Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8292
Gene name
LocationContig_531:72..838
Strand-
Gene length (bp)766
Transcript length (bp)582
Coding sequence length (bp)582
Protein length (aa) 194

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4511 0.6266 0.1045 0.2887 0.0307 0.0278 0.0637 0.0215 0.0739 0.005

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4984
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02031
Ophiocordyceps camponoti-rufipedis Ophun1|5502
Ophiocordyceps kimflemingae Ophio5|6778
Ophiocordyceps subramaniannii Hirsu2|2218
Ophiocordyceps subramaniannii Hirsu2|8292 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8292
MELFDLYRARNVGRKKKVALRDVEDTVAAAVIIYAAAEALSPPHSPAQDQKDGKSRESGGDKDKDRHRKHRHTHH
SSSHSSSKSRGEEEGKESRRRSSQGSHSSSSRHARDDSAGSGKNKAPAKAAKRHDSGHSGESSGASSGKRRRTPE
EHDRKKAERRQKDKAGAGGERASSDRKSKEAEGHGERGHRSPS*
Coding >Hirsu2|8292
ATGGAACTGTTTGACCTTTACCGGGCCCGGAACGTCGGCCGCAAGAAGAAAGTGGCCCTTCGCGACGTCGAGGAC
ACGGTGGCCGCCGCCGTGATCATCTACGCAGCAGCAGAGGCGCTGAGTCCTCCTCACAGCCCGGCCCAGGATCAG
AAAGATGGAAAATCTAGGGAGAGTGGCGGCGACAAGGACAAAGACCGGCATCGAAAGCACCGGCACACACACCAC
TCGAGCAGCCACTCCAGCAGCAAGAGCCGCGGCGAGGAGGAAGGGAAGGAGAGTCGAAGGCGGTCGTCGCAAGGC
TCGCACTCGTCGTCGTCCCGCCACGCCCGAGACGACAGCGCAGGCTCCGGCAAGAACAAGGCACCGGCCAAGGCG
GCCAAGCGGCACGACAGCGGGCACTCGGGCGAGAGCTCCGGCGCCAGCTCGGGCAAGCGGCGCAGGACCCCCGAG
GAGCACGACCGGAAGAAGGCGGAGCGGCGACAGAAGGACAAGGCGGGCGCGGGCGGCGAGCGGGCGAGCTCGGAC
CGGAAGAGCAAGGAGGCCGAGGGCCACGGGGAGCGCGGGCACCGATCCCCATCGTGA
Transcript >Hirsu2|8292
ATGGAACTGTTTGACCTTTACCGGGCCCGGAACGTCGGCCGCAAGAAGAAAGTGGCCCTTCGCGACGTCGAGGAC
ACGGTGGCCGCCGCCGTGATCATCTACGCAGCAGCAGAGGCGCTGAGTCCTCCTCACAGCCCGGCCCAGGATCAG
AAAGATGGAAAATCTAGGGAGAGTGGCGGCGACAAGGACAAAGACCGGCATCGAAAGCACCGGCACACACACCAC
TCGAGCAGCCACTCCAGCAGCAAGAGCCGCGGCGAGGAGGAAGGGAAGGAGAGTCGAAGGCGGTCGTCGCAAGGC
TCGCACTCGTCGTCGTCCCGCCACGCCCGAGACGACAGCGCAGGCTCCGGCAAGAACAAGGCACCGGCCAAGGCG
GCCAAGCGGCACGACAGCGGGCACTCGGGCGAGAGCTCCGGCGCCAGCTCGGGCAAGCGGCGCAGGACCCCCGAG
GAGCACGACCGGAAGAAGGCGGAGCGGCGACAGAAGGACAAGGCGGGCGCGGGCGGCGAGCGGGCGAGCTCGGAC
CGGAAGAGCAAGGAGGCCGAGGGCCACGGGGAGCGCGGGCACCGATCCCCATCGTGA
Gene >Hirsu2|8292
ATGGAACTGTTTGACCTTTACCGGGCCCGGAACGTCGGCCGCAAGAAGAAAGTGGCCCTTCGCGACGTCGAGGAC
ACGGTGGCCGCCGCCGTGATCATCTACGCAGCAGCAGAGGCGCTGAGTCCTCCTCACAGCCCGGCCCAGGATCAG
AAAGGCAAGGACGAGACCAGTGCGAGAGCGCAAATGACTTTGGACCCGCAGGCTGCTCAGTCTCGGGATGAATTC
GCCCCGCGGATGCACCCGGACCATCATCATGCCCCGAACGAATCATTTGCTGACTCGTTTACAGATGGAAAATCT
AGGGAGAGTGGCGGCGACAAGGACAAAGACCGGCATCGAAAGCACCGGCACACACACCACTCGAGCAGCCACTCC
AGCAGCAAGAGCCGCGGCGAGGAGGAAGGGAAGGAGAGTCGAAGGCGGTCGTCGCAAGGCTCGCACTCGTCGTCG
TCCCGCCACGCCCGAGACGACAGCGCAGGCTCCGGCAAGAACAAGGCACCGGCCAAGGCGGCCAAGCGGCACGAC
AGCGGGCACTCGGGCGAGAGCTCCGGCGCCAGCTCGGGCAAGCGGCGCAGGACCCCCGAGGAGCACGACCGGAAG
AAGGCGGAGCGGCGACAGAAGGACAAGGCGGGCGCGGGCGGCGAGCGGGCGAGCTCGGACCGGAAGAGCAAGGAG
GCCGAGGGCCACGGGGAGCGCGGGCACCGATCGTCGCGACGGCCCAGCCAGTCGCAGCCCAAGGGCAGCTCCGAG
CGCGAGCCCATCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail