Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8314
Gene name
LocationContig_534:8780..10026
Strand+
Gene length (bp)1246
Transcript length (bp)1104
Coding sequence length (bp)1104
Protein length (aa) 368

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00141 peroxidase Peroxidase 1.8E-49 105 327

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4ING3|CCPR_GIBZE Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CCP1 PE=3 SV=1 1 366 0.0E+00
sp|Q7SDV9|CCPR_NEUCR Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccp-1 PE=3 SV=1 12 361 0.0E+00
sp|A4QVH4|CCPR_MAGO7 Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CCP1 PE=3 SV=1 1 363 0.0E+00
sp|Q4WPF8|CCPR_ASPFU Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccp1 PE=3 SV=1 14 361 9.0E-163
sp|P0C0V3|CCPR_EMENI Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccp1 PE=3 SV=1 8 361 1.0E-155
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4ING3|CCPR_GIBZE Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CCP1 PE=3 SV=1 1 366 0.0E+00
sp|Q7SDV9|CCPR_NEUCR Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccp-1 PE=3 SV=1 12 361 0.0E+00
sp|A4QVH4|CCPR_MAGO7 Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CCP1 PE=3 SV=1 1 363 0.0E+00
sp|Q4WPF8|CCPR_ASPFU Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccp1 PE=3 SV=1 14 361 9.0E-163
sp|P0C0V3|CCPR_EMENI Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccp1 PE=3 SV=1 8 361 1.0E-155
sp|Q4PBY6|CCPR_USTMA Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCP1 PE=3 SV=1 73 348 2.0E-137
sp|P0CP54|CCPR_CRYNJ Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CCP1 PE=3 SV=1 31 348 2.0E-133
sp|P0CP55|CCPR_CRYNB Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CCP1 PE=3 SV=1 31 348 2.0E-133
sp|Q6URB0|CCPR_CRYNH Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CCP1 PE=3 SV=1 31 348 5.0E-133
sp|Q6C0Z6|CCPR_YARLI Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCP1 PE=3 SV=1 80 362 3.0E-123
sp|Q4PD66|CCPR2_USTMA Putative heme-binding peroxidase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCP2 PE=3 SV=1 91 347 2.0E-104
sp|Q6CAB5|CCPR2_YARLI Putative cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D04268g PE=3 SV=1 112 347 3.0E-97
sp|Q5B1Z0|CCPR2_EMENI Putative heme-binding peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5440 PE=3 SV=1 91 347 1.0E-95
sp|A4R606|CCPR2_MAGO7 Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_10368 PE=3 SV=1 91 347 1.0E-93
sp|Q4HWQ2|CCPR2_GIBZE Putative heme-binding peroxidase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_10606 PE=3 SV=1 88 347 3.0E-92
sp|Q4WLG9|CCPR2_ASPFU Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G13570 PE=3 SV=1 91 347 4.0E-91
sp|Q6FMG7|CCPR_CANGA Cytochrome c peroxidase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0K08184g PE=3 SV=1 91 349 5.0E-87
sp|Q5AEN1|CCPR_CANAL Cytochrome c peroxidase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCP1 PE=3 SV=1 75 349 4.0E-86
sp|Q6BKY9|CCPR_DEBHA Cytochrome c peroxidase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCP1 PE=3 SV=1 72 363 3.0E-85
sp|P0CP56|CCPR2_CRYNJ Putative heme-binding peroxidase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNE03890 PE=3 SV=1 91 347 1.0E-83
sp|P0CP57|CCPR2_CRYNB Putative heme-binding peroxidase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBE3880 PE=3 SV=1 91 347 1.0E-83
sp|Q6CW24|CCPR_KLULA Cytochrome c peroxidase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCP1 PE=3 SV=1 92 349 6.0E-83
sp|P00431|CCPR_YEAST Cytochrome c peroxidase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCP1 PE=1 SV=2 90 349 9.0E-82
sp|Q59X94|CCPR2_CANAL Putative heme-binding peroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCP2 PE=3 SV=1 92 347 2.0E-79
sp|Q6BIB1|CCPR2_DEBHA Putative heme-binding peroxidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G12166g PE=3 SV=3 93 347 8.0E-79
sp|Q6C7U1|CCPR3_YARLI Putative heme-binding peroxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D25366g PE=3 SV=1 81 346 1.0E-72
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 116 346 1.0E-70
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 116 346 2.0E-70
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 113 346 4.0E-70
sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 113 346 6.0E-70
sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 91 351 2.0E-69
sp|Q05431|APX1_ARATH L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2 90 351 4.0E-69
sp|A2XFC7|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1 91 351 1.0E-68
sp|P48534|APX1_PEA L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2 91 346 2.0E-67
sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 88 351 2.0E-67
sp|Q9FE01|APX2_ORYSJ L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1 90 346 9.0E-66
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 116 346 2.0E-59
sp|Q69SV0|APX8_ORYSJ Probable L-ascorbate peroxidase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=APX8 PE=2 SV=2 116 349 3.0E-57
sp|Q7XJ02|APX7_ORYSJ Probable L-ascorbate peroxidase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=APX7 PE=2 SV=1 116 349 8.0E-57
sp|P0C0L1|APX6_ORYSJ Probable L-ascorbate peroxidase 6, chloroplastic OS=Oryza sativa subsp. japonica GN=APX6 PE=2 SV=1 113 349 7.0E-54
sp|Q42593|APXT_ARATH L-ascorbate peroxidase T, chloroplastic OS=Arabidopsis thaliana GN=APXT PE=2 SV=2 116 349 3.0E-53
sp|P0C0L0|APX5_ORYSJ Probable L-ascorbate peroxidase 5, chloroplastic OS=Oryza sativa subsp. japonica GN=APX5 PE=2 SV=1 116 349 9.0E-53
sp|Q42592|APXS_ARATH L-ascorbate peroxidase S, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=APXS PE=1 SV=2 97 349 4.0E-52
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 118 346 3.0E-31
sp|Q9KEE6|KATG_BACHD Catalase-peroxidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=katG PE=3 SV=1 91 343 5.0E-25
sp|Q21DT6|KATG_SACD2 Catalase-peroxidase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=katG PE=3 SV=1 91 342 2.0E-24
sp|Q2JBP8|KATG_FRASC Catalase-peroxidase OS=Frankia sp. (strain CcI3) GN=katG PE=3 SV=1 110 342 1.0E-23
sp|Q9WXB9|KATG2_LEGPN Catalase-peroxidase 2 OS=Legionella pneumophila GN=katG2 PE=2 SV=1 91 344 5.0E-23
sp|Q5ZZ17|KATG2_LEGPH Catalase-peroxidase 2 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=katG2 PE=3 SV=1 91 344 5.0E-23
sp|Q5X8J8|KATG2_LEGPA Catalase-peroxidase 2 OS=Legionella pneumophila (strain Paris) GN=katG2 PE=3 SV=1 91 344 6.0E-23
sp|A5IA67|KATG2_LEGPC Catalase-peroxidase 2 OS=Legionella pneumophila (strain Corby) GN=katG2 PE=3 SV=1 91 344 6.0E-23
sp|Q67LP5|KATG_SYMTH Catalase-peroxidase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=katG PE=3 SV=1 91 342 6.0E-23
sp|Q5WZY1|KATG2_LEGPL Catalase-peroxidase 2 OS=Legionella pneumophila (strain Lens) GN=katG2 PE=3 SV=1 91 344 7.0E-23
sp|Q1GR67|KATG_SPHAL Catalase-peroxidase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=katG PE=3 SV=1 91 342 9.0E-23
sp|Q66E82|KATG_YERPS Catalase-peroxidase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=katG PE=3 SV=1 91 342 1.0E-22
sp|A4TQ37|KATG_YERPP Catalase-peroxidase OS=Yersinia pestis (strain Pestoides F) GN=katG PE=3 SV=1 91 342 1.0E-22
sp|Q1CLM4|KATG_YERPN Catalase-peroxidase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=katG PE=3 SV=1 91 342 1.0E-22
sp|A9R0X4|KATG_YERPG Catalase-peroxidase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=katG PE=3 SV=1 91 342 1.0E-22
sp|Q9X6B0|KATG_YERPE Catalase-peroxidase OS=Yersinia pestis GN=katG PE=1 SV=1 91 342 1.0E-22
sp|B2K5B9|KATG_YERPB Catalase-peroxidase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=katG PE=3 SV=1 91 342 1.0E-22
sp|Q1C435|KATG_YERPA Catalase-peroxidase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=katG PE=3 SV=1 91 342 1.0E-22
sp|A7FLT3|KATG_YERP3 Catalase-peroxidase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=katG PE=3 SV=1 91 342 1.0E-22
sp|Q28S09|KATG_JANSC Catalase-peroxidase OS=Jannaschia sp. (strain CCS1) GN=katG PE=3 SV=1 91 342 1.0E-22
sp|B1JJB5|KATG_YERPY Catalase-peroxidase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=katG PE=3 SV=1 91 342 1.0E-22
sp|B4R8U3|KATG_PHEZH Catalase-peroxidase OS=Phenylobacterium zucineum (strain HLK1) GN=katG PE=3 SV=1 110 342 2.0E-22
sp|P0C8F0|KATG_ECOLX Catalase-peroxidase OS=Escherichia coli GN=katG PE=3 SV=1 110 342 3.0E-22
sp|Q7BSW8|KATG2_ECO57 Catalase-peroxidase 2 OS=Escherichia coli O157:H7 GN=katG2 PE=3 SV=1 110 342 3.0E-22
sp|A6VVN4|KATG_MARMS Catalase-peroxidase OS=Marinomonas sp. (strain MWYL1) GN=katG PE=3 SV=1 91 342 3.0E-22
sp|C6DYB7|KATG_GEOSM Catalase-peroxidase OS=Geobacter sp. (strain M21) GN=katG PE=3 SV=1 91 342 4.0E-22
sp|Q8D951|KATG_VIBVU Catalase-peroxidase OS=Vibrio vulnificus (strain CMCP6) GN=katG PE=3 SV=1 91 342 1.0E-21
sp|A4T0J1|KATG_POLSQ Catalase-peroxidase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=katG PE=3 SV=1 112 342 1.0E-21
sp|Q7MLC1|KATG_VIBVY Catalase-peroxidase OS=Vibrio vulnificus (strain YJ016) GN=katG PE=3 SV=1 91 342 1.0E-21
sp|Q7UUW9|KATG_RHOBA Catalase-peroxidase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=katG PE=3 SV=1 91 342 1.0E-21
sp|A8F6I7|KATG_PSELT Catalase-peroxidase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=katG PE=3 SV=1 91 342 2.0E-21
sp|A4SS04|KATG_AERS4 Catalase-peroxidase OS=Aeromonas salmonicida (strain A449) GN=katG PE=3 SV=1 74 342 2.0E-21
sp|P73911|KATG_SYNY3 Catalase-peroxidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=katG PE=1 SV=1 112 342 2.0E-21
sp|A8EV24|KATG_ARCB4 Catalase-peroxidase OS=Arcobacter butzleri (strain RM4018) GN=katG PE=3 SV=1 88 342 3.0E-21
sp|Q486C8|KATG_COLP3 Catalase-peroxidase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=katG PE=3 SV=1 112 342 3.0E-21
sp|A1REM5|KATG_SHESW Catalase-peroxidase OS=Shewanella sp. (strain W3-18-1) GN=katG PE=3 SV=1 112 342 4.0E-21
sp|A4Y2G4|KATG_SHEPC Catalase-peroxidase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=katG PE=3 SV=1 112 342 4.0E-21
sp|Q082Q2|KATG1_SHEFN Catalase-peroxidase 1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=katG1 PE=3 SV=2 91 342 5.0E-21
sp|A5IF70|KATG1_LEGPC Catalase-peroxidase 1 OS=Legionella pneumophila (strain Corby) GN=katG1 PE=3 SV=1 112 342 6.0E-21
sp|Q5X2D9|KATG1_LEGPA Catalase-peroxidase 1 OS=Legionella pneumophila (strain Paris) GN=katG1 PE=3 SV=1 112 342 7.0E-21
sp|Q5YVJ4|KATG_NOCFA Catalase-peroxidase OS=Nocardia farcinica (strain IFM 10152) GN=katG PE=3 SV=1 91 342 7.0E-21
sp|B0TYQ6|KATG_FRAP2 Catalase-peroxidase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=katG PE=3 SV=1 110 342 7.0E-21
sp|A1SWM1|KATG_PSYIN Catalase-peroxidase OS=Psychromonas ingrahamii (strain 37) GN=katG PE=3 SV=1 112 342 8.0E-21
sp|A0Q5L1|KATG_FRATN Catalase-peroxidase OS=Francisella tularensis subsp. novicida (strain U112) GN=katG PE=3 SV=1 110 342 8.0E-21
sp|Q3IQZ9|KATG_NATPD Catalase-peroxidase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=katG PE=3 SV=1 91 348 1.0E-20
sp|Q5WU58|KATG1_LEGPL Catalase-peroxidase 1 OS=Legionella pneumophila (strain Lens) GN=katG1 PE=3 SV=1 112 342 1.0E-20
sp|B2SDI5|KATG_FRATM Catalase-peroxidase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=katG PE=3 SV=1 110 342 1.0E-20
sp|Q5NGV7|KATG_FRATT Catalase-peroxidase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=katG PE=1 SV=1 110 342 1.0E-20
sp|Q14IA9|KATG_FRAT1 Catalase-peroxidase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=katG PE=3 SV=1 110 342 1.0E-20
sp|A4IZ86|KATG_FRATW Catalase-peroxidase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=katG PE=3 SV=1 110 342 1.0E-20
sp|A0QYP1|KATG3_MYCS2 Catalase-peroxidase 3 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=katG3 PE=3 SV=2 90 345 1.0E-20
sp|Q0HQB2|KATG1_SHESR Catalase-peroxidase 1 OS=Shewanella sp. (strain MR-7) GN=katG1 PE=3 SV=1 112 342 1.0E-20
sp|Q9ZGM4|KATG1_LEGPN Catalase-peroxidase 1 OS=Legionella pneumophila GN=katG1 PE=2 SV=1 112 342 1.0E-20
sp|Q5ZSX7|KATG1_LEGPH Catalase-peroxidase 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=katG1 PE=3 SV=2 112 342 1.0E-20
sp|A0KRY0|KATG1_SHESA Catalase-peroxidase 1 OS=Shewanella sp. (strain ANA-3) GN=katG1 PE=3 SV=1 112 342 1.0E-20
sp|Q5V0S5|KATG1_HALMA Catalase-peroxidase 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=katG1 PE=3 SV=1 110 348 2.0E-20
sp|Q0BKW5|KATG_FRATO Catalase-peroxidase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=katG PE=3 SV=1 110 342 2.0E-20
sp|Q2A298|KATG_FRATH Catalase-peroxidase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=katG PE=3 SV=2 110 342 2.0E-20
sp|A7NDL0|KATG_FRATF Catalase-peroxidase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=katG PE=3 SV=1 110 342 2.0E-20
sp|Q0HNH6|KATG1_SHESM Catalase-peroxidase 1 OS=Shewanella sp. (strain MR-4) GN=katG1 PE=3 SV=1 112 342 2.0E-20
sp|Q5KZ91|KATG_GEOKA Catalase-peroxidase OS=Geobacillus kaustophilus (strain HTA426) GN=katG PE=3 SV=1 91 342 2.0E-20
sp|B3E099|KATG_METI4 Catalase-peroxidase OS=Methylacidiphilum infernorum (isolate V4) GN=katG PE=3 SV=1 110 342 2.0E-20
sp|B8GPM6|KATG_THISH Catalase-peroxidase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=katG PE=3 SV=1 112 344 2.0E-20
sp|Q5MZ99|KATG_SYNP6 Catalase-peroxidase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=katG PE=1 SV=1 112 342 3.0E-20
sp|Q31MN3|KATG_SYNE7 Catalase-peroxidase OS=Synechococcus elongatus (strain PCC 7942) GN=katG PE=1 SV=1 112 342 3.0E-20
sp|P14412|KATG_GEOSE Catalase-peroxidase OS=Geobacillus stearothermophilus GN=katG PE=1 SV=2 91 342 3.0E-20
sp|A7I6W6|KATG_METB6 Catalase-peroxidase OS=Methanoregula boonei (strain 6A8) GN=katG PE=3 SV=1 110 342 3.0E-20
sp|O28050|KATG_ARCFU Catalase-peroxidase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=katG PE=1 SV=1 110 342 3.0E-20
sp|A4INM5|KATG_GEOTN Catalase-peroxidase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=katG PE=3 SV=1 91 342 3.0E-20
sp|Q12PF6|KATG_SHEDO Catalase-peroxidase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=katG PE=3 SV=1 112 342 4.0E-20
sp|Q0A8G6|KATG_ALKEH Catalase-peroxidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=katG PE=3 SV=1 91 343 4.0E-20
sp|B0C4G1|KATG_ACAM1 Catalase-peroxidase OS=Acaryochloris marina (strain MBIC 11017) GN=katG PE=3 SV=1 90 342 4.0E-20
sp|B3PC77|KATG1_CELJU Catalase-peroxidase 1 OS=Cellvibrio japonicus (strain Ueda107) GN=katG1 PE=3 SV=1 91 342 5.0E-20
sp|Q3ATL6|KATG_CHLCH Catalase-peroxidase OS=Chlorobium chlorochromatii (strain CaD3) GN=katG PE=3 SV=1 110 342 5.0E-20
sp|Q2FSF4|KATG_METHJ Catalase-peroxidase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=katG PE=3 SV=2 110 342 7.0E-20
sp|Q4G4B1|KATG_EDWTA Catalase-peroxidase OS=Edwardsiella tarda GN=katG PE=3 SV=1 91 342 7.0E-20
sp|B1Y7V8|KATG_LEPCP Catalase-peroxidase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=katG PE=3 SV=1 110 342 9.0E-20
sp|Q87I38|KATG2_VIBPA Catalase-peroxidase 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=katG2 PE=3 SV=1 112 337 1.0E-19
sp|C0QQ02|KATG_PERMH Catalase-peroxidase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=katG PE=3 SV=1 91 342 1.0E-19
sp|Q7NGW6|KATG_GLOVI Catalase-peroxidase OS=Gloeobacter violaceus (strain PCC 7421) GN=katG PE=3 SV=1 91 342 1.0E-19
sp|O59651|KATG2_HALMA Catalase-peroxidase 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=katG2 PE=1 SV=3 81 342 1.0E-19
sp|B1XK45|KATG_SYNP2 Catalase-peroxidase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=katG PE=3 SV=1 112 342 1.0E-19
sp|A7MZ01|KATG_VIBCB Catalase-peroxidase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=katG PE=3 SV=1 91 342 1.0E-19
sp|Q8E981|KATG1_SHEON Catalase-peroxidase 1 OS=Shewanella oneidensis (strain MR-1) GN=katG1 PE=3 SV=1 91 342 2.0E-19
sp|A4FIR1|KATG_SACEN Catalase-peroxidase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=katG PE=3 SV=1 91 342 3.0E-19
sp|A4WXS6|KATG_RHOS5 Catalase-peroxidase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=katG PE=3 SV=1 112 342 3.0E-19
sp|Q5QWH3|KATG2_IDILO Catalase-peroxidase 2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=katG2 PE=3 SV=1 91 342 3.0E-19
sp|C3LMN9|KATG_VIBCM Catalase-peroxidase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=katG PE=3 SV=1 112 342 5.0E-19
sp|Q9KRS6|KATG_VIBCH Catalase-peroxidase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=katG PE=3 SV=1 112 342 5.0E-19
sp|A5F7X7|KATG_VIBC3 Catalase-peroxidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=katG PE=3 SV=1 112 342 5.0E-19
sp|Q02A20|KATG_SOLUE Catalase-peroxidase OS=Solibacter usitatus (strain Ellin6076) GN=katG PE=3 SV=1 91 342 7.0E-19
sp|Q0BRH7|KATG_GRABC Catalase-peroxidase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=katG PE=3 SV=1 91 344 1.0E-18
sp|B2V515|KATG_CLOBA Catalase-peroxidase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=katG PE=3 SV=1 110 342 1.0E-18
sp|Q2SZ20|KATG_BURTA Catalase-peroxidase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=katG PE=3 SV=1 110 342 1.0E-18
sp|A4XZ62|KATG_PSEMY Catalase-peroxidase OS=Pseudomonas mendocina (strain ymp) GN=katG PE=3 SV=1 91 342 1.0E-18
sp|A5GTX8|KATG_SYNR3 Catalase-peroxidase OS=Synechococcus sp. (strain RCC307) GN=katG PE=3 SV=1 110 342 2.0E-18
sp|B2TJE9|KATG_CLOBB Catalase-peroxidase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=katG PE=3 SV=1 110 342 2.0E-18
sp|C6DK50|KATG_PECCP Catalase-peroxidase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=katG PE=3 SV=1 112 342 2.0E-18
sp|Q2N806|KATG_ERYLH Catalase-peroxidase OS=Erythrobacter litoralis (strain HTCC2594) GN=katG PE=3 SV=1 91 342 3.0E-18
sp|Q24YU1|KATG_DESHY Catalase-peroxidase OS=Desulfitobacterium hafniense (strain Y51) GN=katG PE=3 SV=1 91 253 3.0E-18
sp|A1B4Z0|KATG_PARDP Catalase-peroxidase OS=Paracoccus denitrificans (strain Pd 1222) GN=katG PE=3 SV=1 112 342 4.0E-18
sp|A1WUH1|KATG_HALHL Catalase-peroxidase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=katG PE=3 SV=1 112 342 4.0E-18
sp|A6H0C4|KATG_FLAPJ Catalase-peroxidase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=katG PE=3 SV=1 110 342 5.0E-18
sp|Q2RZX7|KATG_SALRD Catalase-peroxidase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=katG PE=3 SV=1 91 343 6.0E-18
sp|A1S3J7|KATG2_SHEAM Catalase-peroxidase 2 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=katG2 PE=3 SV=1 110 342 7.0E-18
sp|A8LTG4|KATG_DINSH Catalase-peroxidase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=katG PE=3 SV=1 91 342 8.0E-18
sp|Q6D5X9|KATG_PECAS Catalase-peroxidase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=katG PE=3 SV=1 112 342 1.0E-17
sp|Q1GCU3|KATG_RUEST Catalase-peroxidase OS=Ruegeria sp. (strain TM1040) GN=katG PE=3 SV=1 91 342 1.0E-17
sp|Q89WB4|KATG_BRADU Catalase-peroxidase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=katG PE=3 SV=1 91 342 1.0E-17
sp|Q87J02|KATG1_VIBPA Catalase-peroxidase 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=katG1 PE=3 SV=1 112 342 1.0E-17
sp|A3NDB2|KATG_BURP6 Catalase-peroxidase OS=Burkholderia pseudomallei (strain 668) GN=katG PE=3 SV=1 110 342 2.0E-17
sp|A3NZ22|KATG_BURP0 Catalase-peroxidase OS=Burkholderia pseudomallei (strain 1106a) GN=katG PE=3 SV=1 110 342 2.0E-17
sp|A1V0A6|KATG_BURMS Catalase-peroxidase OS=Burkholderia mallei (strain SAVP1) GN=katG PE=3 SV=1 110 342 2.0E-17
sp|Q62H74|KATG_BURMA Catalase-peroxidase OS=Burkholderia mallei (strain ATCC 23344) GN=katG PE=3 SV=1 110 342 2.0E-17
sp|A2S5D5|KATG_BURM9 Catalase-peroxidase OS=Burkholderia mallei (strain NCTC 10229) GN=katG PE=3 SV=1 110 342 2.0E-17
sp|A3MPB8|KATG_BURM7 Catalase-peroxidase OS=Burkholderia mallei (strain NCTC 10247) GN=katG PE=3 SV=1 110 342 2.0E-17
sp|Q939D2|KATG_BURPS Catalase-peroxidase OS=Burkholderia pseudomallei (strain K96243) GN=katG PE=1 SV=3 110 342 2.0E-17
sp|Q3JNW6|KATG_BURP1 Catalase-peroxidase OS=Burkholderia pseudomallei (strain 1710b) GN=katG PE=3 SV=1 110 342 2.0E-17
sp|Q5QXC3|KATG1_IDILO Catalase-peroxidase 1 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=katG1 PE=3 SV=1 112 342 2.0E-17
sp|A6SY97|KATG_JANMA Catalase-peroxidase OS=Janthinobacterium sp. (strain Marseille) GN=katG PE=3 SV=1 91 342 3.0E-17
sp|B0TRN5|KATG_SHEHH Catalase-peroxidase OS=Shewanella halifaxensis (strain HAW-EB4) GN=katG PE=3 SV=1 112 342 3.0E-17
sp|A1TZH9|KATG_MARHV Catalase-peroxidase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=katG PE=3 SV=1 91 342 3.0E-17
sp|C6C1T6|KATG_DESAD Catalase-peroxidase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=katG PE=3 SV=1 91 342 4.0E-17
sp|Q12FQ6|KATG_POLSJ Catalase-peroxidase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=katG PE=3 SV=1 91 342 4.0E-17
sp|Q8X1N3|KATG_BLUGH Catalase-peroxidase OS=Blumeria graminis f. sp. hordei GN=katG PE=3 SV=2 91 344 5.0E-17
sp|A8LBC6|KATG_FRASN Catalase-peroxidase OS=Frankia sp. (strain EAN1pec) GN=katG PE=3 SV=1 91 342 5.0E-17
sp|A0R609|KATG1_MYCS2 Catalase-peroxidase 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=katG1 PE=3 SV=1 110 343 5.0E-17
sp|B0SX45|KATG_CAUSK Catalase-peroxidase OS=Caulobacter sp. (strain K31) GN=katG PE=3 SV=1 91 342 6.0E-17
sp|P0C580|KATG_MYCSM Catalase-peroxidase OS=Mycobacterium smegmatis GN=katG PE=3 SV=1 110 343 7.0E-17
sp|A4JBP6|KATG1_BURVG Catalase-peroxidase 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=katG1 PE=3 SV=1 110 342 8.0E-17
sp|A6TNI2|KATG1_ALKMQ Catalase-peroxidase 1 OS=Alkaliphilus metalliredigens (strain QYMF) GN=katG1 PE=3 SV=1 91 342 9.0E-17
sp|A1SAR6|KATG1_SHEAM Catalase-peroxidase 1 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=katG1 PE=3 SV=1 112 342 9.0E-17
sp|A8IHK8|KATG_AZOC5 Catalase-peroxidase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=katG PE=3 SV=1 91 342 9.0E-17
sp|A0LZM9|KATG_GRAFK Catalase-peroxidase OS=Gramella forsetii (strain KT0803) GN=katG PE=3 SV=1 93 342 1.0E-16
sp|Q0C0D1|KATG_HYPNA Catalase-peroxidase OS=Hyphomonas neptunium (strain ATCC 15444) GN=katG PE=3 SV=1 91 342 1.0E-16
sp|B8FDS1|KATG_DESAA Catalase-peroxidase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=katG PE=3 SV=1 91 342 1.0E-16
sp|B4S3B3|KATG_PROA2 Catalase-peroxidase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=katG PE=3 SV=1 91 342 1.0E-16
sp|Q167Q3|KATG_ROSDO Catalase-peroxidase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=katG PE=3 SV=1 91 342 1.0E-16
sp|A0ACX8|KATG_STRAM Catalase-peroxidase OS=Streptomyces ambofaciens GN=katG PE=3 SV=1 91 342 2.0E-16
sp|A5EQ55|KATG_BRASB Catalase-peroxidase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=katG PE=3 SV=1 110 342 3.0E-16
sp|A9AGE5|KATG_BURM1 Catalase-peroxidase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=katG PE=3 SV=2 110 342 3.0E-16
sp|A4QUT2|KATG2_MAGO7 Catalase-peroxidase 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=KATG2 PE=1 SV=1 91 344 3.0E-16
sp|Q8NJN2|KATG_TALMA Catalase-peroxidase OS=Talaromyces marneffei GN=katG PE=2 SV=1 91 344 3.0E-16
sp|A1BEI1|KATG_CHLPD Catalase-peroxidase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=katG PE=3 SV=1 110 342 3.0E-16
sp|Q7CVH1|KATG_AGRFC Catalase-peroxidase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=katG PE=3 SV=2 112 342 4.0E-16
sp|Q9R708|KATG_RHIRD Catalase-peroxidase OS=Rhizobium radiobacter GN=katG PE=3 SV=1 112 342 4.0E-16
sp|O87864|KATG_STRRE Catalase-peroxidase OS=Streptomyces reticuli GN=katG PE=1 SV=1 91 342 4.0E-16
sp|A4YNR8|KATG_BRASO Catalase-peroxidase OS=Bradyrhizobium sp. (strain ORS278) GN=katG PE=3 SV=1 110 342 4.0E-16
sp|A3M1S3|KATG_ACIBT Catalase-peroxidase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=katG PE=3 SV=2 91 342 5.0E-16
sp|B2I352|KATG_ACIBC Catalase-peroxidase OS=Acinetobacter baumannii (strain ACICU) GN=katG PE=3 SV=1 91 342 5.0E-16
sp|B0V4K1|KATG_ACIBY Catalase-peroxidase OS=Acinetobacter baumannii (strain AYE) GN=katG PE=3 SV=1 91 342 5.0E-16
sp|B7I4D5|KATG_ACIB5 Catalase-peroxidase OS=Acinetobacter baumannii (strain AB0057) GN=katG PE=3 SV=1 91 342 5.0E-16
sp|B7H0U3|KATG_ACIB3 Catalase-peroxidase OS=Acinetobacter baumannii (strain AB307-0294) GN=katG PE=3 SV=1 91 342 5.0E-16
sp|A7HT94|KATG_PARL1 Catalase-peroxidase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=katG PE=3 SV=1 112 342 7.0E-16
sp|A3D0Y7|KATG_SHEB5 Catalase-peroxidase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=katG PE=3 SV=1 91 342 8.0E-16
sp|Q8Y1B4|KATG_RALSO Catalase-peroxidase OS=Ralstonia solanacearum (strain GMI1000) GN=katG PE=3 SV=2 110 326 1.0E-15
sp|A6WS27|KATG_SHEB8 Catalase-peroxidase OS=Shewanella baltica (strain OS185) GN=katG PE=3 SV=1 91 342 1.0E-15
sp|Q9RJH9|KATG_STRCO Catalase-peroxidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=katG PE=1 SV=1 91 342 1.0E-15
sp|A9L1H8|KATG_SHEB9 Catalase-peroxidase OS=Shewanella baltica (strain OS195) GN=katG PE=3 SV=1 91 342 1.0E-15
sp|Q1QS58|KATG_NITHX Catalase-peroxidase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=katG PE=3 SV=1 91 342 1.0E-15
sp|Q3SWP3|KATG_NITWN Catalase-peroxidase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=katG PE=3 SV=1 91 342 1.0E-15
sp|A5GJV3|KATG_SYNPW Catalase-peroxidase OS=Synechococcus sp. (strain WH7803) GN=katG PE=3 SV=1 91 342 2.0E-15
sp|A5FZM1|KATG_ACICJ Catalase-peroxidase OS=Acidiphilium cryptum (strain JF-5) GN=katG PE=3 SV=1 91 342 2.0E-15
sp|A2SMA4|KATG_METPP Catalase-peroxidase OS=Methylibium petroleiphilum (strain PM1) GN=katG PE=3 SV=1 91 342 2.0E-15
sp|B3EEA0|KATG_CHLL2 Catalase-peroxidase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=katG PE=3 SV=1 110 342 2.0E-15
sp|C1AV76|KATG_RHOOB Catalase-peroxidase OS=Rhodococcus opacus (strain B4) GN=katG PE=3 SV=1 91 344 3.0E-15
sp|Q39JF1|KATG_BURL3 Catalase-peroxidase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=katG PE=3 SV=1 110 342 3.0E-15
sp|A8GGQ0|KATG_SERP5 Catalase-peroxidase OS=Serratia proteamaculans (strain 568) GN=katG PE=3 SV=1 110 342 3.0E-15
sp|B0SLJ6|KATG_LEPBP Catalase-peroxidase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=katG PE=3 SV=1 91 342 4.0E-15
sp|B0SD19|KATG_LEPBA Catalase-peroxidase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=katG PE=3 SV=1 91 342 4.0E-15
sp|Q0B385|KATG2_BURCM Catalase-peroxidase 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=katG2 PE=3 SV=1 91 342 4.0E-15
sp|B1KFI8|KATG_SHEWM Catalase-peroxidase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=katG PE=3 SV=1 91 342 4.0E-15
sp|Q8TS34|KATG_METAC Catalase-peroxidase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=katG PE=3 SV=1 91 326 4.0E-15
sp|B1Z5M2|KATG2_BURA4 Catalase-peroxidase 2 OS=Burkholderia ambifaria (strain MC40-6) GN=katG2 PE=3 SV=1 91 342 5.0E-15
sp|A4JPG0|KATG2_BURVG Catalase-peroxidase 2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=katG2 PE=3 SV=1 91 342 5.0E-15
sp|Q0AL71|KATG_MARMM Catalase-peroxidase OS=Maricaulis maris (strain MCS10) GN=katG PE=3 SV=1 91 342 5.0E-15
sp|O73955|KATG_HALSA Catalase-peroxidase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=katG PE=3 SV=1 91 343 5.0E-15
sp|B0R9V8|KATG_HALS3 Catalase-peroxidase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=katG PE=3 SV=1 91 343 5.0E-15
sp|Q31U45|KATG_SHIBS Catalase-peroxidase OS=Shigella boydii serotype 4 (strain Sb227) GN=katG PE=3 SV=1 112 342 6.0E-15
sp|Q0SY48|KATG_SHIF8 Catalase-peroxidase OS=Shigella flexneri serotype 5b (strain 8401) GN=katG PE=3 SV=1 112 342 6.0E-15
sp|A7ZUG1|KATG_ECO24 Catalase-peroxidase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=katG PE=3 SV=1 112 342 6.0E-15
sp|Q7A978|KATG1_ECO57 Catalase-peroxidase 1 OS=Escherichia coli O157:H7 GN=katG1 PE=3 SV=1 112 342 6.0E-15
sp|Q83IT3|KATG_SHIFL Catalase-peroxidase OS=Shigella flexneri GN=katG PE=3 SV=4 112 342 7.0E-15
sp|B1LNQ3|KATG_ECOSM Catalase-peroxidase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=katG PE=3 SV=1 112 342 7.0E-15
sp|P13029|KATG_ECOLI Catalase-peroxidase OS=Escherichia coli (strain K12) GN=katG PE=1 SV=2 112 342 7.0E-15
sp|B1IVD5|KATG_ECOLC Catalase-peroxidase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=katG PE=3 SV=1 112 342 7.0E-15
sp|Q8FBA9|KATG_ECOL6 Catalase-peroxidase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=katG PE=3 SV=2 112 342 7.0E-15
sp|Q0TAB7|KATG_ECOL5 Catalase-peroxidase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=katG PE=3 SV=1 112 342 7.0E-15
sp|A1AIC1|KATG_ECOK1 Catalase-peroxidase OS=Escherichia coli O1:K1 / APEC GN=katG PE=3 SV=1 112 342 7.0E-15
sp|A8A750|KATG_ECOHS Catalase-peroxidase OS=Escherichia coli O9:H4 (strain HS) GN=katG PE=3 SV=1 112 342 7.0E-15
sp|B1XBA8|KATG_ECODH Catalase-peroxidase OS=Escherichia coli (strain K12 / DH10B) GN=katG PE=3 SV=1 112 342 7.0E-15
sp|Q3YV31|KATG_SHISS Catalase-peroxidase OS=Shigella sonnei (strain Ss046) GN=katG PE=3 SV=1 112 342 7.0E-15
sp|Q1R3X0|KATG_ECOUT Catalase-peroxidase OS=Escherichia coli (strain UTI89 / UPEC) GN=katG PE=3 SV=2 112 342 7.0E-15
sp|A4X6K7|KATG_SALTO Catalase-peroxidase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=katG PE=3 SV=1 91 343 8.0E-15
sp|Q2J2I9|KATG_RHOP2 Catalase-peroxidase OS=Rhodopseudomonas palustris (strain HaA2) GN=katG PE=3 SV=1 91 342 8.0E-15
sp|O31066|KATG_CAUCR Catalase-peroxidase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=katG PE=3 SV=3 91 342 9.0E-15
sp|Q0BI48|KATG1_BURCM Catalase-peroxidase 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=katG1 PE=3 SV=1 110 342 9.0E-15
sp|B4SAT7|KATG_PELPB Catalase-peroxidase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=katG PE=3 SV=1 110 342 1.0E-14
sp|Q11KP9|KATG_CHESB Catalase-peroxidase OS=Chelativorans sp. (strain BNC1) GN=katG PE=3 SV=1 91 342 1.0E-14
sp|B2TWE0|KATG_SHIB3 Catalase-peroxidase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=katG PE=3 SV=1 112 342 1.0E-14
sp|B1YTH4|KATG1_BURA4 Catalase-peroxidase 1 OS=Burkholderia ambifaria (strain MC40-6) GN=katG1 PE=3 SV=1 110 342 1.0E-14
sp|A0B2Q6|KATG2_BURCH Catalase-peroxidase 2 OS=Burkholderia cenocepacia (strain HI2424) GN=katG2 PE=3 SV=1 110 342 1.0E-14
sp|B1K6I9|KATG2_BURCC Catalase-peroxidase 2 OS=Burkholderia cenocepacia (strain MC0-3) GN=katG2 PE=3 SV=1 110 342 1.0E-14
sp|Q1BQP0|KATG2_BURCA Catalase-peroxidase 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=katG2 PE=3 SV=1 110 342 1.0E-14
sp|B1JVZ2|KATG1_BURCC Catalase-peroxidase 1 OS=Burkholderia cenocepacia (strain MC0-3) GN=katG1 PE=3 SV=1 110 342 1.0E-14
sp|Q96VT4|KATG_EMENI Catalase-peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=katG PE=1 SV=1 91 342 1.0E-14
sp|A0K4Q2|KATG1_BURCH Catalase-peroxidase 1 OS=Burkholderia cenocepacia (strain HI2424) GN=katG1 PE=3 SV=1 110 342 1.0E-14
sp|Q1BYZ9|KATG1_BURCA Catalase-peroxidase 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=katG1 PE=3 SV=1 110 342 1.0E-14
sp|B9JKI5|KATG_AGRRK Catalase-peroxidase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=katG PE=3 SV=1 110 342 1.0E-14
sp|A7MJS4|KATG_CROS8 Catalase-peroxidase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=katG PE=3 SV=1 112 342 1.0E-14
sp|A0Q5L1|KATG_FRATN Catalase-peroxidase OS=Francisella tularensis subsp. novicida (strain U112) GN=katG PE=3 SV=1 91 346 2.0E-14
sp|B2WH84|KATG_PYRTR Catalase-peroxidase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=katG PE=3 SV=1 118 337 2.0E-14
sp|Q3A5D3|KATG_PELCD Catalase-peroxidase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=katG PE=3 SV=1 112 342 2.0E-14
sp|B2VFG0|KATG_ERWT9 Catalase-peroxidase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=katG PE=3 SV=1 91 342 2.0E-14
sp|Q13EM6|KATG_RHOPS Catalase-peroxidase OS=Rhodopseudomonas palustris (strain BisB5) GN=katG PE=3 SV=1 91 342 2.0E-14
sp|Q1LC96|KATG_CUPMC Catalase-peroxidase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=katG PE=3 SV=1 110 342 2.0E-14
sp|Q0S5Y0|KATG_RHOJR Catalase-peroxidase OS=Rhodococcus jostii (strain RHA1) GN=katG PE=3 SV=1 110 343 2.0E-14
sp|B4EE21|KATG1_BURCJ Catalase-peroxidase 1 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=katG1 PE=3 SV=1 110 342 3.0E-14
sp|Q6W102|KATG_RHISN Catalase-peroxidase OS=Rhizobium sp. (strain NGR234) GN=katG PE=3 SV=3 110 342 3.0E-14
sp|A1T9D9|KATG2_MYCVP Catalase-peroxidase 2 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=katG2 PE=3 SV=1 90 344 3.0E-14
sp|B3EKE9|KATG_CHLPB Catalase-peroxidase OS=Chlorobium phaeobacteroides (strain BS1) GN=katG PE=3 SV=1 110 342 3.0E-14
sp|B1J7Q1|KATG_PSEPW Catalase-peroxidase OS=Pseudomonas putida (strain W619) GN=katG PE=3 SV=1 118 345 4.0E-14
sp|A1TA09|KATG1_MYCVP Catalase-peroxidase 1 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=katG1 PE=3 SV=1 110 343 4.0E-14
sp|Q2H7U1|KATG_CHAGB Catalase-peroxidase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=katG PE=3 SV=1 118 345 4.0E-14
sp|Q2SHA6|KATG_HAHCH Catalase-peroxidase OS=Hahella chejuensis (strain KCTC 2396) GN=katG PE=3 SV=1 91 342 4.0E-14
sp|B3EBB7|KATG_GEOLS Catalase-peroxidase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=katG PE=3 SV=1 88 342 4.0E-14
sp|Q470S7|KATG2_CUPPJ Catalase-peroxidase 2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=katG2 PE=3 SV=1 110 342 5.0E-14
sp|A8AKX8|KATG_CITK8 Catalase-peroxidase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=katG PE=3 SV=1 88 342 5.0E-14
sp|Q1IAY6|KATG_PSEE4 Catalase-peroxidase OS=Pseudomonas entomophila (strain L48) GN=katG PE=3 SV=1 118 345 5.0E-14
sp|Q9R2E9|KATG_MYCVN Catalase-peroxidase OS=Mycobacterium vanbaalenii GN=katG PE=1 SV=1 90 344 6.0E-14
sp|C0ZSW0|KATG_RHOE4 Catalase-peroxidase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=katG PE=3 SV=1 110 343 6.0E-14
sp|B1W5Q9|KATG_STRGG Catalase-peroxidase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=katG PE=3 SV=1 91 342 6.0E-14
sp|A9MI19|KATG_SALAR Catalase-peroxidase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=katG PE=3 SV=1 91 342 7.0E-14
sp|Q57HA8|KATG_SALCH Catalase-peroxidase OS=Salmonella choleraesuis (strain SC-B67) GN=katG PE=3 SV=1 91 342 7.0E-14
sp|B5BJM5|KATG_SALPK Catalase-peroxidase OS=Salmonella paratyphi A (strain AKU_12601) GN=katG PE=3 SV=1 91 342 7.0E-14
sp|Q5PK60|KATG_SALPA Catalase-peroxidase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=katG PE=3 SV=1 91 342 7.0E-14
sp|B2UBU5|KATG_RALPJ Catalase-peroxidase OS=Ralstonia pickettii (strain 12J) GN=katG PE=3 SV=1 91 342 7.0E-14
sp|Q8Z303|KATG_SALTI Catalase-peroxidase OS=Salmonella typhi GN=katG PE=3 SV=1 91 342 7.0E-14
sp|B4TQG7|KATG_SALSV Catalase-peroxidase OS=Salmonella schwarzengrund (strain CVM19633) GN=katG PE=3 SV=1 112 342 7.0E-14
sp|B4RW28|KATG_ALTMD Catalase-peroxidase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=katG PE=3 SV=2 91 342 7.0E-14
sp|B2II34|KATG_BEII9 Catalase-peroxidase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=katG PE=3 SV=1 91 342 7.0E-14
sp|A4WG57|KATG_ENT38 Catalase-peroxidase OS=Enterobacter sp. (strain 638) GN=katG PE=3 SV=1 91 342 7.0E-14
sp|Q987S0|KATG_RHILO Catalase-peroxidase OS=Rhizobium loti (strain MAFF303099) GN=katG PE=3 SV=2 110 342 7.0E-14
sp|A9N0F0|KATG_SALPB Catalase-peroxidase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=katG PE=3 SV=1 112 342 7.0E-14
sp|P17750|KATG_SALTY Catalase-peroxidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=katG PE=3 SV=3 112 342 8.0E-14
sp|B4T0V5|KATG_SALNS Catalase-peroxidase OS=Salmonella newport (strain SL254) GN=katG PE=3 SV=1 112 342 8.0E-14
sp|B4TCP6|KATG_SALHS Catalase-peroxidase OS=Salmonella heidelberg (strain SL476) GN=katG PE=3 SV=1 112 342 8.0E-14
sp|A1ANT3|KATG_PELPD Catalase-peroxidase OS=Pelobacter propionicus (strain DSM 2379) GN=katG PE=3 SV=1 110 342 8.0E-14
sp|Q471D2|KATG1_CUPPJ Catalase-peroxidase 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=katG1 PE=3 SV=1 110 344 9.0E-14
sp|Q4P914|KATG_USTMA Catalase-peroxidase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=katG PE=3 SV=2 91 344 9.0E-14
sp|Q07V22|KATG_RHOP5 Catalase-peroxidase OS=Rhodopseudomonas palustris (strain BisA53) GN=katG PE=3 SV=1 110 342 9.0E-14
sp|A8M0L5|KATG_SALAI Catalase-peroxidase OS=Salinispora arenicola (strain CNS-205) GN=katG PE=3 SV=1 91 343 9.0E-14
sp|Q31U45|KATG_SHIBS Catalase-peroxidase OS=Shigella boydii serotype 4 (strain Sb227) GN=katG PE=3 SV=1 93 345 1.0E-13
sp|P13029|KATG_ECOLI Catalase-peroxidase OS=Escherichia coli (strain K12) GN=katG PE=1 SV=2 93 345 1.0E-13
sp|B1IVD5|KATG_ECOLC Catalase-peroxidase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=katG PE=3 SV=1 93 345 1.0E-13
sp|A8A750|KATG_ECOHS Catalase-peroxidase OS=Escherichia coli O9:H4 (strain HS) GN=katG PE=3 SV=1 93 345 1.0E-13
sp|B1XBA8|KATG_ECODH Catalase-peroxidase OS=Escherichia coli (strain K12 / DH10B) GN=katG PE=3 SV=1 93 345 1.0E-13
sp|Q9AP06|KATG_BURCE Catalase-peroxidase OS=Burkholderia cepacia GN=katG PE=3 SV=1 91 342 1.0E-13
sp|A4R5S9|KATG1_MAGO7 Catalase-peroxidase 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=katG1 PE=1 SV=1 118 345 1.0E-13
sp|Q1IRZ2|KATG_KORVE Catalase-peroxidase OS=Koribacter versatilis (strain Ellin345) GN=katG PE=3 SV=1 110 342 1.0E-13
sp|Q4F6N6|KATG2_BURCJ Catalase-peroxidase 2 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=katG2 PE=1 SV=1 91 342 1.0E-13
sp|Q21CF0|KATG_RHOPB Catalase-peroxidase OS=Rhodopseudomonas palustris (strain BisB18) GN=katG PE=3 SV=1 110 342 1.0E-13
sp|A6UKC3|KATG_SINMW Catalase-peroxidase OS=Sinorhizobium medicae (strain WSM419) GN=katG PE=3 SV=1 110 342 1.0E-13
sp|B3E099|KATG_METI4 Catalase-peroxidase OS=Methylacidiphilum infernorum (isolate V4) GN=katG PE=3 SV=1 118 345 2.0E-13
sp|Q0SY48|KATG_SHIF8 Catalase-peroxidase OS=Shigella flexneri serotype 5b (strain 8401) GN=katG PE=3 SV=1 93 345 2.0E-13
sp|A7ZUG1|KATG_ECO24 Catalase-peroxidase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=katG PE=3 SV=1 93 345 2.0E-13
sp|Q7A978|KATG1_ECO57 Catalase-peroxidase 1 OS=Escherichia coli O157:H7 GN=katG1 PE=3 SV=1 93 345 2.0E-13
sp|Q83IT3|KATG_SHIFL Catalase-peroxidase OS=Shigella flexneri GN=katG PE=3 SV=4 93 345 2.0E-13
sp|B1LNQ3|KATG_ECOSM Catalase-peroxidase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=katG PE=3 SV=1 93 345 2.0E-13
sp|Q8FBA9|KATG_ECOL6 Catalase-peroxidase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=katG PE=3 SV=2 93 345 2.0E-13
sp|Q0TAB7|KATG_ECOL5 Catalase-peroxidase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=katG PE=3 SV=1 93 345 2.0E-13
sp|A1AIC1|KATG_ECOK1 Catalase-peroxidase OS=Escherichia coli O1:K1 / APEC GN=katG PE=3 SV=1 93 345 2.0E-13
sp|Q1R3X0|KATG_ECOUT Catalase-peroxidase OS=Escherichia coli (strain UTI89 / UPEC) GN=katG PE=3 SV=2 93 345 2.0E-13
sp|B2TWE0|KATG_SHIB3 Catalase-peroxidase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=katG PE=3 SV=1 93 345 2.0E-13
sp|A8AKX8|KATG_CITK8 Catalase-peroxidase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=katG PE=3 SV=1 118 345 2.0E-13
sp|Q92XG8|KATG_RHIME Catalase-peroxidase OS=Rhizobium meliloti (strain 1021) GN=katG PE=3 SV=1 110 342 2.0E-13
sp|P37743|KATG_RHOCA Catalase-peroxidase OS=Rhodobacter capsulatus GN=katG PE=1 SV=1 110 253 2.0E-13
sp|B3QAA7|KATG_RHOPT Catalase-peroxidase OS=Rhodopseudomonas palustris (strain TIE-1) GN=katG PE=3 SV=1 91 342 2.0E-13
sp|Q8PBB7|KATG_XANCP Catalase-peroxidase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=katG PE=3 SV=1 89 342 2.0E-13
sp|B0RXD3|KATG_XANCB Catalase-peroxidase OS=Xanthomonas campestris pv. campestris (strain B100) GN=katG PE=3 SV=1 89 342 2.0E-13
sp|Q4US88|KATG_XANC8 Catalase-peroxidase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=katG PE=3 SV=1 89 342 2.0E-13
sp|Q2JZT8|KATG_RHIEC Catalase-peroxidase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=katG PE=2 SV=1 110 342 2.0E-13
sp|A6T9H9|KATG_KLEP7 Catalase-peroxidase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=katG PE=3 SV=1 91 342 2.0E-13
sp|A4VK13|KATG_PSEU5 Catalase-peroxidase OS=Pseudomonas stutzeri (strain A1501) GN=katG PE=3 SV=1 91 342 2.0E-13
sp|Q0CD12|KATG_ASPTN Catalase-peroxidase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=katG PE=3 SV=1 91 342 2.0E-13
sp|B3PEP6|KATG2_CELJU Catalase-peroxidase 2 OS=Cellvibrio japonicus (strain Ueda107) GN=katG2 PE=3 SV=1 110 342 3.0E-13
sp|A3QAT3|KATG_SHELP Catalase-peroxidase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=katG PE=3 SV=1 91 342 3.0E-13
sp|A1SF13|KATG_NOCSJ Catalase-peroxidase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=katG PE=3 SV=1 91 343 4.0E-13
sp|B1MBD0|KATG_MYCA9 Catalase-peroxidase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=katG PE=3 SV=1 91 344 4.0E-13
sp|Q5LLG6|KATG_RUEPO Catalase-peroxidase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=katG PE=3 SV=1 91 327 4.0E-13
sp|C1F960|KATG_ACIC5 Catalase-peroxidase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=katG PE=3 SV=1 110 253 4.0E-13
sp|Q6NCP1|KATG_RHOPA Catalase-peroxidase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=katG PE=3 SV=1 91 342 4.0E-13
sp|Q74BE1|KATG_GEOSL Catalase-peroxidase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=katG PE=3 SV=1 112 342 4.0E-13
sp|A0L153|KATG2_SHESA Catalase-peroxidase 2 OS=Shewanella sp. (strain ANA-3) GN=katG2 PE=3 SV=1 91 342 4.0E-13
sp|B1M869|KATG_METRJ Catalase-peroxidase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=katG PE=3 SV=1 91 204 6.0E-13
sp|Q5QXC3|KATG1_IDILO Catalase-peroxidase 1 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=katG1 PE=3 SV=1 91 343 7.0E-13
sp|P9WIE5|KATG_MYCTU Catalase-peroxidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=katG PE=1 SV=1 110 344 8.0E-13
sp|P9WIE4|KATG_MYCTO Catalase-peroxidase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=katG PE=3 SV=1 110 344 8.0E-13
sp|H8F3Q9|KATG_MYCTE Catalase-peroxidase OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=katG PE=2 SV=1 110 344 8.0E-13
sp|A5U3S7|KATG_MYCTA Catalase-peroxidase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=katG PE=3 SV=1 110 344 8.0E-13
sp|Q479B7|KATG_DECAR Catalase-peroxidase OS=Dechloromonas aromatica (strain RCB) GN=katG PE=3 SV=1 112 306 8.0E-13
sp|Q5NGV7|KATG_FRATT Catalase-peroxidase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=katG PE=1 SV=1 91 346 9.0E-13
sp|Q14IA9|KATG_FRAT1 Catalase-peroxidase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=katG PE=3 SV=1 91 346 9.0E-13
sp|Q1M498|KATG_RHIL3 Catalase-peroxidase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=katG PE=3 SV=1 110 342 9.0E-13
sp|C1API8|KATG_MYCBT Catalase-peroxidase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=katG PE=3 SV=1 110 344 9.0E-13
sp|A1KJX3|KATG_MYCBP Catalase-peroxidase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=katG PE=3 SV=1 110 344 9.0E-13
sp|P46817|KATG_MYCBO Catalase-peroxidase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=katG PE=1 SV=2 110 344 9.0E-13
sp|Q2KTI4|KATG_BORA1 Catalase-peroxidase OS=Bordetella avium (strain 197N) GN=katG PE=3 SV=2 118 345 9.0E-13
sp|B3Q4F9|KATG_RHIE6 Catalase-peroxidase OS=Rhizobium etli (strain CIAT 652) GN=katG PE=3 SV=2 91 342 9.0E-13
sp|B4R8U3|KATG_PHEZH Catalase-peroxidase OS=Phenylobacterium zucineum (strain HLK1) GN=katG PE=3 SV=1 118 344 1.0E-12
sp|A4IZ86|KATG_FRATW Catalase-peroxidase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=katG PE=3 SV=1 91 346 1.0E-12
sp|Q0BKW5|KATG_FRATO Catalase-peroxidase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=katG PE=3 SV=1 91 346 1.0E-12
sp|Q2A298|KATG_FRATH Catalase-peroxidase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=katG PE=3 SV=2 91 346 1.0E-12
sp|A7NDL0|KATG_FRATF Catalase-peroxidase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=katG PE=3 SV=1 91 346 1.0E-12
sp|Q3YV31|KATG_SHISS Catalase-peroxidase OS=Shigella sonnei (strain Ss046) GN=katG PE=3 SV=1 93 345 1.0E-12
sp|Q15UE5|KATG_PSEA6 Catalase-peroxidase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=katG PE=3 SV=1 110 342 1.0E-12
sp|A0PQH6|KATG_MYCUA Catalase-peroxidase OS=Mycobacterium ulcerans (strain Agy99) GN=katG PE=3 SV=2 110 343 1.0E-12
sp|B2HE73|KATG_MYCMM Catalase-peroxidase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=katG PE=3 SV=1 110 344 1.0E-12
sp|Q5WZY1|KATG2_LEGPL Catalase-peroxidase 2 OS=Legionella pneumophila (strain Lens) GN=katG2 PE=3 SV=1 110 343 2.0E-12
sp|B2SDI5|KATG_FRATM Catalase-peroxidase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=katG PE=3 SV=1 91 346 2.0E-12
sp|Q02A20|KATG_SOLUE Catalase-peroxidase OS=Solibacter usitatus (strain Ellin6076) GN=katG PE=3 SV=1 118 345 2.0E-12
sp|B2ASU5|KATG_PODAN Catalase-peroxidase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=katG PE=3 SV=1 118 345 2.0E-12
sp|D8INT8|KATG_HERSS Catalase-peroxidase OS=Herbaspirillum seropedicae (strain SmR1) GN=katG PE=1 SV=1 116 345 2.0E-12
sp|A2RPW9|KATG_HERSE Catalase-peroxidase OS=Herbaspirillum seropedicae GN=katG PE=3 SV=1 116 345 2.0E-12
sp|Q1R185|KATG_CHRSD Catalase-peroxidase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=katG PE=3 SV=1 91 342 2.0E-12
sp|A5IA67|KATG2_LEGPC Catalase-peroxidase 2 OS=Legionella pneumophila (strain Corby) GN=katG2 PE=3 SV=1 118 343 3.0E-12
sp|B0TYQ6|KATG_FRAP2 Catalase-peroxidase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=katG PE=3 SV=1 91 346 3.0E-12
sp|Q0BRH7|KATG_GRABC Catalase-peroxidase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=katG PE=3 SV=1 116 345 3.0E-12
sp|Q0B385|KATG2_BURCM Catalase-peroxidase 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=katG2 PE=3 SV=1 118 345 3.0E-12
sp|A1DAL6|KATG_NEOFI Catalase-peroxidase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=katG PE=3 SV=1 91 342 3.0E-12
sp|Q88GQ0|KATG_PSEPK Catalase-peroxidase OS=Pseudomonas putida (strain KT2440) GN=katG PE=3 SV=1 118 345 3.0E-12
sp|Q4KD86|KATG_PSEF5 Catalase-peroxidase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=katG PE=3 SV=1 110 342 3.0E-12
sp|Q0HES2|KATG2_SHESM Catalase-peroxidase 2 OS=Shewanella sp. (strain MR-4) GN=katG2 PE=3 SV=1 91 342 3.0E-12
sp|P17750|KATG_SALTY Catalase-peroxidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=katG PE=3 SV=3 118 345 4.0E-12
sp|B4T0V5|KATG_SALNS Catalase-peroxidase OS=Salmonella newport (strain SL254) GN=katG PE=3 SV=1 118 345 4.0E-12
sp|B4TCP6|KATG_SALHS Catalase-peroxidase OS=Salmonella heidelberg (strain SL476) GN=katG PE=3 SV=1 118 345 4.0E-12
sp|A9A0F0|KATG_DESOH Catalase-peroxidase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=katG PE=3 SV=1 110 342 4.0E-12
sp|Q8X182|KATG_NEUCR Catalase-peroxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=katG PE=1 SV=2 118 345 4.0E-12
sp|A5W241|KATG_PSEP1 Catalase-peroxidase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=katG PE=3 SV=1 118 345 4.0E-12
sp|B4TQG7|KATG_SALSV Catalase-peroxidase OS=Salmonella schwarzengrund (strain CVM19633) GN=katG PE=3 SV=1 118 345 5.0E-12
sp|B9K0G2|KATG_AGRVS Catalase-peroxidase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=katG PE=3 SV=1 91 253 5.0E-12
sp|Q0HZ78|KATG2_SHESR Catalase-peroxidase 2 OS=Shewanella sp. (strain MR-7) GN=katG2 PE=3 SV=1 91 342 6.0E-12
sp|Q1B8J4|KATG_MYCSS Catalase-peroxidase OS=Mycobacterium sp. (strain MCS) GN=katG PE=3 SV=1 92 343 6.0E-12
sp|A1UGG4|KATG_MYCSK Catalase-peroxidase OS=Mycobacterium sp. (strain KMS) GN=katG PE=3 SV=1 92 343 6.0E-12
sp|A3Q016|KATG_MYCSJ Catalase-peroxidase OS=Mycobacterium sp. (strain JLS) GN=katG PE=3 SV=1 92 343 6.0E-12
sp|Q3KE62|KATG_PSEPF Catalase-peroxidase OS=Pseudomonas fluorescens (strain Pf0-1) GN=katG PE=3 SV=1 91 204 6.0E-12
sp|B2V515|KATG_CLOBA Catalase-peroxidase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=katG PE=3 SV=1 118 335 7.0E-12
sp|A9MI19|KATG_SALAR Catalase-peroxidase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=katG PE=3 SV=1 118 345 7.0E-12
sp|Q3AN75|KATG_SYNSC Catalase-peroxidase OS=Synechococcus sp. (strain CC9605) GN=katG PE=3 SV=1 91 328 7.0E-12
sp|Q486C8|KATG_COLP3 Catalase-peroxidase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=katG PE=3 SV=1 91 345 8.0E-12
sp|Q13US7|KATG_BURXL Catalase-peroxidase OS=Burkholderia xenovorans (strain LB400) GN=katG PE=3 SV=1 118 345 8.0E-12
sp|Q2G479|KATG_NOVAD Catalase-peroxidase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=katG PE=3 SV=1 110 327 8.0E-12
sp|Q0K815|KATG_CUPNH Catalase-peroxidase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=katG PE=3 SV=1 118 345 8.0E-12
sp|B1Z5M2|KATG2_BURA4 Catalase-peroxidase 2 OS=Burkholderia ambifaria (strain MC40-6) GN=katG2 PE=3 SV=1 118 345 9.0E-12
sp|Q8Z303|KATG_SALTI Catalase-peroxidase OS=Salmonella typhi GN=katG PE=3 SV=1 118 345 9.0E-12
sp|A9N0F0|KATG_SALPB Catalase-peroxidase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=katG PE=3 SV=1 118 345 9.0E-12
sp|A4JPG0|KATG2_BURVG Catalase-peroxidase 2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=katG2 PE=3 SV=1 118 345 1.0E-11
sp|Q57HA8|KATG_SALCH Catalase-peroxidase OS=Salmonella choleraesuis (strain SC-B67) GN=katG PE=3 SV=1 118 345 1.0E-11
sp|B5BJM5|KATG_SALPK Catalase-peroxidase OS=Salmonella paratyphi A (strain AKU_12601) GN=katG PE=3 SV=1 118 345 1.0E-11
sp|Q5PK60|KATG_SALPA Catalase-peroxidase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=katG PE=3 SV=1 118 345 1.0E-11
sp|Q04657|KATG_MYCIT Catalase-peroxidase OS=Mycobacterium intracellulare GN=katG PE=3 SV=1 110 253 1.0E-11
sp|A1K9V0|KATG_AZOSB Catalase-peroxidase OS=Azoarcus sp. (strain BH72) GN=katG PE=3 SV=1 112 327 1.0E-11
sp|Q3A5D3|KATG_PELCD Catalase-peroxidase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=katG PE=3 SV=1 116 345 2.0E-11
sp|A1DAL6|KATG_NEOFI Catalase-peroxidase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=katG PE=3 SV=1 118 345 2.0E-11
sp|O08405|KATG2_MYCFO Catalase-peroxidase 2 OS=Mycobacterium fortuitum GN=katG2 PE=3 SV=1 92 343 2.0E-11
sp|Q7Z7W6|KATG_ASPFU Catalase-peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=katG PE=1 SV=1 91 342 2.0E-11
sp|B0YAK0|KATG_ASPFC Catalase-peroxidase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=katG PE=3 SV=1 91 342 2.0E-11
sp|Q0U324|KATG_PHANO Catalase-peroxidase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=katG PE=3 SV=1 118 336 2.0E-11
sp|C6DYB7|KATG_GEOSM Catalase-peroxidase OS=Geobacter sp. (strain M21) GN=katG PE=3 SV=1 118 345 3.0E-11
sp|Q7Z7W6|KATG_ASPFU Catalase-peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=katG PE=1 SV=1 118 345 3.0E-11
sp|B0YAK0|KATG_ASPFC Catalase-peroxidase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=katG PE=3 SV=1 118 345 3.0E-11
sp|Q07YF5|KATG2_SHEFN Catalase-peroxidase 2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=katG2 PE=3 SV=1 91 342 3.0E-11
sp|B0KNK9|KATG_PSEPG Catalase-peroxidase OS=Pseudomonas putida (strain GB-1) GN=katG PE=3 SV=1 118 345 3.0E-11
sp|A0PQH6|KATG_MYCUA Catalase-peroxidase OS=Mycobacterium ulcerans (strain Agy99) GN=katG PE=3 SV=2 118 343 4.0E-11
sp|A1C8R3|KATG_ASPCL Catalase-peroxidase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=katG PE=3 SV=1 91 342 4.0E-11
sp|O08404|KATG1_MYCFO Catalase-peroxidase 1 OS=Mycobacterium fortuitum GN=katG1 PE=3 SV=1 110 343 4.0E-11
sp|A0QGA4|KATG_MYCA1 Catalase-peroxidase OS=Mycobacterium avium (strain 104) GN=katG PE=3 SV=1 116 343 4.0E-11
sp|Q73ZD5|KATG_MYCPA Catalase-peroxidase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=katG PE=3 SV=1 116 343 4.0E-11
sp|Q8X1N3|KATG_BLUGH Catalase-peroxidase OS=Blumeria graminis f. sp. hordei GN=katG PE=3 SV=2 118 347 5.0E-11
sp|A7MJS4|KATG_CROS8 Catalase-peroxidase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=katG PE=3 SV=1 82 345 6.0E-11
sp|A4TA35|KATG_MYCGI Catalase-peroxidase OS=Mycobacterium gilvum (strain PYR-GCK) GN=katG PE=3 SV=1 110 343 7.0E-11
sp|Q2G479|KATG_NOVAD Catalase-peroxidase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=katG PE=3 SV=1 112 348 9.0E-11
sp|Q9WXB9|KATG2_LEGPN Catalase-peroxidase 2 OS=Legionella pneumophila GN=katG2 PE=2 SV=1 118 343 1.0E-10
sp|Q5ZZ17|KATG2_LEGPH Catalase-peroxidase 2 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=katG2 PE=3 SV=1 118 343 1.0E-10
sp|Q3SWP3|KATG_NITWN Catalase-peroxidase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=katG PE=3 SV=1 118 344 1.0E-10
sp|A5FZM1|KATG_ACICJ Catalase-peroxidase OS=Acidiphilium cryptum (strain JF-5) GN=katG PE=3 SV=1 116 345 1.0E-10
sp|C0ZSW0|KATG_RHOE4 Catalase-peroxidase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=katG PE=3 SV=1 110 345 1.0E-10
sp|A6UKC3|KATG_SINMW Catalase-peroxidase OS=Sinorhizobium medicae (strain WSM419) GN=katG PE=3 SV=1 118 344 1.0E-10
sp|A4VK13|KATG_PSEU5 Catalase-peroxidase OS=Pseudomonas stutzeri (strain A1501) GN=katG PE=3 SV=1 118 336 1.0E-10
sp|B2HE73|KATG_MYCMM Catalase-peroxidase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=katG PE=3 SV=1 118 343 1.0E-10
sp|Q8RJZ6|KATG_RHILP Catalase-peroxidase OS=Rhizobium leguminosarum bv. phaseoli GN=katG PE=3 SV=1 110 342 1.0E-10
sp|Q8NJN2|KATG_TALMA Catalase-peroxidase OS=Talaromyces marneffei GN=katG PE=2 SV=1 118 345 2.0E-10
sp|A7HT94|KATG_PARL1 Catalase-peroxidase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=katG PE=3 SV=1 118 343 2.0E-10
sp|Q6W102|KATG_RHISN Catalase-peroxidase OS=Rhizobium sp. (strain NGR234) GN=katG PE=3 SV=3 92 343 2.0E-10
sp|B3EKE9|KATG_CHLPB Catalase-peroxidase OS=Chlorobium phaeobacteroides (strain BS1) GN=katG PE=3 SV=1 116 346 2.0E-10
sp|A4WG57|KATG_ENT38 Catalase-peroxidase OS=Enterobacter sp. (strain 638) GN=katG PE=3 SV=1 84 345 2.0E-10
sp|B9K0G2|KATG_AGRVS Catalase-peroxidase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=katG PE=3 SV=1 118 344 2.0E-10
sp|A0QGA4|KATG_MYCA1 Catalase-peroxidase OS=Mycobacterium avium (strain 104) GN=katG PE=3 SV=1 110 253 2.0E-10
sp|Q73ZD5|KATG_MYCPA Catalase-peroxidase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=katG PE=3 SV=1 110 253 2.0E-10
sp|Q1QS58|KATG_NITHX Catalase-peroxidase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=katG PE=3 SV=1 116 344 3.0E-10
sp|Q539E5|APX1_HYDVD Putative ascorbate peroxidase OS=Hydra viridissima GN=APX1 PE=2 SV=1 85 346 4.0E-10
sp|A4TA35|KATG_MYCGI Catalase-peroxidase OS=Mycobacterium gilvum (strain PYR-GCK) GN=katG PE=3 SV=1 116 343 5.0E-10
sp|A1TRV8|KATG_ACIAC Catalase-peroxidase OS=Acidovorax citrulli (strain AAC00-1) GN=katG PE=3 SV=1 118 345 5.0E-10
sp|B2TJE9|KATG_CLOBB Catalase-peroxidase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=katG PE=3 SV=1 118 335 6.0E-10
sp|A1B4Z0|KATG_PARDP Catalase-peroxidase OS=Paracoccus denitrificans (strain Pd 1222) GN=katG PE=3 SV=1 118 344 6.0E-10
sp|A4X6K7|KATG_SALTO Catalase-peroxidase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=katG PE=3 SV=1 118 345 6.0E-10
sp|A1SF13|KATG_NOCSJ Catalase-peroxidase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=katG PE=3 SV=1 110 344 6.0E-10
sp|Q5KZ91|KATG_GEOKA Catalase-peroxidase OS=Geobacillus kaustophilus (strain HTA426) GN=katG PE=3 SV=1 118 343 7.0E-10
sp|B4S3B3|KATG_PROA2 Catalase-peroxidase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=katG PE=3 SV=1 116 345 7.0E-10
sp|B1J7Q1|KATG_PSEPW Catalase-peroxidase OS=Pseudomonas putida (strain W619) GN=katG PE=3 SV=1 91 204 7.0E-10
sp|Q1IAY6|KATG_PSEE4 Catalase-peroxidase OS=Pseudomonas entomophila (strain L48) GN=katG PE=3 SV=1 91 204 7.0E-10
sp|Q4P914|KATG_USTMA Catalase-peroxidase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=katG PE=3 SV=2 118 345 7.0E-10
sp|Q88GQ0|KATG_PSEPK Catalase-peroxidase OS=Pseudomonas putida (strain KT2440) GN=katG PE=3 SV=1 91 204 7.0E-10
sp|A5W241|KATG_PSEP1 Catalase-peroxidase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=katG PE=3 SV=1 91 204 7.0E-10
sp|B0KNK9|KATG_PSEPG Catalase-peroxidase OS=Pseudomonas putida (strain GB-1) GN=katG PE=3 SV=1 91 204 7.0E-10
sp|Q04657|KATG_MYCIT Catalase-peroxidase OS=Mycobacterium intracellulare GN=katG PE=3 SV=1 110 344 8.0E-10
sp|Q1GR67|KATG_SPHAL Catalase-peroxidase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=katG PE=3 SV=1 85 344 1.0E-09
sp|Q89WB4|KATG_BRADU Catalase-peroxidase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=katG PE=3 SV=1 116 345 1.0E-09
sp|Q74BE1|KATG_GEOSL Catalase-peroxidase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=katG PE=3 SV=1 118 345 1.0E-09
sp|Q8EIV5|KATG2_SHEON Catalase-peroxidase 2 OS=Shewanella oneidensis (strain MR-1) GN=katG2 PE=3 SV=1 91 342 1.0E-09
sp|Q21DT6|KATG_SACD2 Catalase-peroxidase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=katG PE=3 SV=1 91 335 2.0E-09
sp|A0R609|KATG1_MYCS2 Catalase-peroxidase 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=katG1 PE=3 SV=1 97 344 2.0E-09
sp|P0C580|KATG_MYCSM Catalase-peroxidase OS=Mycobacterium smegmatis GN=katG PE=3 SV=1 97 344 2.0E-09
sp|Q167Q3|KATG_ROSDO Catalase-peroxidase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=katG PE=3 SV=1 110 344 2.0E-09
sp|Q92XG8|KATG_RHIME Catalase-peroxidase OS=Rhizobium meliloti (strain 1021) GN=katG PE=3 SV=1 118 344 2.0E-09
sp|B3PEP6|KATG2_CELJU Catalase-peroxidase 2 OS=Cellvibrio japonicus (strain Ueda107) GN=katG2 PE=3 SV=1 118 345 2.0E-09
sp|C1F960|KATG_ACIC5 Catalase-peroxidase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=katG PE=3 SV=1 116 345 2.0E-09
sp|Q3KE62|KATG_PSEPF Catalase-peroxidase OS=Pseudomonas fluorescens (strain Pf0-1) GN=katG PE=3 SV=1 118 345 2.0E-09
sp|O49293|PER13_ARATH Peroxidase 13 OS=Arabidopsis thaliana GN=PER13 PE=3 SV=2 110 359 2.0E-09
sp|B0TRN5|KATG_SHEHH Catalase-peroxidase OS=Shewanella halifaxensis (strain HAW-EB4) GN=katG PE=3 SV=1 118 344 3.0E-09
sp|Q0BI48|KATG1_BURCM Catalase-peroxidase 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=katG1 PE=3 SV=1 118 345 3.0E-09
sp|D8INT8|KATG_HERSS Catalase-peroxidase OS=Herbaspirillum seropedicae (strain SmR1) GN=katG PE=1 SV=1 91 204 3.0E-09
sp|A2RPW9|KATG_HERSE Catalase-peroxidase OS=Herbaspirillum seropedicae GN=katG PE=3 SV=1 91 204 3.0E-09
sp|Q0K815|KATG_CUPNH Catalase-peroxidase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=katG PE=3 SV=1 91 191 3.0E-09
sp|Q8EIV5|KATG2_SHEON Catalase-peroxidase 2 OS=Shewanella oneidensis (strain MR-1) GN=katG2 PE=3 SV=1 116 336 3.0E-09
sp|A2Q7T1|KATG_ASPNC Catalase-peroxidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=katG PE=3 SV=1 110 345 3.0E-09
sp|A9AGE5|KATG_BURM1 Catalase-peroxidase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=katG PE=3 SV=2 118 345 4.0E-09
sp|Q5LLG6|KATG_RUEPO Catalase-peroxidase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=katG PE=3 SV=1 118 344 4.0E-09
sp|O48677|PER6_ARATH Peroxidase 6 OS=Arabidopsis thaliana GN=PER6 PE=2 SV=1 173 357 4.0E-09
sp|Q5MZ99|KATG_SYNP6 Catalase-peroxidase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=katG PE=1 SV=1 118 344 5.0E-09
sp|Q31MN3|KATG_SYNE7 Catalase-peroxidase OS=Synechococcus elongatus (strain PCC 7942) GN=katG PE=1 SV=1 118 344 5.0E-09
sp|A7I6W6|KATG_METB6 Catalase-peroxidase OS=Methanoregula boonei (strain 6A8) GN=katG PE=3 SV=1 116 345 5.0E-09
sp|Q7MLC1|KATG_VIBVY Catalase-peroxidase OS=Vibrio vulnificus (strain YJ016) GN=katG PE=3 SV=1 118 344 6.0E-09
sp|Q0HQB2|KATG1_SHESR Catalase-peroxidase 1 OS=Shewanella sp. (strain MR-7) GN=katG1 PE=3 SV=1 118 344 6.0E-09
sp|Q0HNH6|KATG1_SHESM Catalase-peroxidase 1 OS=Shewanella sp. (strain MR-4) GN=katG1 PE=3 SV=1 118 344 6.0E-09
sp|Q5QWH3|KATG2_IDILO Catalase-peroxidase 2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=katG2 PE=3 SV=1 91 345 6.0E-09
sp|A1SAR6|KATG1_SHEAM Catalase-peroxidase 1 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=katG1 PE=3 SV=1 118 344 6.0E-09
sp|Q43731|PER50_ARATH Peroxidase 50 OS=Arabidopsis thaliana GN=PER50 PE=1 SV=1 116 357 6.0E-09
sp|B3PC77|KATG1_CELJU Catalase-peroxidase 1 OS=Cellvibrio japonicus (strain Ueda107) GN=katG1 PE=3 SV=1 118 344 7.0E-09
sp|Q2KTI4|KATG_BORA1 Catalase-peroxidase OS=Bordetella avium (strain 197N) GN=katG PE=3 SV=2 91 191 7.0E-09
sp|Q13US7|KATG_BURXL Catalase-peroxidase OS=Burkholderia xenovorans (strain LB400) GN=katG PE=3 SV=1 91 204 7.0E-09
sp|Q9KEE6|KATG_BACHD Catalase-peroxidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=katG PE=3 SV=1 110 343 8.0E-09
sp|B1YTH4|KATG1_BURA4 Catalase-peroxidase 1 OS=Burkholderia ambifaria (strain MC40-6) GN=katG1 PE=3 SV=1 118 345 8.0E-09
sp|A5FD11|KATG_FLAJ1 Catalase-peroxidase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=katG PE=3 SV=1 87 345 8.0E-09
sp|Q9SY33|PER7_ARATH Peroxidase 7 OS=Arabidopsis thaliana GN=PER7 PE=2 SV=1 111 347 8.0E-09
sp|O73955|KATG_HALSA Catalase-peroxidase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=katG PE=3 SV=1 116 345 1.0E-08
sp|B0R9V8|KATG_HALS3 Catalase-peroxidase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=katG PE=3 SV=1 116 345 1.0E-08
sp|Q07YF5|KATG2_SHEFN Catalase-peroxidase 2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=katG2 PE=3 SV=1 118 345 1.0E-08
sp|B2T4H0|KATG_BURPP Catalase-peroxidase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=katG PE=3 SV=1 91 204 1.0E-08
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 72 346 1.0E-08
sp|Q3BVY2|KATG_XANC5 Catalase-peroxidase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=katG PE=3 SV=1 89 204 1.0E-08
sp|A0QXX7|KATG2_MYCS2 Catalase-peroxidase 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=katG2 PE=1 SV=1 118 343 1.0E-08
sp|Q8PMX4|KATG_XANAC Catalase-peroxidase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=katG PE=3 SV=2 91 204 1.0E-08
sp|P0C8F0|KATG_ECOLX Catalase-peroxidase OS=Escherichia coli GN=katG PE=3 SV=1 118 336 2.0E-08
sp|Q7BSW8|KATG2_ECO57 Catalase-peroxidase 2 OS=Escherichia coli O157:H7 GN=katG2 PE=3 SV=1 118 336 2.0E-08
sp|Q8D951|KATG_VIBVU Catalase-peroxidase OS=Vibrio vulnificus (strain CMCP6) GN=katG PE=3 SV=1 118 344 2.0E-08
sp|O87864|KATG_STRRE Catalase-peroxidase OS=Streptomyces reticuli GN=katG PE=1 SV=1 118 344 2.0E-08
sp|Q0CD12|KATG_ASPTN Catalase-peroxidase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=katG PE=3 SV=1 118 345 2.0E-08
sp|Q0HES2|KATG2_SHESM Catalase-peroxidase 2 OS=Shewanella sp. (strain MR-4) GN=katG2 PE=3 SV=1 116 335 2.0E-08
sp|Q0HZ78|KATG2_SHESR Catalase-peroxidase 2 OS=Shewanella sp. (strain MR-7) GN=katG2 PE=3 SV=1 116 335 2.0E-08
sp|Q48E42|KATG_PSE14 Catalase-peroxidase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=katG PE=3 SV=1 91 204 2.0E-08
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 78 346 2.0E-08
sp|Q5YVJ4|KATG_NOCFA Catalase-peroxidase OS=Nocardia farcinica (strain IFM 10152) GN=katG PE=3 SV=1 118 345 3.0E-08
sp|Q8E981|KATG1_SHEON Catalase-peroxidase 1 OS=Shewanella oneidensis (strain MR-1) GN=katG1 PE=3 SV=1 91 344 3.0E-08
sp|C6C1T6|KATG_DESAD Catalase-peroxidase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=katG PE=3 SV=1 118 347 3.0E-08
sp|Q12FQ6|KATG_POLSJ Catalase-peroxidase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=katG PE=3 SV=1 118 345 3.0E-08
sp|B2WH84|KATG_PYRTR Catalase-peroxidase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=katG PE=3 SV=1 91 204 3.0E-08
sp|B2UBU5|KATG_RALPJ Catalase-peroxidase OS=Ralstonia pickettii (strain 12J) GN=katG PE=3 SV=1 86 345 3.0E-08
sp|A1C8R3|KATG_ASPCL Catalase-peroxidase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=katG PE=3 SV=1 118 345 3.0E-08
sp|A0QXX7|KATG2_MYCS2 Catalase-peroxidase 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=katG2 PE=1 SV=1 110 287 3.0E-08
sp|A1S3J7|KATG2_SHEAM Catalase-peroxidase 2 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=katG2 PE=3 SV=1 116 345 4.0E-08
sp|A4JBP6|KATG1_BURVG Catalase-peroxidase 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=katG1 PE=3 SV=1 118 345 4.0E-08
sp|Q471D2|KATG1_CUPPJ Catalase-peroxidase 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=katG1 PE=3 SV=1 116 345 4.0E-08
sp|A8M0L5|KATG_SALAI Catalase-peroxidase OS=Salinispora arenicola (strain CNS-205) GN=katG PE=3 SV=1 118 345 4.0E-08
sp|Q96510|PER35_ARATH Peroxidase 35 OS=Arabidopsis thaliana GN=PER35 PE=1 SV=1 116 357 4.0E-08
sp|Q6D5X9|KATG_PECAS Catalase-peroxidase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=katG PE=3 SV=1 118 344 5.0E-08
sp|O31066|KATG_CAUCR Catalase-peroxidase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=katG PE=3 SV=3 118 285 6.0E-08
sp|Q07V22|KATG_RHOP5 Catalase-peroxidase OS=Rhodopseudomonas palustris (strain BisA53) GN=katG PE=3 SV=1 118 344 6.0E-08
sp|Q8X182|KATG_NEUCR Catalase-peroxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=katG PE=1 SV=2 91 204 6.0E-08
sp|Q70LM3|PEM2_PHLRA Manganese peroxidase 2 OS=Phlebia radiata GN=mnp2 PE=1 SV=1 118 346 6.0E-08
sp|B8GPM6|KATG_THISH Catalase-peroxidase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=katG PE=3 SV=1 118 344 7.0E-08
sp|C6DK50|KATG_PECCP Catalase-peroxidase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=katG PE=3 SV=1 118 344 7.0E-08
sp|B1Y7V8|KATG_LEPCP Catalase-peroxidase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=katG PE=3 SV=1 118 344 8.0E-08
sp|Q13EM6|KATG_RHOPS Catalase-peroxidase OS=Rhodopseudomonas palustris (strain BisB5) GN=katG PE=3 SV=1 118 344 8.0E-08
sp|Q1B8J4|KATG_MYCSS Catalase-peroxidase OS=Mycobacterium sp. (strain MCS) GN=katG PE=3 SV=1 118 343 9.0E-08
sp|A1UGG4|KATG_MYCSK Catalase-peroxidase OS=Mycobacterium sp. (strain KMS) GN=katG PE=3 SV=1 118 343 9.0E-08
sp|A3Q016|KATG_MYCSJ Catalase-peroxidase OS=Mycobacterium sp. (strain JLS) GN=katG PE=3 SV=1 118 343 9.0E-08
sp|P73911|KATG_SYNY3 Catalase-peroxidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=katG PE=1 SV=1 118 343 1.0E-07
sp|Q3IQZ9|KATG_NATPD Catalase-peroxidase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=katG PE=3 SV=1 118 345 1.0E-07
sp|Q7NGW6|KATG_GLOVI Catalase-peroxidase OS=Gloeobacter violaceus (strain PCC 7421) GN=katG PE=3 SV=1 118 345 1.0E-07
sp|A0LZM9|KATG_GRAFK Catalase-peroxidase OS=Gramella forsetii (strain KT0803) GN=katG PE=3 SV=1 118 345 1.0E-07
sp|B1JVZ2|KATG1_BURCC Catalase-peroxidase 1 OS=Burkholderia cenocepacia (strain MC0-3) GN=katG1 PE=3 SV=1 118 345 1.0E-07
sp|A0K4Q2|KATG1_BURCH Catalase-peroxidase 1 OS=Burkholderia cenocepacia (strain HI2424) GN=katG1 PE=3 SV=1 118 345 1.0E-07
sp|Q1BYZ9|KATG1_BURCA Catalase-peroxidase 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=katG1 PE=3 SV=1 118 345 1.0E-07
sp|A0L153|KATG2_SHESA Catalase-peroxidase 2 OS=Shewanella sp. (strain ANA-3) GN=katG2 PE=3 SV=1 116 335 1.0E-07
sp|Q2TW34|KATG_ASPOR Catalase-peroxidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=katG PE=3 SV=1 118 345 1.0E-07
sp|Q9FL16|PER63_ARATH Peroxidase 63 OS=Arabidopsis thaliana GN=PER63 PE=2 SV=1 174 347 1.0E-07
sp|Q4ZNN4|KATG_PSEU2 Catalase-peroxidase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=katG PE=3 SV=1 91 204 1.0E-07
sp|A0KRY0|KATG1_SHESA Catalase-peroxidase 1 OS=Shewanella sp. (strain ANA-3) GN=katG1 PE=3 SV=1 118 344 2.0E-07
sp|Q87I38|KATG2_VIBPA Catalase-peroxidase 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=katG2 PE=3 SV=1 118 344 2.0E-07
sp|A4FIR1|KATG_SACEN Catalase-peroxidase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=katG PE=3 SV=1 118 345 2.0E-07
sp|Q0C0D1|KATG_HYPNA Catalase-peroxidase OS=Hyphomonas neptunium (strain ATCC 15444) GN=katG PE=3 SV=1 118 344 2.0E-07
sp|A2SMA4|KATG_METPP Catalase-peroxidase OS=Methylibium petroleiphilum (strain PM1) GN=katG PE=3 SV=1 118 345 2.0E-07
sp|C1AV76|KATG_RHOOB Catalase-peroxidase OS=Rhodococcus opacus (strain B4) GN=katG PE=3 SV=1 118 345 2.0E-07
sp|B1KFI8|KATG_SHEWM Catalase-peroxidase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=katG PE=3 SV=1 118 337 2.0E-07
sp|Q96VT4|KATG_EMENI Catalase-peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=katG PE=1 SV=1 118 345 2.0E-07
sp|B2VFG0|KATG_ERWT9 Catalase-peroxidase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=katG PE=3 SV=1 82 345 2.0E-07
sp|A1TA09|KATG1_MYCVP Catalase-peroxidase 1 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=katG1 PE=3 SV=1 116 346 2.0E-07
sp|Q2H7U1|KATG_CHAGB Catalase-peroxidase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=katG PE=3 SV=1 91 204 2.0E-07
sp|A1TRV8|KATG_ACIAC Catalase-peroxidase OS=Acidovorax citrulli (strain AAC00-1) GN=katG PE=3 SV=1 91 204 2.0E-07
sp|A2Q7T1|KATG_ASPNC Catalase-peroxidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=katG PE=3 SV=1 91 204 2.0E-07
sp|A5FD11|KATG_FLAJ1 Catalase-peroxidase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=katG PE=3 SV=1 91 204 2.0E-07
sp|Q2TW34|KATG_ASPOR Catalase-peroxidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=katG PE=3 SV=1 91 204 2.0E-07
sp|Q87C18|KATG_XYLFT Catalase-peroxidase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=katG PE=3 SV=1 91 204 2.0E-07
sp|B2I5Z2|KATG_XYLF2 Catalase-peroxidase OS=Xylella fastidiosa (strain M23) GN=katG PE=3 SV=1 91 204 2.0E-07
sp|B0U3C6|KATG_XYLFM Catalase-peroxidase OS=Xylella fastidiosa (strain M12) GN=katG PE=3 SV=1 91 204 2.0E-07
sp|Q87WL6|KATG_PSESM Catalase-peroxidase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=katG PE=3 SV=1 91 204 2.0E-07
sp|Q9PBB2|KATG_XYLFA Catalase-peroxidase OS=Xylella fastidiosa (strain 9a5c) GN=katG PE=3 SV=1 91 204 2.0E-07
sp|A4SS04|KATG_AERS4 Catalase-peroxidase OS=Aeromonas salmonicida (strain A449) GN=katG PE=3 SV=1 118 344 3.0E-07
sp|Q082Q2|KATG1_SHEFN Catalase-peroxidase 1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=katG1 PE=3 SV=2 118 344 3.0E-07
sp|Q2FSF4|KATG_METHJ Catalase-peroxidase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=katG PE=3 SV=2 118 345 3.0E-07
sp|A8LBC6|KATG_FRASN Catalase-peroxidase OS=Frankia sp. (strain EAN1pec) GN=katG PE=3 SV=1 118 345 3.0E-07
sp|A4R5S9|KATG1_MAGO7 Catalase-peroxidase 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=katG1 PE=1 SV=1 91 204 3.0E-07
sp|A1REM5|KATG_SHESW Catalase-peroxidase OS=Shewanella sp. (strain W3-18-1) GN=katG PE=3 SV=1 118 344 4.0E-07
sp|A4Y2G4|KATG_SHEPC Catalase-peroxidase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=katG PE=3 SV=1 118 344 4.0E-07
sp|A4T0J1|KATG_POLSQ Catalase-peroxidase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=katG PE=3 SV=1 118 344 5.0E-07
sp|A0B2Q6|KATG2_BURCH Catalase-peroxidase 2 OS=Burkholderia cenocepacia (strain HI2424) GN=katG2 PE=3 SV=1 118 344 5.0E-07
sp|B1K6I9|KATG2_BURCC Catalase-peroxidase 2 OS=Burkholderia cenocepacia (strain MC0-3) GN=katG2 PE=3 SV=1 118 344 5.0E-07
sp|Q1BQP0|KATG2_BURCA Catalase-peroxidase 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=katG2 PE=3 SV=1 118 344 5.0E-07
sp|Q0U324|KATG_PHANO Catalase-peroxidase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=katG PE=3 SV=1 91 204 5.0E-07
sp|B0SX45|KATG_CAUSK Catalase-peroxidase OS=Caulobacter sp. (strain K31) GN=katG PE=3 SV=1 116 345 6.0E-07
sp|B0SLJ6|KATG_LEPBP Catalase-peroxidase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=katG PE=3 SV=1 116 345 6.0E-07
sp|B0SD19|KATG_LEPBA Catalase-peroxidase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=katG PE=3 SV=1 116 345 6.0E-07
sp|O81772|PER46_ARATH Peroxidase 46 OS=Arabidopsis thaliana GN=PER46 PE=3 SV=1 174 357 6.0E-07
sp|B1XK45|KATG_SYNP2 Catalase-peroxidase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=katG PE=3 SV=1 118 344 7.0E-07
sp|Q2N806|KATG_ERYLH Catalase-peroxidase OS=Erythrobacter litoralis (strain HTCC2594) GN=katG PE=3 SV=1 110 334 9.0E-07
sp|Q2J2I9|KATG_RHOP2 Catalase-peroxidase OS=Rhodopseudomonas palustris (strain HaA2) GN=katG PE=3 SV=1 118 344 9.0E-07
sp|Q5V0S5|KATG1_HALMA Catalase-peroxidase 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=katG1 PE=3 SV=1 118 286 1.0E-06
sp|O59651|KATG2_HALMA Catalase-peroxidase 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=katG2 PE=1 SV=3 91 286 1.0E-06
sp|A8IHK8|KATG_AZOC5 Catalase-peroxidase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=katG PE=3 SV=1 118 345 1.0E-06
sp|B3EEA0|KATG_CHLL2 Catalase-peroxidase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=katG PE=3 SV=1 116 345 1.0E-06
sp|Q39JF1|KATG_BURL3 Catalase-peroxidase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=katG PE=3 SV=1 118 345 1.0E-06
sp|Q1M498|KATG_RHIL3 Catalase-peroxidase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=katG PE=3 SV=1 118 344 1.0E-06
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 96 346 1.0E-06
sp|B2ASU5|KATG_PODAN Catalase-peroxidase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=katG PE=3 SV=1 91 204 2.0E-06
sp|Q0AL71|KATG_MARMM Catalase-peroxidase OS=Maricaulis maris (strain MCS10) GN=katG PE=3 SV=1 118 344 3.0E-06
sp|A6T9H9|KATG_KLEP7 Catalase-peroxidase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=katG PE=3 SV=1 118 345 3.0E-06
sp|Q1R185|KATG_CHRSD Catalase-peroxidase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=katG PE=3 SV=1 118 343 3.0E-06
sp|A1WUH1|KATG_HALHL Catalase-peroxidase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=katG PE=3 SV=1 118 343 5.0E-06
sp|A8GGQ0|KATG_SERP5 Catalase-peroxidase OS=Serratia proteamaculans (strain 568) GN=katG PE=3 SV=1 117 345 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006979 response to oxidative stress Yes
GO:0020037 heme binding Yes
GO:0004601 peroxidase activity Yes
GO:0006950 response to stress No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0016209 antioxidant activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0050896 response to stimulus No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8314
MASAARHLARAATRASARSACAAAPRQAFGQQGRRWYSSESGGPKPSSSSTWLYLTGAAAAAAGGLGYWFYAGGG
APSTASAKVVKPTRDDYQKVYDEIAQRLEDLDDYDDGSYGPVLLRLAWHASGTYDKETGTGGSNGATMRFAPESD
HGANAGLKAARDFLEPVKAQFPWISYSDLWILGGVCAVQEMQGPIIPYRPGRSDRDVAACTPDGRLPDATQGSDH
LRNIFYRMGFNDQEIVALSGAHALGRCHPDRSGFDGPWTFSPTVLTNDFYRLLLEEKWQWKKWDGPKQFEDKTTK
SLMMLPTDMVLVQDKKFKPWTEKYAKDNDAFFKDFAAVVVKLFELGVPFADGSEKQRWTMKPTWDES*
Coding >Hirsu2|8314
ATGGCCTCTGCTGCCCGCCACCTCGCCCGCGCGGCGACGCGCGCCTCCGCCCGCAGCGCCTGTGCCGCGGCCCCC
CGCCAGGCCTTCGGCCAGCAGGGCCGCCGCTGGTACTCGTCTGAGAGCGGCGGCCCGAAGCCGTCGTCGTCGTCG
ACCTGGCTGTACCTGACGGGTGCCGCCGCCGCGGCCGCCGGTGGCCTCGGCTACTGGTTCTACGCGGGCGGCGGG
GCGCCGTCGACCGCCTCCGCCAAGGTTGTCAAGCCGACTAGGGACGACTATCAGAAGGTCTACGATGAGATCGCC
CAGCGGCTCGAGGACCTCGACGACTACGACGACGGCAGCTACGGGCCCGTCTTGCTGCGCCTCGCCTGGCACGCC
AGCGGCACCTACGACAAGGAGACGGGCACCGGCGGCAGCAACGGCGCCACGATGCGCTTCGCCCCCGAGTCAGAC
CACGGCGCCAATGCCGGCCTCAAGGCCGCCCGCGACTTTCTCGAACCGGTCAAGGCCCAGTTCCCCTGGATCAGC
TACTCCGACCTCTGGATCCTGGGCGGCGTCTGCGCCGTCCAGGAGATGCAGGGCCCCATCATCCCCTACCGGCCC
GGCCGCAGCGACCGGGACGTGGCTGCCTGCACCCCCGACGGACGCCTGCCCGACGCCACCCAGGGCTCGGACCAC
CTCCGCAACATCTTTTACCGCATGGGCTTCAACGACCAGGAGATTGTCGCCCTTTCCGGCGCCCACGCCCTAGGC
CGCTGTCACCCGGACCGGTCTGGCTTCGACGGGCCCTGGACCTTCTCCCCGACCGTGCTGACCAACGACTTCTAC
CGCCTACTCCTGGAGGAGAAGTGGCAGTGGAAGAAGTGGGACGGCCCGAAGCAGTTCGAGGACAAGACGACCAAG
TCTCTGATGATGCTGCCGACCGACATGGTGCTCGTCCAGGACAAGAAGTTCAAGCCGTGGACGGAGAAGTACGCC
AAAGACAACGACGCCTTCTTCAAGGACTTTGCCGCCGTCGTCGTCAAGCTGTTCGAGCTGGGGGTCCCCTTCGCC
GACGGCAGCGAGAAACAGCGGTGGACGATGAAGCCTACCTGGGACGAATCGTAG
Transcript >Hirsu2|8314
ATGGCCTCTGCTGCCCGCCACCTCGCCCGCGCGGCGACGCGCGCCTCCGCCCGCAGCGCCTGTGCCGCGGCCCCC
CGCCAGGCCTTCGGCCAGCAGGGCCGCCGCTGGTACTCGTCTGAGAGCGGCGGCCCGAAGCCGTCGTCGTCGTCG
ACCTGGCTGTACCTGACGGGTGCCGCCGCCGCGGCCGCCGGTGGCCTCGGCTACTGGTTCTACGCGGGCGGCGGG
GCGCCGTCGACCGCCTCCGCCAAGGTTGTCAAGCCGACTAGGGACGACTATCAGAAGGTCTACGATGAGATCGCC
CAGCGGCTCGAGGACCTCGACGACTACGACGACGGCAGCTACGGGCCCGTCTTGCTGCGCCTCGCCTGGCACGCC
AGCGGCACCTACGACAAGGAGACGGGCACCGGCGGCAGCAACGGCGCCACGATGCGCTTCGCCCCCGAGTCAGAC
CACGGCGCCAATGCCGGCCTCAAGGCCGCCCGCGACTTTCTCGAACCGGTCAAGGCCCAGTTCCCCTGGATCAGC
TACTCCGACCTCTGGATCCTGGGCGGCGTCTGCGCCGTCCAGGAGATGCAGGGCCCCATCATCCCCTACCGGCCC
GGCCGCAGCGACCGGGACGTGGCTGCCTGCACCCCCGACGGACGCCTGCCCGACGCCACCCAGGGCTCGGACCAC
CTCCGCAACATCTTTTACCGCATGGGCTTCAACGACCAGGAGATTGTCGCCCTTTCCGGCGCCCACGCCCTAGGC
CGCTGTCACCCGGACCGGTCTGGCTTCGACGGGCCCTGGACCTTCTCCCCGACCGTGCTGACCAACGACTTCTAC
CGCCTACTCCTGGAGGAGAAGTGGCAGTGGAAGAAGTGGGACGGCCCGAAGCAGTTCGAGGACAAGACGACCAAG
TCTCTGATGATGCTGCCGACCGACATGGTGCTCGTCCAGGACAAGAAGTTCAAGCCGTGGACGGAGAAGTACGCC
AAAGACAACGACGCCTTCTTCAAGGACTTTGCCGCCGTCGTCGTCAAGCTGTTCGAGCTGGGGGTCCCCTTCGCC
GACGGCAGCGAGAAACAGCGGTGGACGATGAAGCCTACCTGGGACGAATCGTAG
Gene >Hirsu2|8314
ATGGCCTCTGCTGCCCGCCACCTCGCCCGCGCGGCGACGCGCGCCTCCGCCCGCAGCGCCTGTGCCGCGGCCCCC
CGCCAGGCCTTCGGCCAGCAGGGCCGCCGCTGGTACTCGTCTGAGAGCGGCGGCCCGAAGCCGTCGTCGTCGTCG
ACCTGGCTGTACCTGACGGGTGCCGCCGCCGCGGCCGCCGGTGGCCTCGGCTACTGGTTCTACGCGGGCGGCGGG
GCGCCGTCGACCGCCTCCGCCAAGGTTGTCAAGCCGACTAGGGACGACTATCAGAAGGTCTACGATGAGATCGCC
CAGCGGCTCGAGGACCTCGACGACTACGACGACGGCAGCTACGGGCCCGTCTTGCTGCGCCTCGCCTGGCACGCC
AGCGGCACCTACGACAAGGAGACGGGCACCGGCGGCAGCAACGGCGCCACGATGCGCTTCGCCCCCGAGTCAGAC
CACGGCGCCAATGCCGGCCTCAAGGCCGCCCGCGACTTTCTCGAACCGGTCAAGGGTGAGCCTCTTTCTTTTCTC
TTTTCTTTTTTTTTCCTCACTTCATCGTTCCGCTGCTGACCGGCTCCGCAGCCCAGTTCCCCTGGATCAGCTACT
CCGACCTCTGGATCCTGGGCGGCGTCTGCGCCGTCCAGGAGATGCAGGGCCCCATCATCCCCTACCGGCCCGGCC
GCAGCGACCGGGACGTGGCTGCCTGCACCCCCGACGGACGCCTGCCCGACGCCACCCAGGGCTCGGACCACCTCC
GCAACATCTTTTACCGCATGGGCTTCAACGACCAGGAGATTGTCGCCCTTTCCGGCGCCCACGCCCTAGGCCGCT
GTCACCCGGACCGGTCTGGCTTCGACGGGCCCTGGACCTTCTCCCCGACCGTGCTGACCAACGACTTCTACCGCC
TACTCCTGGAGGAGAAGTGGCAGTGGAAGAAGTGGGACGGCCCGAAGCAGGTGAGCGCGGCCCGGTCGAGGGAAG
CGGTTTCGCAGCCGACTGACGTTTTTTTTTTTTGCCGCCCCCGCAGTTCGAGGACAAGACGACCAAGTCTCTGAT
GATGCTGCCGACCGACATGGTGCTCGTCCAGGACAAGAAGTTCAAGCCGTGGACGGAGAAGTACGCCAAAGACAA
CGACGCCTTCTTCAAGGACTTTGCCGCCGTCGTCGTCAAGCTGTTCGAGCTGGGGGTCCCCTTCGCCGACGGCAG
CGAGAAACAGCGGTGGACGATGAAGCCTACCTGGGACGAATCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail