Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8302
Gene name
LocationContig_533:1466..3040
Strand-
Gene length (bp)1574
Transcript length (bp)1293
Coding sequence length (bp)1293
Protein length (aa) 431

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01853 MOZ_SAS MOZ/SAS family 7.4E-79 164 343
PF17772 zf-MYST MYST family zinc finger domain 1.3E-20 107 159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10325|MST2_SCHPO Histone acetyltransferase mst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mst2 PE=1 SV=1 18 408 2.0E-113
sp|O95251|KAT7_HUMAN Histone acetyltransferase KAT7 OS=Homo sapiens GN=KAT7 PE=1 SV=1 83 384 4.0E-97
sp|Q5SVQ0|KAT7_MOUSE Histone acetyltransferase KAT7 OS=Mus musculus GN=Kat7 PE=1 SV=1 83 384 5.0E-97
sp|Q810T5|KAT7_RAT Histone acetyltransferase KAT7 OS=Rattus norvegicus GN=Kat7 PE=1 SV=1 83 384 5.0E-97
sp|P34218|SAS3_YEAST Histone acetyltransferase SAS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAS3 PE=1 SV=1 44 422 2.0E-91
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10325|MST2_SCHPO Histone acetyltransferase mst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mst2 PE=1 SV=1 18 408 2.0E-113
sp|O95251|KAT7_HUMAN Histone acetyltransferase KAT7 OS=Homo sapiens GN=KAT7 PE=1 SV=1 83 384 4.0E-97
sp|Q5SVQ0|KAT7_MOUSE Histone acetyltransferase KAT7 OS=Mus musculus GN=Kat7 PE=1 SV=1 83 384 5.0E-97
sp|Q810T5|KAT7_RAT Histone acetyltransferase KAT7 OS=Rattus norvegicus GN=Kat7 PE=1 SV=1 83 384 5.0E-97
sp|P34218|SAS3_YEAST Histone acetyltransferase SAS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAS3 PE=1 SV=1 44 422 2.0E-91
sp|Q9TYU5|TIP60_CAEEL Histone acetyltransferase Tip60 homolog OS=Caenorhabditis elegans GN=mys-1 PE=2 SV=1 41 392 2.0E-90
sp|Q960X4|TIP60_DROME Histone acetyltransferase Tip60 OS=Drosophila melanogaster GN=Tip60 PE=1 SV=1 107 384 7.0E-85
sp|Q8LI34|MYST1_ORYSJ Putative MYST-like histone acetyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os07g0626600 PE=3 SV=1 105 385 3.0E-84
sp|Q9LXD7|MYST2_ARATH Histone acetyltransferase of the MYST family 2 OS=Arabidopsis thaliana GN=HAM2 PE=1 SV=1 105 385 2.0E-83
sp|Q9FLF7|MYST1_ARATH Histone acetyltransferase of the MYST family 1 OS=Arabidopsis thaliana GN=HAM1 PE=1 SV=1 107 385 2.0E-83
sp|Q8BRB7|KAT6B_MOUSE Histone acetyltransferase KAT6B OS=Mus musculus GN=Kat6b PE=1 SV=3 111 393 2.0E-83
sp|Q5RBG4|KAT5_PONAB Histone acetyltransferase KAT5 OS=Pongo abelii GN=KAT5 PE=2 SV=1 107 342 3.0E-83
sp|Q92993|KAT5_HUMAN Histone acetyltransferase KAT5 OS=Homo sapiens GN=KAT5 PE=1 SV=2 107 342 5.0E-83
sp|Q99MK2|KAT5_RAT Histone acetyltransferase KAT5 OS=Rattus norvegicus GN=Kat5 PE=1 SV=2 107 342 5.0E-83
sp|Q8CHK4|KAT5_MOUSE Histone acetyltransferase KAT5 OS=Mus musculus GN=Kat5 PE=1 SV=2 107 342 5.0E-83
sp|Q8WYB5|KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens GN=KAT6B PE=1 SV=3 111 393 1.0E-82
sp|Q8WML3|KAT6B_MACFA Histone acetyltransferase KAT6B OS=Macaca fascicularis GN=KAT6B PE=2 SV=1 111 393 1.0E-82
sp|Q92794|KAT6A_HUMAN Histone acetyltransferase KAT6A OS=Homo sapiens GN=KAT6A PE=1 SV=2 107 390 2.0E-82
sp|Q8BZ21|KAT6A_MOUSE Histone acetyltransferase KAT6A OS=Mus musculus GN=Kat6a PE=1 SV=2 107 390 2.0E-82
sp|Q5TKR9|KAT6A_RAT Histone acetyltransferase KAT6A OS=Rattus norvegicus GN=Kat6a PE=1 SV=2 107 390 2.0E-82
sp|C8VBH4|ESA1_EMENI Histone acetyltransferase esa1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=esa1 PE=3 SV=1 69 391 5.0E-80
sp|Q5XI06|KAT8_RAT Histone acetyltransferase KAT8 OS=Rattus norvegicus GN=Kat8 PE=1 SV=1 47 342 9.0E-80
sp|Q9H7Z6|KAT8_HUMAN Histone acetyltransferase KAT8 OS=Homo sapiens GN=KAT8 PE=1 SV=2 47 342 1.0E-79
sp|Q9D1P2|KAT8_MOUSE Histone acetyltransferase KAT8 OS=Mus musculus GN=Kat8 PE=1 SV=1 47 342 1.0E-79
sp|Q4P3S3|ESA1_USTMA Histone acetyltransferase ESA1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ESA1 PE=3 SV=1 111 395 7.0E-79
sp|P0CP02|ESA1_CRYNJ Histone acetyltransferase ESA1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ESA1 PE=3 SV=1 111 391 2.0E-78
sp|P0CP03|ESA1_CRYNB Histone acetyltransferase ESA1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ESA1 PE=3 SV=1 111 391 2.0E-78
sp|Q4IEV4|ESA1_GIBZE Histone acetyltransferase ESA1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ESA1 PE=3 SV=1 108 343 5.0E-78
sp|O02193|MOF_DROME Males-absent on the first protein OS=Drosophila melanogaster GN=mof PE=1 SV=1 66 342 1.0E-77
sp|O94446|ESA1_SCHPO Histone acetyltransferase mst1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mst1 PE=1 SV=1 107 342 4.0E-77
sp|Q7S9B6|ESA1_NEUCR Histone acetyltransferase esa-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=esa-1 PE=3 SV=1 108 391 5.0E-77
sp|Q6FPH9|ESA1_CANGA Histone acetyltransferase ESA1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ESA1 PE=3 SV=1 95 391 5.0E-76
sp|Q4WHG1|ESA1_ASPFU Histone acetyltransferase esa1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=esa1 PE=3 SV=1 38 342 1.0E-75
sp|Q6CKE9|ESA1_KLULA Histone acetyltransferase ESA1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ESA1 PE=3 SV=1 113 391 4.0E-75
sp|Q08649|ESA1_YEAST Histone acetyltransferase ESA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESA1 PE=1 SV=1 111 390 5.0E-75
sp|Q6C710|ESA1_YARLI Histone acetyltransferase ESA1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ESA1 PE=3 SV=1 107 387 1.0E-74
sp|Q75BY2|ESA1_ASHGO Histone acetyltransferase ESA1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ESA1 PE=3 SV=2 111 391 2.0E-74
sp|Q2UMQ5|ESA1_ASPOR Histone acetyltransferase ESA1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=esa1 PE=3 SV=1 87 391 4.0E-74
sp|Q5A7Q2|ESA1_CANAL Histone acetyltransferase ESA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ESA1 PE=3 SV=1 50 304 5.0E-70
sp|Q6BU95|ESA1_DEBHA Histone acetyltransferase ESA1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ESA1 PE=3 SV=2 95 342 3.0E-67
sp|P40963|SAS2_YEAST Histone acetyltransferase SAS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAS2 PE=1 SV=1 135 350 2.0E-37
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0004402 histone acetyltransferase activity Yes
GO:0016573 histone acetylation Yes
GO:0050794 regulation of cellular process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:0018205 peptidyl-lysine modification No
GO:0008080 N-acetyltransferase activity No
GO:0051252 regulation of RNA metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0018193 peptidyl-amino acid modification No
GO:0031323 regulation of cellular metabolic process No
GO:0019222 regulation of metabolic process No
GO:0016746 acyltransferase activity No
GO:2001141 regulation of RNA biosynthetic process No
GO:0016570 histone modification No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0019538 protein metabolic process No
GO:0010468 regulation of gene expression No
GO:0008150 biological_process No
GO:0043543 protein acylation No
GO:0009889 regulation of biosynthetic process No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0061733 peptide-lysine-N-acetyltransferase activity No
GO:0016740 transferase activity No
GO:0050789 regulation of biological process No
GO:0018393 internal peptidyl-lysine acetylation No
GO:0043170 macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0036211 protein modification process No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0034212 peptide N-acetyltransferase activity No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0065007 biological regulation No
GO:0006475 internal protein amino acid acetylation No
GO:0006807 nitrogen compound metabolic process No
GO:0018394 peptidyl-lysine acetylation No
GO:0031326 regulation of cellular biosynthetic process No
GO:0006473 protein acetylation No
GO:0016410 N-acyltransferase activity No
GO:0016407 acetyltransferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4462 0.7159 0.173 0.0497 0.2081 0.1027 0.0994 0.1443 0.0751 0.3117

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4105
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6447
Ophiocordyceps australis map64 (Brazil) OphauB2|7037
Ophiocordyceps camponoti-floridani Ophcf2|01150
Ophiocordyceps camponoti-rufipedis Ophun1|79
Ophiocordyceps kimflemingae Ophio5|6959
Ophiocordyceps subramaniannii Hirsu2|8302 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8302
MLRLKSSRPRLVTVEKRSRTSLVLKFEPFYSFFDKETDDAKGKPYGGILNEAEADTSKTLPTPDDRKRFDQAKQK
AEDEWRARVLAMQAEAEVPIRKPKKASENASQIECIEFGGWEIDTWYAAPYPAEYSRNRVLYICEFCLKYMNSDY
VAWRHKLKCAAKHPPGDEIYRHESVSIFEVDGRKHPVYCQNLCLLAKLFLGSKTLYYDVEPFLFYILCEYDERGY
HFVGYFSKEKRASSQNNVSCILTLPIHQRKGYGNLLIDFSYLLTKTEQKTGSPEKPLSDMGLVSYRNYWRLELCR
YFLELMDGDGHKKDGLSVKQISEDTGMTADDVVSALEGLRALVRDPQTQLYAFRVDLDYCRQYVTKWESKGYVRL
KPEALAWTPYVMGRSNAVNFELGPPISTIAPREDDETKVHEDPASVVDREGCTRR*
Coding >Hirsu2|8302
ATGCTGCGTCTCAAGTCCTCGCGGCCACGGCTGGTCACCGTCGAGAAACGATCACGCACATCGCTCGTACTCAAG
TTTGAGCCCTTCTACTCCTTCTTCGACAAGGAGACGGACGACGCCAAGGGGAAGCCGTATGGTGGCATACTGAAC
GAGGCGGAGGCGGACACATCAAAAACTCTACCCACGCCCGACGATCGCAAGCGATTCGATCAAGCGAAGCAAAAG
GCCGAGGATGAATGGCGAGCGCGCGTCCTGGCCATGCAGGCAGAGGCAGAGGTGCCGATACGGAAGCCGAAAAAG
GCGAGCGAAAACGCCAGCCAGATCGAGTGCATCGAATTTGGCGGGTGGGAGATTGATACCTGGTACGCGGCTCCA
TACCCAGCCGAATACAGCAGAAATCGCGTCCTCTACATCTGCGAGTTCTGCCTCAAGTACATGAACTCGGACTAC
GTTGCGTGGCGGCACAAGCTGAAATGCGCCGCCAAACACCCCCCTGGCGACGAAATCTATCGACATGAATCGGTC
TCGATCTTCGAAGTCGACGGGCGGAAGCATCCCGTCTATTGCCAGAACCTGTGTCTCCTGGCAAAGCTGTTTCTC
GGCTCGAAGACGCTCTACTACGACGTGGAGCCTTTCCTGTTCTACATTCTCTGCGAGTATGACGAGCGCGGATAC
CACTTTGTCGGCTACTTCTCCAAGGAGAAACGCGCGAGCAGCCAGAACAACGTGTCGTGCATCCTGACGCTGCCG
ATACACCAGCGCAAGGGTTACGGAAACCTGCTCATCGATTTTTCTTACCTTCTCACCAAGACGGAGCAGAAGACG
GGCTCGCCCGAGAAACCACTGTCAGACATGGGCCTCGTCTCGTATCGCAACTACTGGCGCCTGGAGCTATGCCGG
TACTTTCTGGAGCTCATGGACGGAGATGGGCACAAGAAGGATGGGCTCAGCGTCAAGCAGATCTCCGAAGACACG
GGCATGACGGCCGACGACGTCGTCTCTGCCCTGGAAGGGCTCCGGGCCTTGGTGAGGGACCCGCAGACACAGTTG
TACGCGTTCCGCGTCGACCTGGACTACTGCCGACAGTACGTGACGAAGTGGGAATCCAAAGGCTATGTCAGGCTG
AAGCCAGAGGCCCTGGCCTGGACGCCCTATGTCATGGGCCGCAGCAACGCCGTGAACTTCGAGCTTGGCCCGCCC
ATCAGCACCATCGCGCCACGCGAGGATGACGAGACCAAAGTGCACGAAGACCCCGCCAGCGTGGTCGATCGAGAA
GGTTGCACCCGAAGATAA
Transcript >Hirsu2|8302
ATGCTGCGTCTCAAGTCCTCGCGGCCACGGCTGGTCACCGTCGAGAAACGATCACGCACATCGCTCGTACTCAAG
TTTGAGCCCTTCTACTCCTTCTTCGACAAGGAGACGGACGACGCCAAGGGGAAGCCGTATGGTGGCATACTGAAC
GAGGCGGAGGCGGACACATCAAAAACTCTACCCACGCCCGACGATCGCAAGCGATTCGATCAAGCGAAGCAAAAG
GCCGAGGATGAATGGCGAGCGCGCGTCCTGGCCATGCAGGCAGAGGCAGAGGTGCCGATACGGAAGCCGAAAAAG
GCGAGCGAAAACGCCAGCCAGATCGAGTGCATCGAATTTGGCGGGTGGGAGATTGATACCTGGTACGCGGCTCCA
TACCCAGCCGAATACAGCAGAAATCGCGTCCTCTACATCTGCGAGTTCTGCCTCAAGTACATGAACTCGGACTAC
GTTGCGTGGCGGCACAAGCTGAAATGCGCCGCCAAACACCCCCCTGGCGACGAAATCTATCGACATGAATCGGTC
TCGATCTTCGAAGTCGACGGGCGGAAGCATCCCGTCTATTGCCAGAACCTGTGTCTCCTGGCAAAGCTGTTTCTC
GGCTCGAAGACGCTCTACTACGACGTGGAGCCTTTCCTGTTCTACATTCTCTGCGAGTATGACGAGCGCGGATAC
CACTTTGTCGGCTACTTCTCCAAGGAGAAACGCGCGAGCAGCCAGAACAACGTGTCGTGCATCCTGACGCTGCCG
ATACACCAGCGCAAGGGTTACGGAAACCTGCTCATCGATTTTTCTTACCTTCTCACCAAGACGGAGCAGAAGACG
GGCTCGCCCGAGAAACCACTGTCAGACATGGGCCTCGTCTCGTATCGCAACTACTGGCGCCTGGAGCTATGCCGG
TACTTTCTGGAGCTCATGGACGGAGATGGGCACAAGAAGGATGGGCTCAGCGTCAAGCAGATCTCCGAAGACACG
GGCATGACGGCCGACGACGTCGTCTCTGCCCTGGAAGGGCTCCGGGCCTTGGTGAGGGACCCGCAGACACAGTTG
TACGCGTTCCGCGTCGACCTGGACTACTGCCGACAGTACGTGACGAAGTGGGAATCCAAAGGCTATGTCAGGCTG
AAGCCAGAGGCCCTGGCCTGGACGCCCTATGTCATGGGCCGCAGCAACGCCGTGAACTTCGAGCTTGGCCCGCCC
ATCAGCACCATCGCGCCACGCGAGGATGACGAGACCAAAGTGCACGAAGACCCCGCCAGCGTGGTCGATCGAGAA
GGTTGCACCCGAAGATAA
Gene >Hirsu2|8302
ATGCTGCGTCTCAAGTCCTCGCGGCCACGGCTGGTCACCGTCGAGAAACGATCACGCACATCGCTCGTACTCAAG
TTTGAGGTTCGCCCTGGAAATCTCAAGGAGATTCTGTCTCGAAGAAGACGGGATAGGAGGCGCCCGAGCGCTGGC
CCGAGGCCTGCTCCGCCGGCACGATCGGCGGCCGCGCGCCCGGCGGCCGCTCCGGCCGTGAACATTTCCCTTCCC
ACGCCATTTACTTCCGATCTCTACTCCCAGCCCTTCTACTCCTTCTTCGACAAGGAGACGGACGACGCCAAGGGG
AAGCCGTATGGTGGCATACTGAACGAGGCGGAGGCGGACACATCAAAAACTCTACCCACGCCCGACGATCGCAAG
CGATTCGATCAAGCGAAGCAAAAGGCCGAGGATGAATGGCGAGCGCGCGTCCTGGCCATGCAGGCAGAGGCAGAG
GTGCCGATACGGAAGCCGAAAAAGGCGAGCGAAAACGCCAGCCAGATCGAGTGCATCGAATTTGGCGGGTGGGAG
ATTGATACCTGGTACGCGGCTCCATACCCAGCCGAATACAGCAGAAATCGCGTCCTCTACATCTGCGAGTTCTGC
CTCAAGTACATGAACTCGGACTACGTTGCGTGGCGGCACAAGCTGAAATGCGCCGCCAAACACCCCCCTGGCGAC
GAAATCTATCGACATGAATCGGTCTCGATCTTCGAAGTCGACGGGCGGAAGCATCCCGTCTATTGCCAGAACCTG
TGTCTCCTGGCAAAGCTGTTTCTCGGCTCGAAGACGCTCTACTACGACGTGGAGCCTTTCCTGTTCTACATTCTC
TGCGAGTATGACGAGCGCGGATACCACTTTGTCGGCTACTTCTCCAAGGAGAAACGCGCGAGCAGCCAGAACAAC
GTGTCGTGCATCCTGACGCTGCCGATACACCAGCGCAAGGGTTACGGAAACCTGCTCATCGATTTTTCTTACCTT
CTCACCAAGACGGAGCAGAAGACGGGCTCGCCCGAGAAACCACTGTCAGACATGGGCCTCGTCTCGTATCGCAAC
TACTGGCGCCTGGAGCTATGCCGGTACTTTCTGGAGCTCATGGACGGAGATGGGCACAAGAAGGATGGGCTCAGC
GTCAAGCAGATCTCCGAAGACACGGGCATGACGGCCGACGACGTCGTCTCTGCCCTGGAAGGGCTCCGGGCCTTG
GTGAGGGACCCGCAGACACAGTTGTACGCGTTCCGCGTCGACCTGGACTACTGCCGACAGTACGTGACGAAGTGG
GAATCCAAAGGCTATGTCAGGCTGAAGCCAGAGGCCCTGGCCTGGACGCCCTATGTCATGGGCCGCAGCAACGCC
GTGAACTTCGAGCTTGGCCCGCCCATCAGCACCATCGCGCCACGCGAGGATGACGAGACCAAAGTGCACGAAGAC
CCCGCCAGCGTGGGTGCGGAATCGCAGCCGGCGGTCAACGGCGATGACGGAGACACGTCGCAACGAGAATCAAGC
ACGGCAGGCGATGTGGCCATGGCGGACAGCATGGAACCCGTCAAGTCGATCGAGAAGGTTGCACCCGAAGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail