CAAGCGGCAGACGCCGCCTCGGCCATCATCCGGAAGGGAGTGTCCGTCACGGCCCTGGAGCTGATGGACGGCGTG
CAGATGAAAGTCATCAACCGGACAGGAGGCGCCGGGGGCAGGACGTGGGCAGAGCTCCCGACCCTGTTCATCAAG
TAGGCCGCGCTGGCGAGCCTCCTGTGGGGGGACAGAAAAAGATGGGGCTGATTTAGGCGTCCGTAGGTTCTCCGG
CACGGACAACGGCATCGCCGAGAGCGTCCAGTCGACCCGATGGCTGGCCGAGTCGCACGGCTGCACGTCTTTCGA
AGCTGCCGACTCGGCCGATCAGATACAGACTCTGTGGTCGGCGAGAAAGCAGGCCTTGTGGGCGTCTCTCGCCGT
CAGGCCCGAGGGCACGCAGATCTGGTCGACGGACGTGGCAGTGCCTCTGTCAAGGATGGCCGAATTGATCGGTAC
GTTTGATAACCCTGGCGGACGGCGAACGCTGACGGCCCGGACCAGAGCTGTCGCAGGAGAGGGCGGCGAAGCTCG
GCCTGTTCAACAGCATTCTGGGCCACGTCGGCGACGGCAACTTTCACCAGATGATCATGTACGACCCGCGCGTCG
CGGAACAGCGCAGAGGCGTGGAAGAATGCGTCGCTGCCATGGTCGACGACGCGCTCGACATGGAGGGCACTGTAT
CGGTGAGGCTGGCAGGCTGGTCATTCCCGACGGGCCCTGTGACTGACTTGAGAGTGGAAGGGTGAGCATGGGATC
GGTATGGGGAAGAAGGTGGGCAACGCCGCAGTCCCTGAGGTTGGCTTCCCGAACGACTGACACGGAACTCGCAGC
ACTGTCTCGCAAAGGAGGTGGACGCATCGACTCTGGGCGTCATGAAGGCCTTGAAAGATGCCCTCGATCCACAGT
AAGCGCCCAGACCCAGGCCTGATCCGCTGCCGTACTCTTGTCCCCCGACCTTGCGACGGAAGCTGAGCCGGTTTA
GTTGGCTGTTGAACCCAGGCAAGGTATTCGACGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail