Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8305
Gene name
LocationContig_533:5568..6741
Strand-
Gene length (bp)1173
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01171 ATP_bind_3 PP-loop family 1.3E-18 54 233
PF16503 zn-ribbon_14 Zinc-ribbon 2.9E-16 358 388

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2Q879|CTU1_ASPNC Cytoplasmic tRNA 2-thiolation protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ncs6 PE=3 SV=1 1 279 8.0E-162
sp|Q6C8R5|CTU1_YARLI Cytoplasmic tRNA 2-thiolation protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NCS6 PE=3 SV=1 6 390 4.0E-146
sp|Q6CWX6|CTU1_KLULA Cytoplasmic tRNA 2-thiolation protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NCS6 PE=3 SV=1 6 388 4.0E-143
sp|Q5AML2|CTU1_CANAL Cytoplasmic tRNA 2-thiolation protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NCS6 PE=3 SV=1 6 390 4.0E-143
sp|A3GGB3|CTU1_PICST Cytoplasmic tRNA 2-thiolation protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NCS6 PE=3 SV=2 6 390 4.0E-142
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2Q879|CTU1_ASPNC Cytoplasmic tRNA 2-thiolation protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ncs6 PE=3 SV=1 1 279 8.0E-162
sp|Q6C8R5|CTU1_YARLI Cytoplasmic tRNA 2-thiolation protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NCS6 PE=3 SV=1 6 390 4.0E-146
sp|Q6CWX6|CTU1_KLULA Cytoplasmic tRNA 2-thiolation protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NCS6 PE=3 SV=1 6 388 4.0E-143
sp|Q5AML2|CTU1_CANAL Cytoplasmic tRNA 2-thiolation protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NCS6 PE=3 SV=1 6 390 4.0E-143
sp|A3GGB3|CTU1_PICST Cytoplasmic tRNA 2-thiolation protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NCS6 PE=3 SV=2 6 390 4.0E-142
sp|A5DPQ4|CTU1_PICGU Cytoplasmic tRNA 2-thiolation protein 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NCS6 PE=3 SV=2 4 390 9.0E-140
sp|Q755T1|CTU1_ASHGO Cytoplasmic tRNA 2-thiolation protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NCS6 PE=3 SV=1 6 390 2.0E-139
sp|B5RV24|CTU1_DEBHA Cytoplasmic tRNA 2-thiolation protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NCS6 PE=3 SV=1 6 390 5.0E-139
sp|B0DK66|CTU1_LACBS Cytoplasmic tRNA 2-thiolation protein 1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=NCS6 PE=3 SV=1 1 268 1.0E-136
sp|Q5FW05|CTU1_XENTR Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus tropicalis GN=ctu1 PE=2 SV=1 3 271 2.0E-136
sp|P0CS70|CTU1_CRYNJ Cytoplasmic tRNA 2-thiolation protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NCS6 PE=3 SV=1 1 270 1.0E-135
sp|P0CS71|CTU1_CRYNB Cytoplasmic tRNA 2-thiolation protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NCS6 PE=3 SV=1 1 270 1.0E-135
sp|Q6FMB5|CTU1_CANGA Cytoplasmic tRNA 2-thiolation protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NCS6 PE=3 SV=1 6 271 6.0E-135
sp|A7TER7|CTU1_VANPO Cytoplasmic tRNA 2-thiolation protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NCS6 PE=3 SV=1 6 271 3.0E-134
sp|Q05AW7|CTU1_XENLA Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus laevis GN=ctu1 PE=2 SV=1 3 271 5.0E-134
sp|Q4P6R3|CTU1_USTMA Cytoplasmic tRNA 2-thiolation protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NCS6 PE=3 SV=2 1 270 3.0E-133
sp|O64862|CTU1_ARATH Cytoplasmic tRNA 2-thiolation protein 1 OS=Arabidopsis thaliana GN=NCS6 PE=2 SV=2 6 277 2.0E-132
sp|Q94480|CTU1_DICDI Cytoplasmic tRNA 2-thiolation protein 1 OS=Dictyostelium discoideum GN=ctu1 PE=2 SV=2 6 308 6.0E-132
sp|A8JF71|CTU1_CHLRE Cytoplasmic tRNA 2-thiolation protein 1 OS=Chlamydomonas reinhardtii GN=NCS6 PE=3 SV=1 1 270 8.0E-132
sp|Q803X1|CTU1_DANRE Cytoplasmic tRNA 2-thiolation protein 1 OS=Danio rerio GN=ctu1 PE=2 SV=1 3 271 2.0E-131
sp|O94282|CTU1_SCHPO Cytoplasmic tRNA 2-thiolation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ncs6 PE=1 SV=1 1 270 1.0E-130
sp|B4LM02|CTU1_DROVI Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila virilis GN=GJ21203 PE=3 SV=1 3 270 6.0E-130
sp|B4J5B3|CTU1_DROGR Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila grimshawi GN=GH20281 PE=3 SV=1 3 270 7.0E-130
sp|B3MI77|CTU1_DROAN Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila ananassae GN=GF12710 PE=3 SV=1 3 270 8.0E-130
sp|A6ZTX8|CTU1_YEAS7 Cytoplasmic tRNA 2-thiolation protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NCS6 PE=3 SV=1 6 271 1.0E-129
sp|B3LHQ7|CTU1_YEAS1 Cytoplasmic tRNA 2-thiolation protein 1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=NCS6 PE=3 SV=1 6 271 1.0E-129
sp|P53088|CTU1_YEAST Cytoplasmic tRNA 2-thiolation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCS6 PE=1 SV=3 6 271 1.0E-129
sp|B4P3W7|CTU1_DROYA Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila yakuba GN=GE22576 PE=3 SV=1 3 270 2.0E-129
sp|B4KLL0|CTU1_DROMO Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila mojavensis GN=GI19452 PE=3 SV=1 3 270 3.0E-129
sp|B4HSL7|CTU1_DROSE Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila sechellia GN=GM20632 PE=3 SV=1 3 270 4.0E-129
sp|B3N7L9|CTU1_DROER Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila erecta GN=GG10584 PE=3 SV=1 3 270 6.0E-129
sp|Q7JWW5|CTU1_DROME Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila melanogaster GN=CG8078 PE=1 SV=1 7 270 8.0E-129
sp|Q6Z6G6|CTU1_ORYSJ Cytoplasmic tRNA 2-thiolation protein 1 OS=Oryza sativa subsp. japonica GN=NCS6 PE=2 SV=1 6 270 3.0E-128
sp|A8PVM6|CTU1_MALGO Cytoplasmic tRNA 2-thiolation protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=NCS6 PE=3 SV=1 3 270 9.0E-128
sp|B4NN33|CTU1_DROWI Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila willistoni GN=GK22963 PE=3 SV=1 3 270 1.0E-125
sp|Q28ZC1|CTU1_DROPS Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila pseudoobscura pseudoobscura GN=GA20807 PE=3 SV=2 3 270 2.0E-125
sp|B4GHY8|CTU1_DROPE Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila persimilis GN=GL16852 PE=3 SV=1 3 270 5.0E-125
sp|Q16QI1|CTU1_AEDAE Cytoplasmic tRNA 2-thiolation protein 1 OS=Aedes aegypti GN=AAEL011283 PE=3 SV=1 3 271 6.0E-119
sp|A5E3Q3|CTU1_LODEL Cytoplasmic tRNA 2-thiolation protein 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NCS6 PE=3 SV=1 6 390 2.0E-118
sp|Q7Q9I4|CTU1_ANOGA Cytoplasmic tRNA 2-thiolation protein 1 OS=Anopheles gambiae GN=AGAP005220 PE=3 SV=3 3 270 5.0E-117
sp|A8WR63|CTU1_CAEBR Cytoplasmic tRNA 2-thiolation protein 1 OS=Caenorhabditis briggsae GN=tut-1 PE=3 SV=1 3 271 5.0E-117
sp|O76365|CTU1_CAEEL Cytoplasmic tRNA 2-thiolation protein 1 OS=Caenorhabditis elegans GN=tut-1 PE=1 SV=1 3 271 2.0E-112
sp|Q7Z7A3|CTU1_HUMAN Cytoplasmic tRNA 2-thiolation protein 1 OS=Homo sapiens GN=CTU1 PE=1 SV=1 1 271 8.0E-96
sp|Q99J10|CTU1_MOUSE Cytoplasmic tRNA 2-thiolation protein 1 OS=Mus musculus GN=Ctu1 PE=2 SV=1 1 268 1.0E-95
sp|Q0VC66|CTU1_BOVIN Cytoplasmic tRNA 2-thiolation protein 1 OS=Bos taurus GN=CTU1 PE=2 SV=1 1 271 5.0E-95
sp|B1WBV0|CTU1_RAT Cytoplasmic tRNA 2-thiolation protein 1 OS=Rattus norvegicus GN=Ctu1 PE=2 SV=1 1 268 3.0E-94
sp|Q58558|Y1157_METJA CTU1/ATPBD3 family protein MJ1157 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1157 PE=3 SV=1 12 272 1.0E-35
sp|Q58873|Y1478_METJA CTU1/ATPBD3 family protein MJ1478 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1478 PE=3 SV=1 6 257 1.0E-26
sp|Q2YBQ4|TTCA_NITMU tRNA 2-thiocytidine biosynthesis protein TtcA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ttcA PE=3 SV=1 42 262 1.0E-15
sp|A6T3N1|TTCA_JANMA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Janthinobacterium sp. (strain Marseille) GN=ttcA PE=3 SV=1 10 266 3.0E-15
sp|Q82UJ4|TTCA_NITEU tRNA 2-thiocytidine biosynthesis protein TtcA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ttcA PE=3 SV=1 42 257 3.0E-15
sp|B2T6U6|TTCA_BURPP tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ttcA PE=3 SV=1 37 266 3.0E-15
sp|B5FE41|TTCA_VIBFM tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio fischeri (strain MJ11) GN=ttcA PE=3 SV=1 40 260 3.0E-15
sp|Q5E590|TTCA_VIBF1 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ttcA PE=3 SV=1 40 260 3.0E-15
sp|Q1IX43|TTCA_DEIGD tRNA 2-thiocytidine biosynthesis protein TtcA OS=Deinococcus geothermalis (strain DSM 11300) GN=ttcA PE=3 SV=1 40 283 6.0E-15
sp|Q13T64|TTCA_BURXL tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia xenovorans (strain LB400) GN=ttcA PE=3 SV=1 37 260 8.0E-15
sp|A9HY25|TTCA_BORPD tRNA 2-thiocytidine biosynthesis protein TtcA OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=ttcA PE=3 SV=1 37 275 1.0E-14
sp|C3LMC8|TTCA_VIBCM tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ttcA PE=3 SV=1 40 271 2.0E-14
sp|Q9KS29|TTCA_VIBCH tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ttcA PE=3 SV=1 40 271 2.0E-14
sp|Q9RX35|TTCA_DEIRA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ttcA PE=3 SV=1 30 286 2.0E-14
sp|A7H8W2|TTCA_ANADF tRNA 2-thiocytidine biosynthesis protein TtcA OS=Anaeromyxobacter sp. (strain Fw109-5) GN=ttcA PE=3 SV=1 40 309 3.0E-14
sp|A4G9W3|TTCA_HERAR tRNA 2-thiocytidine biosynthesis protein TtcA OS=Herminiimonas arsenicoxydans GN=ttcA PE=3 SV=1 10 266 4.0E-14
sp|Q63Y74|TTCA_BURPS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia pseudomallei (strain K96243) GN=ttcA PE=3 SV=1 37 278 4.0E-14
sp|A3N4V9|TTCA_BURP6 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia pseudomallei (strain 668) GN=ttcA PE=3 SV=1 37 278 4.0E-14
sp|Q3JWX0|TTCA_BURP1 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia pseudomallei (strain 1710b) GN=ttcA PE=3 SV=1 37 278 4.0E-14
sp|A3NQK2|TTCA_BURP0 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia pseudomallei (strain 1106a) GN=ttcA PE=3 SV=1 37 278 4.0E-14
sp|A1V7Z5|TTCA_BURMS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia mallei (strain SAVP1) GN=ttcA PE=3 SV=1 37 278 4.0E-14
sp|Q62EN9|TTCA_BURMA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia mallei (strain ATCC 23344) GN=ttcA PE=3 SV=1 37 278 4.0E-14
sp|A2S7T4|TTCA_BURM9 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia mallei (strain NCTC 10229) GN=ttcA PE=3 SV=1 37 278 4.0E-14
sp|A3MND8|TTCA_BURM7 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia mallei (strain NCTC 10247) GN=ttcA PE=3 SV=1 37 278 4.0E-14
sp|Q47ZU5|TTCA_COLP3 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ttcA PE=3 SV=1 40 314 5.0E-14
sp|A5F888|TTCA_VIBC3 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ttcA PE=3 SV=1 40 271 5.0E-14
sp|C6E087|TTCA_GEOSM tRNA 2-thiocytidine biosynthesis protein TtcA OS=Geobacter sp. (strain M21) GN=ttcA PE=3 SV=1 25 257 6.0E-14
sp|B5ED57|TTCA_GEOBB tRNA 2-thiocytidine biosynthesis protein TtcA OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=ttcA PE=3 SV=1 25 257 6.0E-14
sp|Q2T1V1|TTCA_BURTA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ttcA PE=3 SV=1 37 302 1.0E-13
sp|Q5F956|TTCA_NEIG1 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=ttcA PE=3 SV=1 41 287 1.0E-13
sp|B4RMM2|TTCA_NEIG2 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Neisseria gonorrhoeae (strain NCCP11945) GN=ttcA PE=3 SV=1 41 287 1.0E-13
sp|Q74GW7|TTCA_GEOSL tRNA 2-thiocytidine biosynthesis protein TtcA OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ttcA PE=3 SV=2 34 266 1.0E-13
sp|Q7WEL6|TTCA_BORBR tRNA 2-thiocytidine biosynthesis protein TtcA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ttcA PE=3 SV=1 37 305 1.0E-13
sp|A1S6K0|TTCA_SHEAM tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ttcA PE=3 SV=1 37 271 1.0E-13
sp|Q7W398|TTCA_BORPA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ttcA PE=3 SV=1 37 305 2.0E-13
sp|Q7VU56|TTCA_BORPE tRNA 2-thiocytidine biosynthesis protein TtcA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ttcA PE=3 SV=1 37 305 2.0E-13
sp|A0KKM7|TTCA_AERHH tRNA 2-thiocytidine biosynthesis protein TtcA OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=ttcA PE=3 SV=1 38 262 3.0E-13
sp|A4JIF6|TTCA_BURVG tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ttcA PE=3 SV=1 4 260 3.0E-13
sp|Q39QC5|TTCA_GEOMG tRNA 2-thiocytidine biosynthesis protein TtcA OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=ttcA PE=3 SV=2 41 266 3.0E-13
sp|Q0AI06|TTCA_NITEC tRNA 2-thiocytidine biosynthesis protein TtcA OS=Nitrosomonas eutropha (strain C91) GN=ttcA PE=3 SV=1 42 257 3.0E-13
sp|A3QEG3|TTCA_SHELP tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ttcA PE=3 SV=1 37 278 3.0E-13
sp|A9LZH0|TTCA_NEIM0 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Neisseria meningitidis serogroup C (strain 053442) GN=ttcA PE=3 SV=2 46 262 3.0E-13
sp|Q39C93|TTCA_BURL3 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ttcA PE=3 SV=1 37 275 3.0E-13
sp|C4L8F7|TTCA_TOLAT tRNA 2-thiocytidine biosynthesis protein TtcA OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ttcA PE=3 SV=1 38 262 3.0E-13
sp|B6ELU0|TTCA_ALISL tRNA 2-thiocytidine biosynthesis protein TtcA OS=Aliivibrio salmonicida (strain LFI1238) GN=ttcA PE=3 SV=1 42 222 4.0E-13
sp|A5GBX4|TTCA_GEOUR tRNA 2-thiocytidine biosynthesis protein TtcA OS=Geobacter uraniireducens (strain Rf4) GN=ttcA PE=3 SV=1 25 257 4.0E-13
sp|A9AKB0|TTCA_BURM1 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ttcA PE=3 SV=1 37 260 4.0E-13
sp|Q5ZXN3|TTCA_LEGPH tRNA 2-thiocytidine biosynthesis protein TtcA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=ttcA PE=3 SV=1 38 222 5.0E-13
sp|A4SMC4|TTCA_AERS4 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Aeromonas salmonicida (strain A449) GN=ttcA PE=3 SV=1 38 262 5.0E-13
sp|Q7MKU7|TTCA_VIBVY tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio vulnificus (strain YJ016) GN=ttcA PE=3 SV=1 40 271 6.0E-13
sp|A1RJP0|TTCA_SHESW tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella sp. (strain W3-18-1) GN=ttcA PE=3 SV=1 37 271 6.0E-13
sp|A4Y6T9|TTCA_SHEPC tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ttcA PE=3 SV=1 37 271 6.0E-13
sp|Q5X752|TTCA_LEGPA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Legionella pneumophila (strain Paris) GN=ttcA PE=3 SV=1 38 222 6.0E-13
sp|A5IGL1|TTCA_LEGPC tRNA 2-thiocytidine biosynthesis protein TtcA OS=Legionella pneumophila (strain Corby) GN=ttcA PE=3 SV=1 38 222 7.0E-13
sp|Q7NQK6|TTCA_CHRVO tRNA 2-thiocytidine biosynthesis protein TtcA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ttcA PE=3 SV=1 39 334 7.0E-13
sp|Q65TL6|TTCA_MANSM tRNA 2-thiocytidine biosynthesis protein TtcA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=ttcA PE=3 SV=1 38 260 7.0E-13
sp|Q1BSY9|TTCA_BURCA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia cenocepacia (strain AU 1054) GN=ttcA PE=3 SV=1 37 275 7.0E-13
sp|A1IS67|TTCA_NEIMA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ttcA PE=3 SV=1 46 262 7.0E-13
sp|B1JZU7|TTCA_BURCC tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia cenocepacia (strain MC0-3) GN=ttcA PE=3 SV=1 37 275 8.0E-13
sp|A0KB51|TTCA_BURCH tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia cenocepacia (strain HI2424) GN=ttcA PE=3 SV=1 37 275 8.0E-13
sp|B2UD46|TTCA_RALPJ tRNA 2-thiocytidine biosynthesis protein TtcA OS=Ralstonia pickettii (strain 12J) GN=ttcA PE=3 SV=1 34 266 8.0E-13
sp|Q1CZQ8|TTCA_MYXXD tRNA 2-thiocytidine biosynthesis protein TtcA OS=Myxococcus xanthus (strain DK 1622) GN=ttcA PE=3 SV=1 42 262 9.0E-13
sp|C5CNK9|TTCA_VARPS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Variovorax paradoxus (strain S110) GN=ttcA PE=3 SV=1 37 262 9.0E-13
sp|Q8D9J0|TTCA_VIBVU tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio vulnificus (strain CMCP6) GN=ttcA PE=3 SV=1 40 271 1.0E-12
sp|A5WG99|TTCA_PSYWF tRNA 2-thiocytidine biosynthesis protein TtcA OS=Psychrobacter sp. (strain PRwf-1) GN=ttcA PE=3 SV=1 38 271 1.0E-12
sp|A9MQT5|TTCA_SALAR tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ttcA PE=3 SV=1 38 308 1.0E-12
sp|Q7N3Y7|TTCA_PHOLL tRNA 2-thiocytidine biosynthesis protein TtcA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ttcA PE=3 SV=1 37 271 1.0E-12
sp|B0TY35|TTCA1_FRAP2 tRNA 2-thiocytidine biosynthesis protein TtcA 1 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=ttcA1 PE=3 SV=1 31 266 1.0E-12
sp|B1YP61|TTCA_BURA4 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia ambifaria (strain MC40-6) GN=ttcA PE=3 SV=1 37 260 1.0E-12
sp|B2JIL8|TTCA_BURP8 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ttcA PE=3 SV=1 37 260 1.0E-12
sp|Q5WYK1|TTCA_LEGPL tRNA 2-thiocytidine biosynthesis protein TtcA OS=Legionella pneumophila (strain Lens) GN=ttcA PE=3 SV=1 38 222 1.0E-12
sp|Q12N51|TTCA_SHEDO tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ttcA PE=3 SV=1 37 278 1.0E-12
sp|Q8Y306|TTCA_RALSO tRNA 2-thiocytidine biosynthesis protein TtcA OS=Ralstonia solanacearum (strain GMI1000) GN=ttcA PE=3 SV=1 51 270 2.0E-12
sp|A9KE14|TTCA_COXBN tRNA 2-thiocytidine biosynthesis protein TtcA OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ttcA PE=3 SV=1 38 266 2.0E-12
sp|Q0BB90|TTCA_BURCM tRNA 2-thiocytidine biosynthesis protein TtcA OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ttcA PE=3 SV=1 37 260 2.0E-12
sp|P76055|TTCA_ECOLI tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain K12) GN=ttcA PE=1 SV=1 38 308 2.0E-12
sp|B1XCH3|TTCA_ECODH tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain K12 / DH10B) GN=ttcA PE=3 SV=1 38 308 2.0E-12
sp|C4ZV92|TTCA_ECOBW tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ttcA PE=3 SV=1 38 308 2.0E-12
sp|Q83CP2|TTCA_COXBU tRNA 2-thiocytidine biosynthesis protein TtcA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ttcA PE=3 SV=1 38 266 2.0E-12
sp|B6J7A4|TTCA_COXB1 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Coxiella burnetii (strain CbuK_Q154) GN=ttcA PE=3 SV=1 38 266 2.0E-12
sp|Q3A6S7|TTCA_PELCD tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ttcA PE=3 SV=1 46 262 2.0E-12
sp|A1KU93|TTCA_NEIMF tRNA 2-thiocytidine biosynthesis protein TtcA OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=ttcA PE=3 SV=1 46 262 2.0E-12
sp|C0Q3V6|TTCA_SALPC tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella paratyphi C (strain RKS4594) GN=ttcA PE=3 SV=1 38 308 2.0E-12
sp|Q57P06|TTCA_SALCH tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella choleraesuis (strain SC-B67) GN=ttcA PE=3 SV=1 38 308 2.0E-12
sp|Q83KS7|TTCA_SHIFL tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shigella flexneri GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|Q0T3Z1|TTCA_SHIF8 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shigella flexneri serotype 5b (strain 8401) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|Q320D9|TTCA_SHIBS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shigella boydii serotype 4 (strain Sb227) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|B7NHP6|TTCA_ECO7I tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|A9NCM4|TTCA_COXBR tRNA 2-thiocytidine biosynthesis protein TtcA OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ttcA PE=3 SV=1 38 266 3.0E-12
sp|B4T6P5|TTCA_SALNS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella newport (strain SL254) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|B5RA25|TTCA_SALG2 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|B5R4D8|TTCA_SALEP tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella enteritidis PT4 (strain P125109) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|B5FUP1|TTCA_SALDC tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella dublin (strain CT_02021853) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|Q3Z194|TTCA_SHISS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shigella sonnei (strain Ss046) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|B4TIS7|TTCA_SALHS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella heidelberg (strain SL476) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|B6IA61|TTCA_ECOSE tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain SE11) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|Q8X8Q5|TTCA_ECO57 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O157:H7 GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|B7N4F3|TTCA_ECOLU tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|B1ISR7|TTCA_ECOLC tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|A7ZZT7|TTCA_ECOHS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O9:H4 (strain HS) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|B7LYL5|TTCA_ECO8A tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O8 (strain IAI1) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|B5Z0R4|TTCA_ECO5E tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|A7ZLH4|TTCA_ECO24 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ttcA PE=3 SV=1 38 308 3.0E-12
sp|A1AUS1|TTCA_PELPD tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pelobacter propionicus (strain DSM 2379) GN=ttcA PE=3 SV=1 47 257 3.0E-12
sp|B7L5B2|TTCA_ECO55 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain 55989 / EAEC) GN=ttcA PE=3 SV=1 38 308 4.0E-12
sp|Q6D5P6|TTCA_PECAS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ttcA PE=3 SV=1 42 260 4.0E-12
sp|Q32GI6|TTCA_SHIDS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ttcA PE=3 SV=1 38 308 4.0E-12
sp|A4WAT7|TTCA_ENT38 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Enterobacter sp. (strain 638) GN=ttcA PE=3 SV=1 38 260 4.0E-12
sp|Q8Z783|TTCA_SALTI tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella typhi GN=ttcA PE=3 SV=1 38 308 4.0E-12
sp|B1JJU2|TTCA_YERPY tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ttcA PE=3 SV=1 38 260 4.0E-12
sp|A4TIV5|TTCA_YERPP tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pestis (strain Pestoides F) GN=ttcA PE=3 SV=1 38 260 4.0E-12
sp|Q1CIQ7|TTCA_YERPN tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ttcA PE=3 SV=1 38 260 4.0E-12
sp|A9R8Q5|TTCA_YERPG tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ttcA PE=3 SV=1 38 260 4.0E-12
sp|Q7CIP8|TTCA_YERPE tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pestis GN=ttcA PE=3 SV=1 38 260 4.0E-12
sp|Q1C7C2|TTCA_YERPA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ttcA PE=3 SV=1 38 260 4.0E-12
sp|A7FHP9|TTCA_YERP3 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ttcA PE=3 SV=1 38 260 4.0E-12
sp|Q8ZP88|TTCA_SALTY tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ttcA PE=1 SV=1 38 308 4.0E-12
sp|B5F5C0|TTCA_SALA4 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella agona (strain SL483) GN=ttcA PE=3 SV=1 38 308 4.0E-12
sp|B6J031|TTCA_COXB2 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Coxiella burnetii (strain CbuG_Q212) GN=ttcA PE=3 SV=1 38 266 4.0E-12
sp|A9MXN4|TTCA_SALPB tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ttcA PE=3 SV=1 38 308 5.0E-12
sp|Q9JZJ6|TTCA_NEIMB tRNA 2-thiocytidine biosynthesis protein TtcA OS=Neisseria meningitidis serogroup B (strain MC58) GN=ttcA PE=1 SV=1 46 262 5.0E-12
sp|Q476S4|TTCA_CUPPJ tRNA 2-thiocytidine biosynthesis protein TtcA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ttcA PE=3 SV=1 51 266 5.0E-12
sp|A9BXV6|TTCA_DELAS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=ttcA PE=3 SV=1 37 266 5.0E-12
sp|B4TWA6|TTCA_SALSV tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella schwarzengrund (strain CVM19633) GN=ttcA PE=3 SV=1 38 308 5.0E-12
sp|B5BJ71|TTCA_SALPK tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella paratyphi A (strain AKU_12601) GN=ttcA PE=3 SV=1 38 308 5.0E-12
sp|Q5PHS1|TTCA_SALPA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ttcA PE=3 SV=1 38 308 5.0E-12
sp|Q477W2|TTCA_DECAR tRNA 2-thiocytidine biosynthesis protein TtcA OS=Dechloromonas aromatica (strain RCB) GN=ttcA PE=3 SV=1 42 222 5.0E-12
sp|Q603C7|TTCA_METCA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ttcA PE=3 SV=1 40 271 5.0E-12
sp|Q8EEM4|TTCA_SHEON tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella oneidensis (strain MR-1) GN=ttcA PE=3 SV=1 37 271 6.0E-12
sp|A1JND8|TTCA_YERE8 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ttcA PE=3 SV=1 38 260 8.0E-12
sp|Q0HVA7|TTCA_SHESR tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella sp. (strain MR-7) GN=ttcA PE=3 SV=2 37 271 9.0E-12
sp|Q0HIM8|TTCA_SHESM tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella sp. (strain MR-4) GN=ttcA PE=3 SV=2 37 271 9.0E-12
sp|A0KX28|TTCA_SHESA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella sp. (strain ANA-3) GN=ttcA PE=3 SV=2 37 271 9.0E-12
sp|Q1RC21|TTCA_ECOUT tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain UTI89 / UPEC) GN=ttcA PE=3 SV=1 38 308 1.0E-11
sp|B7MM21|TTCA_ECO45 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ttcA PE=3 SV=1 38 308 1.0E-11
sp|Q2KU24|TTCA_BORA1 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Bordetella avium (strain 197N) GN=ttcA PE=3 SV=1 37 275 1.0E-11
sp|Q8FHP6|TTCA_ECOL6 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ttcA PE=3 SV=1 38 308 1.0E-11
sp|Q0TI22|TTCA_ECOL5 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ttcA PE=3 SV=1 38 308 1.0E-11
sp|B7MUI7|TTCA_ECO81 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O81 (strain ED1a) GN=ttcA PE=3 SV=1 38 308 1.0E-11
sp|A1AAV5|TTCA_ECOK1 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O1:K1 / APEC GN=ttcA PE=3 SV=1 38 308 1.0E-11
sp|B1LG84|TTCA_ECOSM tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ttcA PE=3 SV=1 38 308 1.0E-11
sp|B7LRU9|TTCA_ESCF3 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ttcA PE=3 SV=1 38 291 1.0E-11
sp|B2U0Z1|TTCA_SHIB3 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ttcA PE=3 SV=1 38 308 1.0E-11
sp|C6DJ78|TTCA_PECCP tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ttcA PE=3 SV=1 38 260 1.0E-11
sp|A1TUY3|TTCA_ACIAC tRNA 2-thiocytidine biosynthesis protein TtcA OS=Acidovorax citrulli (strain AAC00-1) GN=ttcA PE=3 SV=1 37 262 1.0E-11
sp|Q66A78|TTCA_YERPS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ttcA PE=3 SV=1 38 260 1.0E-11
sp|B2K5E0|TTCA_YERPB tRNA 2-thiocytidine biosynthesis protein TtcA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ttcA PE=3 SV=1 38 260 1.0E-11
sp|Q1H4T8|TTCA_METFK tRNA 2-thiocytidine biosynthesis protein TtcA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=ttcA PE=3 SV=1 46 266 1.0E-11
sp|Q082E9|TTCA_SHEFN tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella frigidimarina (strain NCIMB 400) GN=ttcA PE=3 SV=1 37 278 2.0E-11
sp|A4T0E0|TTCA_POLSQ tRNA 2-thiocytidine biosynthesis protein TtcA OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=ttcA PE=3 SV=1 13 281 2.0E-11
sp|A1B0E2|TTCA_PARDP tRNA 2-thiocytidine biosynthesis protein TtcA OS=Paracoccus denitrificans (strain Pd 1222) GN=ttcA PE=3 SV=1 37 262 2.0E-11
sp|Q3IYY8|TTCA_RHOS4 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ttcA PE=3 SV=1 37 262 2.0E-11
sp|B9MCI6|TTCA_ACIET tRNA 2-thiocytidine biosynthesis protein TtcA OS=Acidovorax ebreus (strain TPSY) GN=ttcA PE=3 SV=1 37 266 2.0E-11
sp|A1W3C0|TTCA_ACISJ tRNA 2-thiocytidine biosynthesis protein TtcA OS=Acidovorax sp. (strain JS42) GN=ttcA PE=3 SV=1 37 266 2.0E-11
sp|B9KNZ4|TTCA_RHOSK tRNA 2-thiocytidine biosynthesis protein TtcA OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ttcA PE=3 SV=1 37 262 2.0E-11
sp|A3PNA9|TTCA_RHOS1 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ttcA PE=3 SV=1 37 262 2.0E-11
sp|A7N0R3|TTCA_VIBCB tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ttcA PE=3 SV=1 38 280 2.0E-11
sp|A8H4Q7|TTCA_SHEPA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ttcA PE=3 SV=1 37 278 2.0E-11
sp|A3D4P4|TTCA_SHEB5 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ttcA1 PE=3 SV=1 37 271 2.0E-11
sp|A1SWS4|TTCA_PSYIN tRNA 2-thiocytidine biosynthesis protein TtcA OS=Psychromonas ingrahamii (strain 37) GN=ttcA PE=3 SV=1 40 222 3.0E-11
sp|A6VP68|TTCA_ACTSZ tRNA 2-thiocytidine biosynthesis protein TtcA OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=ttcA PE=3 SV=1 38 260 3.0E-11
sp|A5UBX9|TTCA_HAEIE tRNA 2-thiocytidine biosynthesis protein TtcA OS=Haemophilus influenzae (strain PittEE) GN=ttcA PE=3 SV=2 38 260 3.0E-11
sp|Q0VQ34|TTCA_ALCBS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ttcA PE=3 SV=1 37 271 3.0E-11
sp|A1K2P7|TTCA_AZOSB tRNA 2-thiocytidine biosynthesis protein TtcA OS=Azoarcus sp. (strain BH72) GN=ttcA PE=3 SV=1 34 234 3.0E-11
sp|B2AGH6|TTCA_CUPTR tRNA 2-thiocytidine biosynthesis protein TtcA OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ttcA PE=3 SV=1 51 264 3.0E-11
sp|B9M1Y2|TTCA_GEODF tRNA 2-thiocytidine biosynthesis protein TtcA OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=ttcA PE=3 SV=1 25 227 3.0E-11
sp|B0VDQ2|TTCA_ACIBY tRNA 2-thiocytidine biosynthesis protein TtcA OS=Acinetobacter baumannii (strain AYE) GN=ttcA PE=3 SV=1 37 264 4.0E-11
sp|B2HXA8|TTCA_ACIBC tRNA 2-thiocytidine biosynthesis protein TtcA OS=Acinetobacter baumannii (strain ACICU) GN=ttcA PE=3 SV=1 37 264 4.0E-11
sp|B7I610|TTCA_ACIB5 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Acinetobacter baumannii (strain AB0057) GN=ttcA PE=3 SV=1 37 264 4.0E-11
sp|B7GY44|TTCA_ACIB3 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Acinetobacter baumannii (strain AB307-0294) GN=ttcA PE=3 SV=1 37 264 4.0E-11
sp|A0Q736|TTCA2_FRATN tRNA 2-thiocytidine biosynthesis protein TtcA 2 OS=Francisella tularensis subsp. novicida (strain U112) GN=ttcA2 PE=3 SV=1 38 266 4.0E-11
sp|A3M828|TTCA_ACIBT tRNA 2-thiocytidine biosynthesis protein TtcA OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=ttcA PE=3 SV=2 37 227 4.0E-11
sp|B0VT10|TTCA_ACIBS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Acinetobacter baumannii (strain SDF) GN=ttcA PE=3 SV=1 37 227 4.0E-11
sp|A1WHW6|TTCA_VEREI tRNA 2-thiocytidine biosynthesis protein TtcA OS=Verminephrobacter eiseniae (strain EF01-2) GN=ttcA PE=3 SV=1 46 262 4.0E-11
sp|Q0I3K3|TTCA_HAES1 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Haemophilus somnus (strain 129Pt) GN=ttcA PE=3 SV=1 38 266 4.0E-11
sp|Q5NFP3|TTCA2_FRATT tRNA 2-thiocytidine biosynthesis protein TtcA 2 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=ttcA2 PE=3 SV=1 38 266 4.0E-11
sp|Q14H45|TTCA2_FRAT1 tRNA 2-thiocytidine biosynthesis protein TtcA 2 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=ttcA2 PE=3 SV=1 38 266 4.0E-11
sp|Q3IHG8|TTCA_PSEHT tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ttcA PE=3 SV=1 40 223 4.0E-11
sp|B0UU61|TTCA_HISS2 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Histophilus somni (strain 2336) GN=ttcA PE=3 SV=1 38 266 4.0E-11
sp|A4IYL5|TTCA2_FRATW tRNA 2-thiocytidine biosynthesis protein TtcA 2 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=ttcA2 PE=3 SV=1 38 266 4.0E-11
sp|Q220I8|TTCA_RHOFT tRNA 2-thiocytidine biosynthesis protein TtcA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ttcA PE=3 SV=1 20 265 4.0E-11
sp|A7MLI7|TTCA_CROS8 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ttcA PE=3 SV=1 38 308 4.0E-11
sp|A6WNB3|TTCA_SHEB8 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella baltica (strain OS185) GN=ttcA PE=3 SV=2 37 271 5.0E-11
sp|A9L1D4|TTCA_SHEB9 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella baltica (strain OS195) GN=ttcA PE=3 SV=2 37 278 6.0E-11
sp|A8FVF7|TTCA_SHESH tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella sediminis (strain HAW-EB3) GN=ttcA PE=3 SV=1 37 278 6.0E-11
sp|Q0KF09|TTCA_CUPNH tRNA 2-thiocytidine biosynthesis protein TtcA OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ttcA PE=3 SV=1 51 264 6.0E-11
sp|A8AGE0|TTCA_CITK8 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ttcA PE=3 SV=1 38 260 6.0E-11
sp|B7URE9|TTCA_ECO27 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ttcA PE=3 SV=1 38 222 7.0E-11
sp|Q0AA41|TTCA_ALKEH tRNA 2-thiocytidine biosynthesis protein TtcA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ttcA PE=3 SV=2 51 264 7.0E-11
sp|Q4QK81|TTCA_HAEI8 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Haemophilus influenzae (strain 86-028NP) GN=ttcA PE=3 SV=1 38 260 7.0E-11
sp|B2VKN8|TTCA_ERWT9 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ttcA PE=3 SV=1 38 260 7.0E-11
sp|Q57184|TTCA_HAEIN tRNA 2-thiocytidine biosynthesis protein TtcA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ttcA PE=3 SV=1 38 260 1.0E-10
sp|Q6F8Q3|TTCA_ACIAD tRNA 2-thiocytidine biosynthesis protein TtcA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ttcA PE=3 SV=1 37 227 1.0E-10
sp|Q2NSV5|TTCA_SODGM tRNA 2-thiocytidine biosynthesis protein TtcA OS=Sodalis glossinidius (strain morsitans) GN=ttcA PE=3 SV=1 37 270 1.0E-10
sp|B3GXW8|TTCA_ACTP7 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ttcA PE=3 SV=1 38 260 1.0E-10
sp|Q11IV8|TTCA_CHESB tRNA 2-thiocytidine biosynthesis protein TtcA OS=Chelativorans sp. (strain BNC1) GN=ttcA PE=3 SV=1 33 262 1.0E-10
sp|Q5P3T7|TTCA_AROAE tRNA 2-thiocytidine biosynthesis protein TtcA OS=Aromatoleum aromaticum (strain EbN1) GN=ttcA PE=3 SV=1 34 222 1.0E-10
sp|Q0BMI3|TTCA1_FRATO tRNA 2-thiocytidine biosynthesis protein TtcA 1 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=ttcA1 PE=3 SV=1 38 266 1.0E-10
sp|Q2A447|TTCA1_FRATH tRNA 2-thiocytidine biosynthesis protein TtcA 1 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=ttcA1 PE=3 SV=1 38 266 1.0E-10
sp|A7NBC6|TTCA1_FRATF tRNA 2-thiocytidine biosynthesis protein TtcA 1 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=ttcA1 PE=3 SV=1 38 266 1.0E-10
sp|Q87PG9|TTCA_VIBPA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ttcA PE=3 SV=1 38 277 2.0E-10
sp|Q124R0|TTCA_POLSJ tRNA 2-thiocytidine biosynthesis protein TtcA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=ttcA PE=3 SV=1 37 222 2.0E-10
sp|A6T886|TTCA_KLEP7 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ttcA PE=3 SV=1 10 260 2.0E-10
sp|B8JEH9|TTCA_ANAD2 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=ttcA PE=3 SV=1 41 258 2.0E-10
sp|B5XRN3|TTCA_KLEP3 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Klebsiella pneumoniae (strain 342) GN=ttcA PE=3 SV=1 38 260 2.0E-10
sp|B4UF77|TTCA_ANASK tRNA 2-thiocytidine biosynthesis protein TtcA OS=Anaeromyxobacter sp. (strain K) GN=ttcA PE=3 SV=1 41 258 2.0E-10
sp|B3PID5|TTCA_CELJU tRNA 2-thiocytidine biosynthesis protein TtcA OS=Cellvibrio japonicus (strain Ueda107) GN=ttcA PE=3 SV=1 42 287 2.0E-10
sp|B2FU61|TTCA_STRMK tRNA 2-thiocytidine biosynthesis protein TtcA OS=Stenotrophomonas maltophilia (strain K279a) GN=ttcA PE=3 SV=2 14 266 2.0E-10
sp|Q3JAS2|TTCA_NITOC tRNA 2-thiocytidine biosynthesis protein TtcA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ttcA PE=3 SV=1 40 262 3.0E-10
sp|Q1LS06|TTCA_CUPMC tRNA 2-thiocytidine biosynthesis protein TtcA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ttcA PE=3 SV=1 51 222 3.0E-10
sp|Q4UNZ5|TTCA_XANC8 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ttcA PE=3 SV=1 38 270 3.0E-10
sp|B1XSG8|TTCA_POLNS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=ttcA PE=3 SV=1 13 321 3.0E-10
sp|A3N0Y3|TTCA_ACTP2 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ttcA PE=3 SV=1 38 260 3.0E-10
sp|B0BPR8|TTCA_ACTPJ tRNA 2-thiocytidine biosynthesis protein TtcA OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ttcA PE=3 SV=1 38 260 3.0E-10
sp|Q7VKY7|TTCA_HAEDU tRNA 2-thiocytidine biosynthesis protein TtcA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ttcA PE=3 SV=2 38 260 3.0E-10
sp|A1VJK9|TTCA_POLNA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Polaromonas naphthalenivorans (strain CJ2) GN=ttcA PE=3 SV=1 37 222 4.0E-10
sp|Q2IPE3|TTCA_ANADE tRNA 2-thiocytidine biosynthesis protein TtcA OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=ttcA PE=3 SV=1 41 258 5.0E-10
sp|A8GF18|TTCA_SERP5 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Serratia proteamaculans (strain 568) GN=ttcA PE=3 SV=1 38 260 5.0E-10
sp|Q8P3H2|TTCA_XANCP tRNA 2-thiocytidine biosynthesis protein TtcA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ttcA PE=3 SV=1 38 270 6.0E-10
sp|B0RYY8|TTCA_XANCB tRNA 2-thiocytidine biosynthesis protein TtcA OS=Xanthomonas campestris pv. campestris (strain B100) GN=ttcA PE=3 SV=2 38 270 6.0E-10
sp|B1KFY6|TTCA_SHEWM tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ttcA PE=3 SV=1 16 278 6.0E-10
sp|B0TUN8|TTCA_SHEHH tRNA 2-thiocytidine biosynthesis protein TtcA OS=Shewanella halifaxensis (strain HAW-EB4) GN=ttcA PE=3 SV=1 37 271 6.0E-10
sp|Q1IDN2|TTCA_PSEE4 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas entomophila (strain L48) GN=ttcA PE=3 SV=1 42 271 7.0E-10
sp|C1DPQ6|TTCA_AZOVD tRNA 2-thiocytidine biosynthesis protein TtcA OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ttcA PE=3 SV=1 40 257 8.0E-10
sp|B0CEK4|TTCA_ACAM1 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Acaryochloris marina (strain MBIC 11017) GN=ttcA PE=3 SV=1 46 270 8.0E-10
sp|B4SRP3|TTCA_STRM5 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Stenotrophomonas maltophilia (strain R551-3) GN=ttcA PE=3 SV=1 14 305 1.0E-09
sp|A8LMA2|TTCA_DINSH tRNA 2-thiocytidine biosynthesis protein TtcA OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ttcA PE=3 SV=1 53 262 2.0E-09
sp|Q9CN39|TTCA_PASMU tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pasteurella multocida (strain Pm70) GN=ttcA PE=3 SV=1 42 266 2.0E-09
sp|A6X1K4|TTCA_OCHA4 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ttcA PE=3 SV=1 40 262 2.0E-09
sp|Q3BMF4|TTCA_XANC5 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ttcA PE=3 SV=2 34 276 2.0E-09
sp|Q48FG8|TTCA_PSE14 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ttcA PE=3 SV=1 42 277 2.0E-09
sp|Q1QZ76|TTCA_CHRSD tRNA 2-thiocytidine biosynthesis protein TtcA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=ttcA PE=3 SV=1 37 271 2.0E-09
sp|B0KT32|TTCA_PSEPG tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas putida (strain GB-1) GN=ttcA PE=3 SV=1 42 271 3.0E-09
sp|B1J1K3|TTCA_PSEPW tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas putida (strain W619) GN=ttcA PE=3 SV=1 42 271 3.0E-09
sp|Q8PEW6|TTCA_XANAC tRNA 2-thiocytidine biosynthesis protein TtcA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ttcA PE=3 SV=1 34 319 3.0E-09
sp|Q885Z7|TTCA_PSESM tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ttcA PE=3 SV=1 42 277 4.0E-09
sp|Q6G5E1|TTCA_BARHE tRNA 2-thiocytidine biosynthesis protein TtcA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ttcA PE=3 SV=1 37 262 4.0E-09
sp|Q4ZQ35|TTCA_PSEU2 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ttcA PE=3 SV=1 42 262 4.0E-09
sp|B0U453|TTCA_XYLFM tRNA 2-thiocytidine biosynthesis protein TtcA OS=Xylella fastidiosa (strain M12) GN=ttcA PE=3 SV=1 11 266 4.0E-09
sp|Q9PFT8|TTCA_XYLFA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Xylella fastidiosa (strain 9a5c) GN=ttcA PE=3 SV=2 12 266 5.0E-09
sp|A5W7U0|TTCA_PSEP1 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ttcA PE=3 SV=1 42 271 5.0E-09
sp|A1U1K6|TTCA_MARHV tRNA 2-thiocytidine biosynthesis protein TtcA OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ttcA PE=3 SV=1 37 266 5.0E-09
sp|Q10441|TILS_SCHPO Probable tRNA(Ile)-lysidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.08c PE=3 SV=1 37 219 6.0E-09
sp|Q16A99|TTCA_ROSDO tRNA 2-thiocytidine biosynthesis protein TtcA OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ttcA PE=3 SV=2 53 184 7.0E-09
sp|Q0BYJ5|TTCA_HYPNA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Hyphomonas neptunium (strain ATCC 15444) GN=ttcA PE=3 SV=1 59 262 8.0E-09
sp|A1UT10|TTCA_BARBK tRNA 2-thiocytidine biosynthesis protein TtcA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ttcA PE=3 SV=1 38 262 9.0E-09
sp|B7IFR8|TILS_THEAB tRNA(Ile)-lysidine synthase OS=Thermosipho africanus (strain TCF52B) GN=tilS PE=3 SV=1 40 277 9.0E-09
sp|Q8YYB8|TILS_NOSS1 tRNA(Ile)-lysidine synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tilS PE=3 SV=1 37 184 1.0E-08
sp|Q1GJX4|TTCA_RUEST tRNA 2-thiocytidine biosynthesis protein TtcA OS=Ruegeria sp. (strain TM1040) GN=ttcA PE=3 SV=1 59 184 1.0E-08
sp|Q9I4E6|TTCA_PSEAE tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ttcA PE=3 SV=1 42 277 1.0E-08
sp|Q02J28|TTCA_PSEAB tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ttcA PE=3 SV=1 42 277 1.0E-08
sp|B7UWY4|TTCA_PSEA8 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas aeruginosa (strain LESB58) GN=ttcA PE=3 SV=1 42 277 1.0E-08
sp|A6V906|TTCA_PSEA7 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas aeruginosa (strain PA7) GN=ttcA PE=3 SV=1 42 277 1.0E-08
sp|Q88MD2|TTCA_PSEPK tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas putida (strain KT2440) GN=ttcA PE=3 SV=1 42 271 1.0E-08
sp|B0CLF8|TTCA_BRUSI tRNA 2-thiocytidine biosynthesis protein TtcA OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ttcA PE=3 SV=1 51 283 1.0E-08
sp|Q8G189|TTCA_BRUSU tRNA 2-thiocytidine biosynthesis protein TtcA OS=Brucella suis biovar 1 (strain 1330) GN=ttcA PE=3 SV=1 51 283 1.0E-08
sp|A5VQ10|TTCA_BRUO2 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ttcA PE=3 SV=1 51 283 1.0E-08
sp|C0RIG5|TTCA_BRUMB tRNA 2-thiocytidine biosynthesis protein TtcA OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ttcA PE=3 SV=1 51 283 1.0E-08
sp|A9MAK8|TTCA_BRUC2 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ttcA PE=3 SV=1 51 283 1.0E-08
sp|Q57DS4|TTCA_BRUAB tRNA 2-thiocytidine biosynthesis protein TtcA OS=Brucella abortus biovar 1 (strain 9-941) GN=ttcA PE=3 SV=1 51 283 1.0E-08
sp|Q2YNH1|TTCA_BRUA2 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Brucella abortus (strain 2308) GN=ttcA PE=3 SV=1 51 283 1.0E-08
sp|B2S568|TTCA_BRUA1 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Brucella abortus (strain S19) GN=ttcA PE=3 SV=1 51 283 1.0E-08
sp|C3JY43|TTCA_PSEFS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas fluorescens (strain SBW25) GN=ttcA PE=3 SV=1 42 277 1.0E-08
sp|Q8YGM6|TTCA_BRUME tRNA 2-thiocytidine biosynthesis protein TtcA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ttcA PE=3 SV=1 51 283 2.0E-08
sp|B2SIG7|TTCA_XANOP tRNA 2-thiocytidine biosynthesis protein TtcA OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ttcA PE=3 SV=1 34 278 2.0E-08
sp|A5EXQ4|TTCA_DICNV tRNA 2-thiocytidine biosynthesis protein TtcA OS=Dichelobacter nodosus (strain VCS1703A) GN=ttcA PE=3 SV=1 51 260 2.0E-08
sp|Q5GUF3|TTCA_XANOR tRNA 2-thiocytidine biosynthesis protein TtcA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ttcA PE=3 SV=1 34 278 2.0E-08
sp|Q2NXR3|TTCA_XANOM tRNA 2-thiocytidine biosynthesis protein TtcA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ttcA PE=3 SV=1 34 278 2.0E-08
sp|A2SD77|TTCA_METPP tRNA 2-thiocytidine biosynthesis protein TtcA OS=Methylibium petroleiphilum (strain PM1) GN=ttcA PE=3 SV=1 46 266 2.0E-08
sp|A9IUA2|TTCA_BART1 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ttcA PE=3 SV=1 46 262 2.0E-08
sp|Q3K8D5|TTCA_PSEPF tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas fluorescens (strain Pf0-1) GN=ttcA PE=3 SV=1 42 270 2.0E-08
sp|Q21IJ4|TTCA_SACD2 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ttcA PE=3 SV=1 38 266 2.0E-08
sp|B1Y629|TTCA_LEPCP tRNA 2-thiocytidine biosynthesis protein TtcA OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ttcA PE=3 SV=1 37 227 3.0E-08
sp|Q87B85|TTCA_XYLFT tRNA 2-thiocytidine biosynthesis protein TtcA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ttcA PE=3 SV=2 37 266 3.0E-08
sp|B2I7H1|TTCA_XYLF2 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Xylella fastidiosa (strain M23) GN=ttcA PE=3 SV=1 37 266 3.0E-08
sp|A6VXH3|TTCA_MARMS tRNA 2-thiocytidine biosynthesis protein TtcA OS=Marinomonas sp. (strain MWYL1) GN=ttcA PE=3 SV=1 40 289 6.0E-08
sp|Q74C65|TILS_GEOSL tRNA(Ile)-lysidine synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tilS PE=3 SV=1 46 271 6.0E-08
sp|Q15U56|TTCA_PSEA6 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=ttcA PE=3 SV=1 42 262 6.0E-08
sp|Q8DIH2|TILS_THEEB tRNA(Ile)-lysidine synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=tilS PE=3 SV=1 38 187 7.0E-08
sp|A4VJ19|TTCA_PSEU5 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas stutzeri (strain A1501) GN=ttcA PE=3 SV=1 40 257 7.0E-08
sp|Q5LW09|TTCA_RUEPO tRNA 2-thiocytidine biosynthesis protein TtcA OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ttcA PE=3 SV=1 59 257 8.0E-08
sp|Q4K882|TTCA_PSEF5 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ttcA PE=3 SV=2 42 270 1.0E-07
sp|A6U9M6|TTCA_SINMW tRNA 2-thiocytidine biosynthesis protein TtcA OS=Sinorhizobium medicae (strain WSM419) GN=ttcA PE=3 SV=1 37 257 1.0E-07
sp|Q2SK22|TTCA_HAHCH tRNA 2-thiocytidine biosynthesis protein TtcA OS=Hahella chejuensis (strain KCTC 2396) GN=ttcA PE=3 SV=1 37 270 1.0E-07
sp|A4XWK1|TTCA_PSEMY tRNA 2-thiocytidine biosynthesis protein TtcA OS=Pseudomonas mendocina (strain ymp) GN=ttcA PE=3 SV=1 42 270 1.0E-07
sp|C5BRQ7|TTCA_TERTT tRNA 2-thiocytidine biosynthesis protein TtcA OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ttcA PE=3 SV=1 38 303 1.0E-07
sp|A4WWJ3|TTCA_RHOS5 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ttcA PE=3 SV=1 53 262 1.0E-07
sp|Q7MTC4|TILS_PORGI tRNA(Ile)-lysidine synthase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=tilS PE=3 SV=1 36 270 2.0E-07
sp|Q6LR31|TTCA_PHOPR tRNA 2-thiocytidine biosynthesis protein TtcA OS=Photobacterium profundum GN=ttcA PE=3 SV=1 38 277 2.0E-07
sp|Q5QZ01|TTCA_IDILO tRNA 2-thiocytidine biosynthesis protein TtcA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ttcA PE=3 SV=1 51 262 2.0E-07
sp|A9G6U6|TTCA_SORC5 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Sorangium cellulosum (strain So ce56) GN=ttcA PE=3 SV=1 41 272 2.0E-07
sp|A2Q879|CTU1_ASPNC Cytoplasmic tRNA 2-thiolation protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ncs6 PE=3 SV=1 355 390 4.0E-07
sp|Q8R7K9|TILS_CALS4 tRNA(Ile)-lysidine synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tilS PE=3 SV=1 36 261 5.0E-07
sp|Q81J84|TILS_BACCR tRNA(Ile)-lysidine synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=tilS PE=3 SV=1 27 188 5.0E-07
sp|Q4FTN3|TTCA_PSYA2 tRNA 2-thiocytidine biosynthesis protein TtcA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=ttcA PE=3 SV=1 37 271 6.0E-07
sp|Q0BLX1|TTCA2_FRATO tRNA 2-thiocytidine biosynthesis protein TtcA 2 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=ttcA2 PE=3 SV=1 40 227 1.0E-06
sp|Q2A3F9|TTCA2_FRATH tRNA 2-thiocytidine biosynthesis protein TtcA 2 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=ttcA2 PE=3 SV=1 40 227 1.0E-06
sp|A7NC76|TTCA2_FRATF tRNA 2-thiocytidine biosynthesis protein TtcA 2 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=ttcA2 PE=3 SV=1 40 227 1.0E-06
sp|Q92PH1|TTCA_RHIME tRNA 2-thiocytidine biosynthesis protein TtcA OS=Rhizobium meliloti (strain 1021) GN=ttcA PE=3 SV=2 37 257 1.0E-06
sp|Q1QCP2|TTCA_PSYCK tRNA 2-thiocytidine biosynthesis protein TtcA OS=Psychrobacter cryohalolentis (strain K5) GN=ttcA PE=3 SV=1 37 271 1.0E-06
sp|B2RMB4|TILS_PORG3 tRNA(Ile)-lysidine synthase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=tilS PE=3 SV=1 36 270 2.0E-06
sp|B0U092|TTCA2_FRAP2 tRNA 2-thiocytidine biosynthesis protein TtcA 2 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=ttcA2 PE=3 SV=1 40 227 2.0E-06
sp|C3MD80|TTCA_RHISN tRNA 2-thiocytidine biosynthesis protein TtcA OS=Rhizobium sp. (strain NGR234) GN=ttcA PE=3 SV=1 52 257 2.0E-06
sp|Q98NP4|TTCA_RHILO tRNA 2-thiocytidine biosynthesis protein TtcA OS=Rhizobium loti (strain MAFF303099) GN=ttcA PE=3 SV=2 51 283 2.0E-06
sp|Q67JG9|TILS_SYMTH tRNA(Ile)-lysidine synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tilS PE=3 SV=1 36 184 3.0E-06
sp|A5WCA0|TILS_PSYWF tRNA(Ile)-lysidine synthase OS=Psychrobacter sp. (strain PRwf-1) GN=tilS PE=3 SV=1 29 184 4.0E-06
sp|B2SGI4|TTCA_FRATM tRNA 2-thiocytidine biosynthesis protein TtcA OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=ttcA PE=3 SV=1 40 227 5.0E-06
sp|A4IXY7|TTCA1_FRATW tRNA 2-thiocytidine biosynthesis protein TtcA 1 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=ttcA1 PE=3 SV=1 40 227 5.0E-06
sp|Q5NG17|TTCA1_FRATT tRNA 2-thiocytidine biosynthesis protein TtcA 1 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=ttcA1 PE=3 SV=1 40 227 5.0E-06
sp|Q14HG9|TTCA1_FRAT1 tRNA 2-thiocytidine biosynthesis protein TtcA 1 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=ttcA1 PE=3 SV=1 40 227 5.0E-06
sp|Q73FE5|TILS_BACC1 tRNA(Ile)-lysidine synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=tilS PE=3 SV=1 27 188 5.0E-06
sp|Q6MLE7|TTCA_BDEBA tRNA 2-thiocytidine biosynthesis protein TtcA OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ttcA PE=3 SV=1 37 182 6.0E-06
sp|Q899H5|TILS_CLOTE tRNA(Ile)-lysidine synthase OS=Clostridium tetani (strain Massachusetts / E88) GN=tilS PE=3 SV=1 36 184 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8305
MPPTPCVLCQNNRAVVKRPKNHQKVCRDCFIAAFEDEIHHTIVSSNLFYSGERVAIGASGGKDSTVLASVLKTLN
DRHGYGLDLVLLSVDEGIKGYRDDSLETVKRNATQYEMPLQIVGYDQLYGWTMDQVVETVGKKGNCTYCGVFRRQ
ALDRGAKLLNIRHVVTGHNADDIAETVLMNLLRGDLPRLSRATNIVTGNSSSEVKRSKPLKYAYEKEIVLYAYHK
KLDYFSTECIYSPEAFRGTARSLIKSLEKVRPSAILDIVRSGEDMARLTPDKGQNGCDCSADDMGGCGSAKAGTS
DSGLARVEEANVDASLEAGSLETEITSNGTSTTDGSVKLPIRTRRPKDAAPAPLQTLGSCVKCGYMSSQDMCQAC
TLLEALNKNRADVVI*
Coding >Hirsu2|8305
ATGCCGCCCACACCCTGTGTTCTTTGCCAGAACAACAGAGCCGTTGTCAAAAGACCAAAGAACCACCAAAAGGTC
TGCAGAGATTGTTTCATCGCCGCGTTTGAGGATGAAATCCACCACACCATCGTTTCCTCCAACCTCTTCTACTCC
GGCGAGAGGGTGGCAATAGGAGCGTCGGGCGGCAAAGACTCCACGGTCCTGGCCTCAGTCCTGAAAACTCTTAAT
GATCGCCATGGCTACGGGCTTGACCTGGTGCTTCTCAGTGTCGACGAAGGCATCAAAGGATACCGAGATGATTCT
CTCGAAACGGTGAAGCGGAACGCGACGCAGTATGAGATGCCCTTACAGATCGTTGGCTACGATCAACTCTATGGC
TGGACCATGGATCAAGTCGTGGAAACAGTCGGGAAGAAGGGCAACTGCACGTACTGCGGCGTCTTTCGACGCCAA
GCTCTCGATCGGGGAGCCAAGCTGCTGAACATCAGGCATGTGGTCACGGGTCACAACGCAGACGACATTGCCGAG
ACCGTCCTCATGAACCTCCTACGTGGCGATTTGCCTCGGCTATCCCGGGCCACCAACATCGTCACCGGCAACTCG
TCGAGTGAGGTCAAGAGAAGCAAGCCACTCAAATATGCCTACGAGAAGGAGATTGTTCTCTATGCATACCACAAG
AAGCTGGACTACTTCAGTACCGAATGCATATACAGCCCCGAGGCCTTTCGAGGGACTGCGAGAAGCCTTATCAAG
AGCCTGGAGAAGGTCCGACCTAGCGCTATTCTGGACATCGTCAGAAGCGGGGAGGACATGGCGCGGCTCACACCA
GACAAGGGCCAAAATGGCTGCGATTGCAGCGCCGACGACATGGGGGGCTGCGGCTCGGCAAAGGCCGGCACGTCC
GACAGCGGACTGGCACGAGTAGAGGAGGCAAATGTCGACGCTTCACTTGAGGCTGGGAGCCTTGAGACTGAGATC
ACGTCCAACGGAACATCCACGACGGACGGGTCGGTGAAGCTCCCCATCAGGACTCGTCGACCAAAAGACGCCGCA
CCCGCTCCGTTGCAAACCCTCGGTAGTTGCGTCAAATGCGGCTACATGTCAAGTCAGGACATGTGCCAGGCGTGC
ACGCTCTTGGAGGCTTTGAACAAGAACAGGGCCGACGTTGTCATATGA
Transcript >Hirsu2|8305
ATGCCGCCCACACCCTGTGTTCTTTGCCAGAACAACAGAGCCGTTGTCAAAAGACCAAAGAACCACCAAAAGGTC
TGCAGAGATTGTTTCATCGCCGCGTTTGAGGATGAAATCCACCACACCATCGTTTCCTCCAACCTCTTCTACTCC
GGCGAGAGGGTGGCAATAGGAGCGTCGGGCGGCAAAGACTCCACGGTCCTGGCCTCAGTCCTGAAAACTCTTAAT
GATCGCCATGGCTACGGGCTTGACCTGGTGCTTCTCAGTGTCGACGAAGGCATCAAAGGATACCGAGATGATTCT
CTCGAAACGGTGAAGCGGAACGCGACGCAGTATGAGATGCCCTTACAGATCGTTGGCTACGATCAACTCTATGGC
TGGACCATGGATCAAGTCGTGGAAACAGTCGGGAAGAAGGGCAACTGCACGTACTGCGGCGTCTTTCGACGCCAA
GCTCTCGATCGGGGAGCCAAGCTGCTGAACATCAGGCATGTGGTCACGGGTCACAACGCAGACGACATTGCCGAG
ACCGTCCTCATGAACCTCCTACGTGGCGATTTGCCTCGGCTATCCCGGGCCACCAACATCGTCACCGGCAACTCG
TCGAGTGAGGTCAAGAGAAGCAAGCCACTCAAATATGCCTACGAGAAGGAGATTGTTCTCTATGCATACCACAAG
AAGCTGGACTACTTCAGTACCGAATGCATATACAGCCCCGAGGCCTTTCGAGGGACTGCGAGAAGCCTTATCAAG
AGCCTGGAGAAGGTCCGACCTAGCGCTATTCTGGACATCGTCAGAAGCGGGGAGGACATGGCGCGGCTCACACCA
GACAAGGGCCAAAATGGCTGCGATTGCAGCGCCGACGACATGGGGGGCTGCGGCTCGGCAAAGGCCGGCACGTCC
GACAGCGGACTGGCACGAGTAGAGGAGGCAAATGTCGACGCTTCACTTGAGGCTGGGAGCCTTGAGACTGAGATC
ACGTCCAACGGAACATCCACGACGGACGGGTCGGTGAAGCTCCCCATCAGGACTCGTCGACCAAAAGACGCCGCA
CCCGCTCCGTTGCAAACCCTCGGTAGTTGCGTCAAATGCGGCTACATGTCAAGTCAGGACATGTGCCAGGCGTGC
ACGCTCTTGGAGGCTTTGAACAAGAACAGGGCCGACGTTGTCATATGA
Gene >Hirsu2|8305
ATGCCGCCCACACCCTGTGTTCTTTGCCAGAACAACAGAGCCGTTGTCAAAAGACCAAAGAACCACCAAAAGGTC
TGCAGAGATTGTTTCATCGCCGCGTTTGAGGATGAAATCCACCACACCATCGTTTCCTCCAACCTCTTCTACTCC
GGCGAGAGGGTGGCAATAGGAGCGTCGGGCGGCAAAGACTCCACGGTCCTGGCCTCAGTCCTGAAAACTCTTAAT
GATCGCCATGGCTACGGGCTTGACCTGGTGCTTCTCAGTGTCGACGAAGGCATCAAAGGATACCGAGATGATTCT
CTCGAAACGGTGAAGCGGAACGCGACGCAGTATGAGATGCCCTTACAGATCGTTGGCTACGATCAACTCTATGGC
TGGACCATGGATCAAGTCGTGGAAACAGTCGGGAAGAAGGGCAACTGCACGTACTGCGGCGTCTTTCGACGCCAA
GCTCTCGATCGGGGAGCCAAGCTGCTGAACATCAGGCATGTGGTCACGGGTCACAACGCAGACGACATTGCCGAG
ACCGTCCTCATGAACCTCCTACGTGGCGATTTGCCTCGGCTATCCCGGGCCACCAACATCGTCACCGGCAACTCG
TCGAGTGAGGTCAAGAGAAGCAAGCCACTCAAATATGCCTACGAGAAGGAGATTGTTCTCTATGCATACCACAAG
AAGCTGGACTACTTCAGTACCGAATGCATATACAGCCCCGAGGCCTTTCGAGGGACTGCGAGAAGCCTTATCAAG
AGCCTGGAGAAGGTCCGACCTAGCGCTATTCTGGACATCGTCAGAAGCGGGGAGGACATGGCGCGGCTCACACCA
GACAAGGGCCAAAATGGCTGCGATTGCAGCGCCGACGACATGGGGGGCTGCGGCTCGGCAAAGGCCGGCACGTCC
GACAGCGGACTGGCACGAGTAGAGGAGGCAAATGTCGACGCTTCACTTGAGGCTGGGAGCCTTGAGACTGAGATC
ACGTCCAACGGAACATCCACGACGGACGGGTCGGTGAAGCTCCCCATCAGGACTCGTCGACCAAAAGACGCCGCA
CCCGCTCCGTTGCAAACCCTCGGTAGTTGCGTCAAATGCGGCTACATGTCAAGTCAGGACATGTGCCAGGCGTGC
ACGCTCTTGGAGGCTTTGAACAAGAACAGGGCCGACGTTGTCATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail