Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8318
Gene name
LocationContig_534:16382..16664
Strand-
Gene length (bp)282
Transcript length (bp)216
Coding sequence length (bp)216
Protein length (aa) 72

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion|Endoplasmic reticulum Transmembrane domain|Mitochondrial transit peptide 0.1024 0.1704 0.1296 0.1978 0.8183 0.1339 0.7434 0.4157 0.6214 0.0305

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 10 32 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4110
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1128
Ophiocordyceps australis map64 (Brazil) OphauB2|4946
Ophiocordyceps camponoti-floridani Ophcf2|04360
Ophiocordyceps camponoti-rufipedis Ophun1|3040
Ophiocordyceps kimflemingae Ophio5|3156
Ophiocordyceps subramaniannii Hirsu2|8318 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8318
MLTAPSSWTLTSLFGFLFGCVLAGGGVYSYLVQEYKASNDLLTEDIYTLQASVNRLSTYVKTLEEKIPGKK*
Coding >Hirsu2|8318
ATGCTGACGGCTCCCTCCTCGTGGACCTTGACCAGCCTCTTCGGCTTCCTCTTCGGCTGCGTCCTCGCCGGCGGC
GGCGTCTATAGCTACCTCGTCCAGGAATACAAGGCCTCCAACGACCTGCTGACCGAGGACATCTACACGCTGCAA
GCTTCCGTCAACCGCCTCTCCACCTACGTCAAGACGCTCGAGGAAAAGATACCAGGCAAGAAGTGA
Transcript >Hirsu2|8318
ATGCTGACGGCTCCCTCCTCGTGGACCTTGACCAGCCTCTTCGGCTTCCTCTTCGGCTGCGTCCTCGCCGGCGGC
GGCGTCTATAGCTACCTCGTCCAGGAATACAAGGCCTCCAACGACCTGCTGACCGAGGACATCTACACGCTGCAA
GCTTCCGTCAACCGCCTCTCCACCTACGTCAAGACGCTCGAGGAAAAGATACCAGGCAAGAAGTGA
Gene >Hirsu2|8318
ATGCTGACGGCTCCCTCCTCGTGGACCTTGACCAGCCTCTTCGGCTTCCTCTTCGGCTGCGTCCTCGCCGGCGGC
GGCGTCTATAGCTACCTCGTCCAGGAATACAAGGCCTCCAACGACCTGCTGACCGAGGACATCTACGTGCGTTCC
CCCTCCCAGTCTACTACAGCGGCGGCCCCGGGCGTGGTGCTGACCACGGCTTCTCAGACGCTGCAAGCTTCCGTC
AACCGCCTCTCCACCTACGTCAAGACGCTCGAGGAAAAGATACCAGGCAAGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail