Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8321
Gene name
LocationContig_535:7834..8356
Strand-
Gene length (bp)522
Transcript length (bp)522
Coding sequence length (bp)522
Protein length (aa) 174

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 2.4E-21 7 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52041|HBD_CLOAB 3-hydroxybutyryl-CoA dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hbd PE=1 SV=2 7 173 4.0E-09
sp|Q9WVK7|HCDH_RAT Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Hadh PE=2 SV=1 54 173 9.0E-09
sp|Q61425|HCDH_MOUSE Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus GN=Hadh PE=1 SV=2 54 173 9.0E-09
sp|Q98CR3|LCDH_RHILO L-carnitine dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=lcdH PE=3 SV=1 14 173 2.0E-08
sp|P34439|HCDH1_CAEEL Probable 3-hydroxyacyl-CoA dehydrogenase F54C8.1 OS=Caenorhabditis elegans GN=F54C8.1 PE=1 SV=1 7 173 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52041|HBD_CLOAB 3-hydroxybutyryl-CoA dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hbd PE=1 SV=2 7 173 4.0E-09
sp|Q9WVK7|HCDH_RAT Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Hadh PE=2 SV=1 54 173 9.0E-09
sp|Q61425|HCDH_MOUSE Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus GN=Hadh PE=1 SV=2 54 173 9.0E-09
sp|Q98CR3|LCDH_RHILO L-carnitine dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=lcdH PE=3 SV=1 14 173 2.0E-08
sp|P34439|HCDH1_CAEEL Probable 3-hydroxyacyl-CoA dehydrogenase F54C8.1 OS=Caenorhabditis elegans GN=F54C8.1 PE=1 SV=1 7 173 2.0E-08
sp|P00348|HCDH_PIG Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Sus scrofa GN=HADH PE=1 SV=2 54 173 3.0E-08
sp|Q16836|HCDH_HUMAN Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens GN=HADH PE=1 SV=3 48 173 3.0E-08
sp|Q5LTH8|LCDH_RUEPO L-carnitine dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=lcdH PE=3 SV=1 14 173 1.0E-07
sp|Q29554|ECHA_PIG Trifunctional enzyme subunit alpha, mitochondrial OS=Sus scrofa GN=HADHA PE=1 SV=1 52 145 8.0E-07
sp|Q4V182|LCDH_BACCZ L-carnitine dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=lcdH PE=3 SV=1 14 173 8.0E-07
sp|Q39659|MFPA_CUCSA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Cucumis sativus PE=1 SV=1 64 173 2.0E-06
sp|A1RI92|FADJ_SHESW Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadJ PE=3 SV=1 17 173 2.0E-06
sp|P83589|HCDH_DEIRA Probable 3-hydroxyacyl-CoA dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_2477 PE=1 SV=2 53 173 3.0E-06
sp|Q7MIS5|FADJ_VIBVY Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain YJ016) GN=fadJ PE=3 SV=1 15 173 9.0E-06
sp|Q8DB47|FADJ_VIBVU Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain CMCP6) GN=fadJ PE=3 SV=1 15 173 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006631 fatty acid metabolic process Yes
GO:0016491 oxidoreductase activity Yes
GO:0003857 3-hydroxyacyl-CoA dehydrogenase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0071704 organic substance metabolic process No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0003674 molecular_function No
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0009987 cellular process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0019752 carboxylic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0006082 organic acid metabolic process No
GO:0003824 catalytic activity No
GO:0032787 monocarboxylic acid metabolic process No
GO:0044281 small molecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8321
LSSSLAAEWWAAGGYDVHIRDPSEEQRAAALHYWANNMTQHPGGKQGTVQAFEDLAAAVDRSWLVVEAVPEKLSV
KVSTFVELERVAPADCVMCSNSSSFKSWEMVEERQVSTRRRVLSMHYYMPPDNVVVELMTDGDTDPDILAFLADK
CRGVGLHPYVARTESAGLIFNRL*
Coding >Hirsu2|8321
CTGTCGTCGTCCTTGGCGGCGGAGTGGTGGGCTGCCGGCGGCTATGACGTCCACATCCGCGACCCCAGCGAGGAG
CAGAGGGCGGCGGCGCTGCATTACTGGGCCAACAACATGACCCAGCATCCCGGCGGCAAGCAGGGGACCGTCCAG
GCCTTCGAGGACCTGGCGGCGGCCGTCGACAGGTCGTGGTTGGTGGTCGAGGCCGTGCCCGAGAAGCTCTCGGTC
AAGGTGTCGACCTTTGTCGAGCTGGAGAGGGTGGCGCCCGCGGACTGCGTCATGTGCAGCAACTCGTCGTCGTTC
AAGTCGTGGGAGATGGTGGAGGAGCGGCAGGTGTCGACGAGGAGGCGCGTCCTCAGCATGCACTACTACATGCCC
CCCGACAACGTCGTCGTCGAGCTCATGACCGACGGCGACACCGACCCGGACATCTTGGCCTTCCTGGCCGACAAG
TGCCGGGGCGTCGGCCTGCACCCGTACGTGGCCCGCACAGAGTCGGCCGGCCTCATCTTCAACCGCCTGTAG
Transcript >Hirsu2|8321
CTGTCGTCGTCCTTGGCGGCGGAGTGGTGGGCTGCCGGCGGCTATGACGTCCACATCCGCGACCCCAGCGAGGAG
CAGAGGGCGGCGGCGCTGCATTACTGGGCCAACAACATGACCCAGCATCCCGGCGGCAAGCAGGGGACCGTCCAG
GCCTTCGAGGACCTGGCGGCGGCCGTCGACAGGTCGTGGTTGGTGGTCGAGGCCGTGCCCGAGAAGCTCTCGGTC
AAGGTGTCGACCTTTGTCGAGCTGGAGAGGGTGGCGCCCGCGGACTGCGTCATGTGCAGCAACTCGTCGTCGTTC
AAGTCGTGGGAGATGGTGGAGGAGCGGCAGGTGTCGACGAGGAGGCGCGTCCTCAGCATGCACTACTACATGCCC
CCCGACAACGTCGTCGTCGAGCTCATGACCGACGGCGACACCGACCCGGACATCTTGGCCTTCCTGGCCGACAAG
TGCCGGGGCGTCGGCCTGCACCCGTACGTGGCCCGCACAGAGTCGGCCGGCCTCATCTTCAACCGCCTGTAG
Gene >Hirsu2|8321
CTGTCGTCGTCCTTGGCGGCGGAGTGGTGGGCTGCCGGCGGCTATGACGTCCACATCCGCGACCCCAGCGAGGAG
CAGAGGGCGGCGGCGCTGCATTACTGGGCCAACAACATGACCCAGCATCCCGGCGGCAAGCAGGGGACCGTCCAG
GCCTTCGAGGACCTGGCGGCGGCCGTCGACAGGTCGTGGTTGGTGGTCGAGGCCGTGCCCGAGAAGCTCTCGGTC
AAGGTGTCGACCTTTGTCGAGCTGGAGAGGGTGGCGCCCGCGGACTGCGTCATGTGCAGCAACTCGTCGTCGTTC
AAGTCGTGGGAGATGGTGGAGGAGCGGCAGGTGTCGACGAGGAGGCGCGTCCTCAGCATGCACTACTACATGCCC
CCCGACAACGTCGTCGTCGAGCTCATGACCGACGGCGACACCGACCCGGACATCTTGGCCTTCCTGGCCGACAAG
TGCCGGGGCGTCGGCCTGCACCCGTACGTGGCCCGCACAGAGTCGGCCGGCCTCATCTTCAACCGCCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail