Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8278
Gene name
LocationContig_53:5836..8036
Strand-
Gene length (bp)2200
Transcript length (bp)2073
Coding sequence length (bp)2073
Protein length (aa) 691

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09334 tRNA-synt_1g tRNA synthetases class I (M) 8.9E-89 53 425
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 3.2E-07 48 108
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 4.0E-07 312 401

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2H9|SYMM_NEUCR Probable methionine--tRNA ligase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=93G11.130 PE=3 SV=1 50 600 3.0E-176
sp|O14000|SYMM_SCHPO Probable methionine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27E2.06c PE=3 SV=1 39 570 3.0E-123
sp|O74634|SYMM_CANAX Methionine--tRNA ligase, mitochondrial OS=Candida albicans GN=MSM1 PE=3 SV=1 38 585 3.0E-120
sp|Q92PX0|SYM_RHIME Methionine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=metG PE=3 SV=1 52 581 5.0E-114
sp|Q90YI3|SYMM_TAKRU Methionine--tRNA ligase, mitochondrial OS=Takifugu rubripes GN=mars2 PE=3 SV=1 13 566 2.0E-112
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2H9|SYMM_NEUCR Probable methionine--tRNA ligase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=93G11.130 PE=3 SV=1 50 600 3.0E-176
sp|O14000|SYMM_SCHPO Probable methionine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27E2.06c PE=3 SV=1 39 570 3.0E-123
sp|O74634|SYMM_CANAX Methionine--tRNA ligase, mitochondrial OS=Candida albicans GN=MSM1 PE=3 SV=1 38 585 3.0E-120
sp|Q92PX0|SYM_RHIME Methionine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=metG PE=3 SV=1 52 581 5.0E-114
sp|Q90YI3|SYMM_TAKRU Methionine--tRNA ligase, mitochondrial OS=Takifugu rubripes GN=mars2 PE=3 SV=1 13 566 2.0E-112
sp|Q9ZCP0|SYM_RICPR Methionine--tRNA ligase OS=Rickettsia prowazekii (strain Madrid E) GN=metG PE=3 SV=1 53 569 2.0E-112
sp|Q54MZ8|SYMM_DICDI Probable methionine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=mmetS PE=3 SV=1 51 566 5.0E-112
sp|Q8UFA2|SYM_AGRFC Methionine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=metG PE=3 SV=1 49 565 1.0E-111
sp|Q68W54|SYM_RICTY Methionine--tRNA ligase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=metG PE=3 SV=1 53 569 9.0E-110
sp|Q7T0Z0|SYMM_XENLA Methionine--tRNA ligase, mitochondrial OS=Xenopus laevis GN=mars2 PE=2 SV=1 44 568 1.0E-109
sp|Q1RJZ5|SYM_RICBR Methionine--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=metG PE=3 SV=1 50 572 6.0E-109
sp|Q4UMX2|SYM_RICFE Methionine--tRNA ligase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=metG PE=3 SV=1 53 569 7.0E-107
sp|Q499X9|SYMM_MOUSE Methionine--tRNA ligase, mitochondrial OS=Mus musculus GN=Mars2 PE=1 SV=2 30 565 3.0E-106
sp|Q9CD55|SYM_MYCLE Methionine--tRNA ligase OS=Mycobacterium leprae (strain TN) GN=metG PE=3 SV=1 51 626 7.0E-106
sp|P59078|SYM_BRUSU Methionine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=metG PE=3 SV=1 53 565 7.0E-105
sp|Q96GW9|SYMM_HUMAN Methionine--tRNA ligase, mitochondrial OS=Homo sapiens GN=MARS2 PE=1 SV=2 48 567 1.0E-104
sp|Q92GS6|SYM_RICCN Methionine--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=metG PE=3 SV=1 50 569 3.0E-104
sp|P22438|SYMM_YEAST Methionine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSM1 PE=1 SV=2 40 585 5.0E-104
sp|Q8YH17|SYM_BRUME Methionine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=metG PE=3 SV=2 53 565 9.0E-104
sp|Q98MV8|SYM_RHILO Methionine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=metG PE=3 SV=1 53 565 6.0E-102
sp|Q9KGK8|SYM_BACHD Methionine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=metG PE=3 SV=1 47 611 7.0E-102
sp|O33925|SYM_THEMA Methionine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=metG PE=3 SV=1 53 555 3.0E-101
sp|O67298|SYM_AQUAE Methionine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=metG PE=1 SV=1 51 562 1.0E-100
sp|Q9VFL5|SYMM_DROME Methionine--tRNA ligase, mitochondrial OS=Drosophila melanogaster GN=Aats-met-m PE=2 SV=2 50 569 5.0E-100
sp|Q8RDD1|SYM_CALS4 Methionine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=metG PE=3 SV=1 51 573 9.0E-100
sp|A6H7E1|SYMM_BOVIN Methionine--tRNA ligase, mitochondrial OS=Bos taurus GN=MARS2 PE=2 SV=1 50 599 2.0E-99
sp|Q81JA8|SYM1_BACCR Methionine--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metG1 PE=3 SV=1 50 617 7.0E-99
sp|Q9CHE0|SYM_LACLA Methionine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=metG PE=3 SV=1 50 666 1.0E-98
sp|P9WFU4|SYM_MYCTO Methionine--tRNA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=metG PE=3 SV=1 51 580 3.0E-97
sp|P59952|SYM_MYCBO Methionine--tRNA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=metG PE=3 SV=1 51 580 3.0E-97
sp|Q92F90|SYM_LISIN Methionine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metG PE=3 SV=1 53 654 3.0E-96
sp|P9WFU5|SYM_MYCTU Methionine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=metG PE=1 SV=1 51 580 6.0E-96
sp|Q81W03|SYM1_BACAN Methionine--tRNA ligase 1 OS=Bacillus anthracis GN=metG1 PE=3 SV=1 50 599 1.0E-95
sp|Q724N6|SYM_LISMF Methionine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metG PE=3 SV=1 53 563 1.0E-95
sp|P37465|SYM_BACSU Methionine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=metG PE=3 SV=1 53 560 1.0E-95
sp|Q8YAF2|SYM_LISMO Methionine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metG PE=3 SV=1 53 563 2.0E-95
sp|P23920|SYM_GEOSE Methionine--tRNA ligase OS=Geobacillus stearothermophilus GN=metG PE=3 SV=1 51 591 2.0E-94
sp|Q8P298|SYM_STRP8 Methionine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=metG PE=3 SV=1 51 581 1.0E-93
sp|Q5XDK8|SYM_STRP6 Methionine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=metG PE=3 SV=2 51 581 1.0E-93
sp|P0DG49|SYM_STRPQ Methionine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=metG PE=3 SV=1 51 581 1.0E-93
sp|P0DG48|SYM_STRP3 Methionine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=metG PE=3 SV=1 51 581 1.0E-93
sp|Q837B3|SYM_ENTFA Methionine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=metG PE=3 SV=1 53 599 2.0E-93
sp|P59079|SYM_OCEIH Methionine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metG PE=3 SV=1 48 563 6.0E-93
sp|Q5HII6|SYM_STAAC Methionine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=metG PE=3 SV=1 53 626 9.0E-93
sp|Q9A178|SYM_STRP1 Methionine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=metG PE=3 SV=2 51 581 2.0E-92
sp|Q8NY00|SYM_STAAW Methionine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=metG PE=3 SV=1 53 626 3.0E-92
sp|Q6GBZ8|SYM_STAAS Methionine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=metG PE=3 SV=1 53 626 3.0E-92
sp|P67579|SYM_STAAN Methionine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=metG PE=1 SV=1 53 629 3.0E-92
sp|P67578|SYM_STAAM Methionine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metG PE=3 SV=1 53 629 3.0E-92
sp|Q88Z97|SYM_LACPL Methionine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metG PE=3 SV=1 48 640 4.0E-92
sp|Q6GJI1|SYM_STAAR Methionine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=metG PE=3 SV=1 53 629 6.0E-92
sp|Q97EW5|SYM_CLOAB Methionine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=metG PE=3 SV=1 51 563 1.0E-91
sp|Q8Z068|SYM_NOSS1 Methionine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=metG PE=3 SV=1 46 559 2.0E-91
sp|P67581|SYM_STRR6 Methionine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=metG PE=3 SV=1 49 562 2.0E-91
sp|P67580|SYM_STRPN Methionine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=metG PE=3 SV=1 49 562 2.0E-91
sp|Q49UZ9|SYM_STAS1 Methionine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=metG PE=3 SV=1 53 599 6.0E-91
sp|P23395|SYM_THET8 Methionine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=metG PE=1 SV=2 50 568 7.0E-91
sp|Q8CQU3|SYM_STAES Methionine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=metG PE=3 SV=1 53 560 8.0E-91
sp|Q5HRR5|SYM_STAEQ Methionine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=metG PE=3 SV=1 53 560 8.0E-91
sp|Q9F2I9|SYM_STRCO Methionine--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=metG PE=3 SV=1 51 561 2.0E-90
sp|Q899D9|SYM_CLOTE Methionine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=metG PE=3 SV=1 51 560 4.0E-89
sp|Q4L3E7|SYM_STAHJ Methionine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=metG PE=3 SV=1 53 666 9.0E-89
sp|Q8RE57|SYM_FUSNN Methionine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=metG PE=3 SV=1 51 572 2.0E-86
sp|Q9PP85|SYM_CAMJE Methionine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=metG PE=3 SV=1 54 575 9.0E-85
sp|Q55729|SYM_SYNY3 Methionine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=metG PE=3 SV=1 53 571 2.0E-84
sp|Q8XHG1|SYM_CLOPE Methionine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=metG PE=3 SV=1 51 561 2.0E-82
sp|Q9M2T9|SYMM_ARATH Methionine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=OVA1 PE=2 SV=1 41 564 7.0E-81
sp|P56127|SYM_HELPY Methionine--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=metG PE=3 SV=1 55 551 7.0E-80
sp|Q9ZKG9|SYM_HELPJ Methionine--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=metG PE=3 SV=1 55 551 4.0E-79
sp|Q9PQU6|SYM_UREPA Methionine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=metG PE=3 SV=1 51 567 4.0E-78
sp|Q9RUF3|SYM_DEIRA Methionine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=metG PE=3 SV=1 45 560 3.0E-77
sp|P59081|SYM_THEEB Methionine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=metG PE=3 SV=1 53 559 4.0E-74
sp|P47267|SYM_MYCGE Methionine--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=metG PE=3 SV=1 51 563 2.0E-69
sp|Q50319|SYM_MYCPU Methionine--tRNA ligase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=metG PE=3 SV=2 51 559 3.0E-67
sp|P75091|SYM_MYCPN Methionine--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=metG PE=1 SV=1 51 566 8.0E-67
sp|B8D274|SYM_HALOH Methionine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=metG PE=3 SV=1 61 572 1.0E-40
sp|A0B7K2|SYM_METTP Methionine--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=metG PE=3 SV=1 50 689 2.0E-38
sp|O26687|SYM_METTH Methionine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=metG PE=3 SV=1 54 588 4.0E-38
sp|Q46F18|SYM_METBF Methionine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=metG PE=3 SV=1 49 615 5.0E-38
sp|A2SRE2|SYM_METLZ Methionine--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=metG PE=3 SV=1 49 668 3.0E-37
sp|A5UJ98|SYM_METS3 Methionine--tRNA ligase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=metG PE=3 SV=1 54 554 3.0E-37
sp|O28819|SYM_ARCFU Methionine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=metG PE=3 SV=1 55 633 1.0E-36
sp|Q2NI31|SYM_METST Methionine--tRNA ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=metG PE=3 SV=1 54 554 2.0E-36
sp|A3CX39|SYM_METMJ Methionine--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=metG PE=3 SV=1 49 563 2.0E-36
sp|A8MG12|SYM1_ALKOO Methionine--tRNA ligase 1 OS=Alkaliphilus oremlandii (strain OhILAs) GN=metG1 PE=3 SV=1 61 562 2.0E-36
sp|A6UUN1|SYM_META3 Methionine--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=metG PE=3 SV=1 53 563 3.0E-36
sp|Q0W0H2|SYM_METAR Methionine--tRNA ligase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=metG PE=3 SV=1 45 559 5.0E-36
sp|A7I6H7|SYM_METB6 Methionine--tRNA ligase OS=Methanoregula boonei (strain 6A8) GN=metG PE=3 SV=1 49 559 1.0E-35
sp|Q8PYJ4|SYM_METMA Methionine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=metG PE=3 SV=2 46 580 2.0E-35
sp|Q47SZ0|SYM_THEFY Methionine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=metG PE=3 SV=1 61 559 2.0E-35
sp|Q8TIU5|SYM_METAC Methionine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=metG PE=3 SV=1 46 580 3.0E-35
sp|Q2FU77|SYM_METHJ Methionine--tRNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=metG PE=3 SV=2 51 559 3.0E-35
sp|B2IQ55|SYM_STRPS Methionine--tRNA ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=metG PE=3 SV=1 61 556 4.0E-35
sp|C1C727|SYM_STRP7 Methionine--tRNA ligase OS=Streptococcus pneumoniae (strain 70585) GN=metG PE=3 SV=1 61 556 4.0E-35
sp|Q3KMZ0|SYM_CHLTA Methionine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=metG PE=3 SV=1 55 559 4.0E-35
sp|A6URW2|SYM_METVS Methionine--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=metG PE=3 SV=1 53 563 9.0E-35
sp|B0BB18|SYM_CHLTB Methionine--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=metG PE=3 SV=1 55 559 1.0E-34
sp|B0B9D9|SYM_CHLT2 Methionine--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=metG PE=3 SV=1 55 559 1.0E-34
sp|A7NND5|SYM_ROSCS Methionine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=metG PE=3 SV=1 61 559 2.0E-34
sp|A5UUW9|SYM_ROSS1 Methionine--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=metG PE=3 SV=1 61 559 3.0E-34
sp|Q12UQ9|SYM_METBU Methionine--tRNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=metG PE=3 SV=1 49 580 3.0E-34
sp|O84035|SYM_CHLTR Methionine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=metG PE=3 SV=1 55 559 3.0E-34
sp|C5C046|SYM_BEUC1 Methionine--tRNA ligase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=metG PE=3 SV=1 61 559 4.0E-34
sp|A8M218|SYM_SALAI Methionine--tRNA ligase OS=Salinispora arenicola (strain CNS-205) GN=metG PE=3 SV=1 61 579 6.0E-34
sp|B0SQX5|SYM_LEPBP Methionine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=metG PE=3 SV=1 51 556 8.0E-34
sp|B0SHA8|SYM_LEPBA Methionine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=metG PE=3 SV=1 51 556 8.0E-34
sp|Q9Z959|SYM_CHLPN Methionine--tRNA ligase OS=Chlamydia pneumoniae GN=metG PE=3 SV=2 55 551 1.0E-33
sp|B8GFL4|SYM_METPE Methionine--tRNA ligase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=metG PE=3 SV=1 52 571 1.0E-33
sp|B8DT48|SYM_BIFA0 Methionine--tRNA ligase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=metG PE=3 SV=1 61 577 1.0E-33
sp|B9KZR0|SYM_THERP Methionine--tRNA ligase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=metG PE=3 SV=1 61 561 2.0E-33
sp|A4F7W6|SYM_SACEN Methionine--tRNA ligase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=metG PE=3 SV=1 61 559 3.0E-33
sp|Q5V1B3|SYM_HALMA Methionine--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=metG PE=3 SV=1 49 559 7.0E-33
sp|A6W6U1|SYM_KINRD Methionine--tRNA ligase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=metG PE=3 SV=1 61 559 1.0E-32
sp|A5FS74|SYM_DEHMB Methionine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=metG PE=3 SV=1 61 559 1.0E-32
sp|Q9YCY3|SYM_AERPE Methionine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=metG PE=3 SV=1 53 560 1.0E-32
sp|A4X307|SYM_SALTO Methionine--tRNA ligase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=metG PE=3 SV=1 61 579 2.0E-32
sp|Q3ZZB2|SYM_DEHMC Methionine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=metG PE=3 SV=1 61 559 2.0E-32
sp|B7HD62|SYM_BACC4 Methionine--tRNA ligase OS=Bacillus cereus (strain B4264) GN=metG PE=3 SV=1 61 560 2.0E-32
sp|Q815U6|SYM2_BACCR Methionine--tRNA ligase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metG2 PE=3 SV=1 61 560 2.0E-32
sp|Q1AST1|SYM_RUBXD Methionine--tRNA ligase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=metG PE=3 SV=1 53 556 3.0E-32
sp|B6J4V8|SYM_COXB1 Methionine--tRNA ligase OS=Coxiella burnetii (strain CbuK_Q154) GN=metG PE=3 SV=1 55 554 4.0E-32
sp|B6J3N7|SYM_COXB2 Methionine--tRNA ligase OS=Coxiella burnetii (strain CbuG_Q212) GN=metG PE=3 SV=1 55 554 4.0E-32
sp|A1A3N3|SYM_BIFAA Methionine--tRNA ligase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=metG PE=3 SV=1 61 559 4.0E-32
sp|A9KDF8|SYM_COXBN Methionine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=metG PE=3 SV=1 55 554 5.0E-32
sp|Q83B24|SYM_COXBU Methionine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=metG PE=3 SV=1 55 554 5.0E-32
sp|A9NA60|SYM_COXBR Methionine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=metG PE=3 SV=1 55 554 5.0E-32
sp|A4FZL1|SYM_METM5 Methionine--tRNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=metG PE=3 SV=1 53 563 5.0E-32
sp|B9LDY3|SYM_CHLSY Methionine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=metG PE=3 SV=1 61 559 6.0E-32
sp|A9WKM1|SYM_CHLAA Methionine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=metG PE=3 SV=1 61 559 6.0E-32
sp|B7INU9|SYM_BACC2 Methionine--tRNA ligase OS=Bacillus cereus (strain G9842) GN=metG PE=3 SV=1 61 560 8.0E-32
sp|B8G6F7|SYM_CHLAD Methionine--tRNA ligase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=metG PE=3 SV=1 61 559 9.0E-32
sp|Q979B7|SYM_THEVO Methionine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=metG PE=3 SV=1 55 563 1.0E-31
sp|A6VIW5|SYM_METM7 Methionine--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=metG PE=3 SV=1 53 563 3.0E-31
sp|Q3IT47|SYM_NATPD Methionine--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=metG PE=3 SV=1 49 573 4.0E-31
sp|C3LD96|SYM_BACAC Methionine--tRNA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=metG PE=3 SV=1 61 560 4.0E-31
sp|C3P025|SYM_BACAA Methionine--tRNA ligase OS=Bacillus anthracis (strain A0248) GN=metG PE=3 SV=1 61 560 4.0E-31
sp|Q81XF9|SYM2_BACAN Methionine--tRNA ligase 2 OS=Bacillus anthracis GN=metG2 PE=3 SV=1 61 560 4.0E-31
sp|B7JEJ3|SYM_BACC0 Methionine--tRNA ligase OS=Bacillus cereus (strain AH820) GN=metG PE=3 SV=1 61 560 4.0E-31
sp|Q6HBM0|SYM1_BACHK Methionine--tRNA ligase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=metG1 PE=3 SV=1 61 560 4.0E-31
sp|C1EYD5|SYM_BACC3 Methionine--tRNA ligase OS=Bacillus cereus (strain 03BB102) GN=metG PE=3 SV=1 61 560 5.0E-31
sp|A0RKM3|SYM1_BACAH Methionine--tRNA ligase 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=metG1 PE=3 SV=1 61 560 5.0E-31
sp|Q6L1M5|SYM_PICTO Methionine--tRNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=metG PE=3 SV=1 61 569 5.0E-31
sp|P59076|SYM_BIFLO Methionine--tRNA ligase OS=Bifidobacterium longum (strain NCC 2705) GN=metG PE=3 SV=1 61 559 6.0E-31
sp|Q58659|SYM_METJA Methionine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=metG PE=3 SV=1 53 670 6.0E-31
sp|Q3Z9G6|SYM_DEHM1 Methionine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=metG PE=3 SV=1 61 559 7.0E-31
sp|Q5JDZ7|SYM_THEKO Methionine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=metG PE=3 SV=1 53 589 7.0E-31
sp|Q1D8K2|SYM_MYXXD Methionine--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=metG PE=3 SV=1 55 581 7.0E-31
sp|Q6M0E5|SYM_METMP Methionine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=metG PE=3 SV=1 53 566 8.0E-31
sp|B4ESY6|SYM_PROMH Methionine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=metG PE=3 SV=1 55 549 9.0E-31
sp|B6YUN0|SYM_THEON Methionine--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=metG PE=3 SV=1 53 565 1.0E-30
sp|B7GP85|SYM_BIFLS Methionine--tRNA ligase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=metG PE=3 SV=1 61 559 1.0E-30
sp|Q8D219|SYM_WIGBR Methionine--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=metG PE=3 SV=1 55 560 1.0E-30
sp|Q8TX28|SYM_METKA Methionine--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=metG PE=3 SV=1 55 637 1.0E-30
sp|A3QD92|SYM_SHELP Methionine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=metG PE=3 SV=1 47 554 1.0E-30
sp|B7HVW2|SYM_BACC7 Methionine--tRNA ligase OS=Bacillus cereus (strain AH187) GN=metG PE=3 SV=1 61 560 2.0E-30
sp|A5EY62|SYM_DICNV Methionine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=metG PE=3 SV=1 54 670 2.0E-30
sp|Q9PL07|SYM_CHLMU Methionine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=metG PE=3 SV=1 55 551 3.0E-30
sp|B9J4E0|SYM_BACCQ Methionine--tRNA ligase OS=Bacillus cereus (strain Q1) GN=metG PE=3 SV=1 61 560 3.0E-30
sp|A9VP41|SYM_BACWK Methionine--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=metG PE=3 SV=1 61 559 3.0E-30
sp|B1L7J9|SYM_KORCO Methionine--tRNA ligase OS=Korarchaeum cryptofilum (strain OPF8) GN=metG PE=3 SV=1 61 574 4.0E-30
sp|Q255A6|SYM_CHLFF Methionine--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=metG PE=3 SV=1 55 568 4.0E-30
sp|B3QT85|SYM_CHLT3 Methionine--tRNA ligase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=metG PE=3 SV=1 55 562 4.0E-30
sp|Q054R6|SYM_LEPBL Methionine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=metG PE=3 SV=1 45 561 7.0E-30
sp|Q04Q66|SYM_LEPBJ Methionine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=metG PE=3 SV=1 45 561 7.0E-30
sp|Q822N0|SYM_CHLCV Methionine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=metG PE=3 SV=1 55 559 1.0E-29
sp|Q5L5M3|SYM_CHLAB Methionine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=metG PE=3 SV=1 55 554 1.0E-29
sp|A6GVQ2|SYM_FLAPJ Methionine--tRNA ligase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=metG PE=3 SV=1 51 551 1.0E-29
sp|A5FLM7|SYM_FLAJ1 Methionine--tRNA ligase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=metG PE=3 SV=1 51 552 1.0E-29
sp|O58721|SYM_PYRHO Methionine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=metG PE=3 SV=1 53 554 2.0E-29
sp|A0KW24|SYM_SHESA Methionine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=metG PE=3 SV=1 55 554 2.0E-29
sp|A4YI01|SYM_METS5 Methionine--tRNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=metG PE=3 SV=1 61 564 2.0E-29
sp|C4LHI6|SYM_CORK4 Methionine--tRNA ligase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=metG PE=3 SV=1 61 572 3.0E-29
sp|B1KQM2|SYM_SHEWM Methionine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=metG PE=3 SV=1 55 554 3.0E-29
sp|A2BLU2|SYM_HYPBU Methionine--tRNA ligase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=metG PE=3 SV=1 61 552 3.0E-29
sp|B2S0T6|SYM_BORHD Methionine--tRNA ligase OS=Borrelia hermsii (strain HS1 / DAH) GN=metG PE=3 SV=1 51 554 3.0E-29
sp|Q89AX4|SYM_BUCBP Methionine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=metG PE=3 SV=1 55 561 4.0E-29
sp|A8H3V2|SYM_SHEPA Methionine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=metG PE=3 SV=1 55 554 4.0E-29
sp|B5ENA8|SYM_ACIF5 Methionine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=metG PE=3 SV=1 55 563 5.0E-29
sp|B7J7Y5|SYM_ACIF2 Methionine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=metG PE=3 SV=1 55 563 5.0E-29
sp|Q3B3N3|SYM_CHLL7 Methionine--tRNA ligase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=metG PE=3 SV=1 48 561 5.0E-29
sp|Q72Y44|SYM1_BACC1 Methionine--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metG1 PE=3 SV=1 61 560 6.0E-29
sp|Q12MI8|SYM_SHEDO Methionine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=metG PE=3 SV=1 55 554 1.0E-28
sp|A3MZ70|SYM_ACTP2 Methionine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=metG PE=3 SV=2 55 632 1.0E-28
sp|B0TJ05|SYM_SHEHH Methionine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=metG PE=3 SV=1 55 554 1.0E-28
sp|Q72MR4|SYM_LEPIC Methionine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=metG PE=3 SV=1 45 561 1.0E-28
sp|Q8EZD6|SYM_LEPIN Methionine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=metG PE=3 SV=1 45 561 1.0E-28
sp|A1SGG5|SYM_NOCSJ Methionine--tRNA ligase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=metG PE=3 SV=1 61 614 2.0E-28
sp|Q1H2F4|SYM_METFK Methionine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=metG1 PE=3 SV=1 55 554 2.0E-28
sp|Q9SVN5|SYMC_ARATH Methionine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At4g13780 PE=2 SV=1 55 560 2.0E-28
sp|Q7VMC9|SYM_HAEDU Methionine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metG PE=3 SV=1 55 552 2.0E-28
sp|Q081H3|SYM_SHEFN Methionine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=metG PE=3 SV=1 55 554 2.0E-28
sp|B5RME0|SYM_BORDL Methionine--tRNA ligase OS=Borrelia duttonii (strain Ly) GN=metG PE=3 SV=1 51 548 2.0E-28
sp|Q1LT75|SYM_BAUCH Methionine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=metG PE=3 SV=1 55 551 3.0E-28
sp|B5RPT6|SYM_BORRA Methionine--tRNA ligase OS=Borrelia recurrentis (strain A1) GN=metG PE=3 SV=1 51 548 3.0E-28
sp|Q0HJN6|SYM_SHESM Methionine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=metG PE=3 SV=1 55 554 3.0E-28
sp|Q8EDX2|SYM_SHEON Methionine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=metG PE=3 SV=1 55 554 3.0E-28
sp|Q6NIA5|SYM_CORDI Methionine--tRNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metG PE=3 SV=1 61 559 3.0E-28
sp|B0BTA2|SYM_ACTPJ Methionine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=metG PE=3 SV=1 55 551 4.0E-28
sp|B3H0J7|SYM_ACTP7 Methionine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=metG PE=3 SV=1 55 551 4.0E-28
sp|A1S798|SYM_SHEAM Methionine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=metG PE=3 SV=1 55 556 4.0E-28
sp|A4SE77|SYM_CHLPM Methionine--tRNA ligase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=metG PE=3 SV=1 55 561 7.0E-28
sp|Q0I3W7|SYM_HAES1 Methionine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=metG PE=3 SV=1 47 552 7.0E-28
sp|Q9V011|SYM_PYRAB Methionine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=metG PE=1 SV=1 53 565 8.0E-28
sp|Q0HVY2|SYM_SHESR Methionine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=metG PE=3 SV=1 55 554 8.0E-28
sp|C6DCI4|SYM_PECCP Methionine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=metG PE=3 SV=1 51 551 9.0E-28
sp|Q18JV4|SYM_HALWD Methionine--tRNA ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=metG PE=3 SV=1 40 567 9.0E-28
sp|Q4J8M3|SYM_SULAC Methionine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=metG PE=3 SV=1 55 560 1.0E-27
sp|Q6D7B6|SYM_PECAS Methionine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metG PE=3 SV=1 51 548 1.0E-27
sp|A6WP56|SYM_SHEB8 Methionine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=metG PE=3 SV=1 55 554 1.0E-27
sp|Q8FR00|SYM_COREF Methionine--tRNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metG PE=3 SV=1 61 559 1.0E-27
sp|A3D5E5|SYM_SHEB5 Methionine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=metG PE=3 SV=1 55 554 2.0E-27
sp|B8E958|SYM_SHEB2 Methionine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=metG PE=3 SV=1 55 554 2.0E-27
sp|A9L4F6|SYM_SHEB9 Methionine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=metG PE=3 SV=1 55 554 2.0E-27
sp|Q0AAG6|SYM_ALKEH Methionine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=metG PE=3 SV=1 55 553 2.0E-27
sp|A6VQD5|SYM_ACTSZ Methionine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=metG PE=3 SV=1 47 551 3.0E-27
sp|Q8U221|SYM_PYRFU Methionine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=metG PE=3 SV=1 53 554 3.0E-27
sp|A6SX05|SYM_JANMA Methionine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=metG PE=3 SV=1 54 670 3.0E-27
sp|B1XWM2|SYM_LEPCP Methionine--tRNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=metG PE=3 SV=1 54 670 3.0E-27
sp|A8FWN7|SYM_SHESH Methionine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=metG PE=3 SV=1 55 554 3.0E-27
sp|Q47IK0|SYM_DECAR Methionine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=metG PE=3 SV=1 55 560 4.0E-27
sp|Q11RM3|SYM_CYTH3 Methionine--tRNA ligase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=metG PE=3 SV=1 49 563 5.0E-27
sp|A1BF81|SYM_CHLPD Methionine--tRNA ligase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=metG PE=3 SV=1 55 562 6.0E-27
sp|B4SGQ6|SYM_PELPB Methionine--tRNA ligase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=metG PE=3 SV=1 55 559 6.0E-27
sp|Q3SKG8|SYM_THIDA Methionine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=metG PE=3 SV=1 55 554 7.0E-27
sp|O83776|SYM_TREPA Methionine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=metG PE=3 SV=1 55 601 7.0E-27
sp|A1TZ66|SYM_MARHV Methionine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=metG PE=3 SV=1 44 563 8.0E-27
sp|Q1QVN7|SYM_CHRSD Methionine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=metG PE=3 SV=1 55 567 8.0E-27
sp|A1RIY0|SYM_SHESW Methionine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=metG PE=3 SV=1 55 554 9.0E-27
sp|A4Y7K8|SYM_SHEPC Methionine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=metG PE=3 SV=1 55 554 9.0E-27
sp|C3MW97|SYM_SULIM Methionine--tRNA ligase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=metG PE=3 SV=1 55 560 1.0E-26
sp|B2VIF6|SYM_ERWT9 Methionine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=metG PE=3 SV=1 51 551 2.0E-26
sp|Q60CR0|SYM_METCA Methionine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=metG PE=3 SV=1 55 554 2.0E-26
sp|A8AEB2|SYM_CITK8 Methionine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=metG PE=3 SV=1 51 554 2.0E-26
sp|B3ECI3|SYM_CHLL2 Methionine--tRNA ligase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=metG PE=3 SV=1 55 559 2.0E-26
sp|Q9HSA4|SYM_HALSA Methionine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=metG PE=3 SV=1 49 661 3.0E-26
sp|A0M5Z9|SYM_GRAFK Methionine--tRNA ligase OS=Gramella forsetii (strain KT0803) GN=metG PE=3 SV=1 53 563 3.0E-26
sp|B0UV72|SYM_HISS2 Methionine--tRNA ligase OS=Histophilus somni (strain 2336) GN=metG PE=3 SV=1 47 552 3.0E-26
sp|Q9UWW2|SYM_SULSO Methionine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=metG PE=3 SV=1 61 560 4.0E-26
sp|A1R019|SYM_BORT9 Methionine--tRNA ligase OS=Borrelia turicatae (strain 91E135) GN=metG PE=3 SV=1 51 554 4.0E-26
sp|B4TNL2|SYM_SALSV Methionine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=metG PE=3 SV=1 51 577 4.0E-26
sp|Q3JCG5|SYM_NITOC Methionine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=metG PE=3 SV=1 55 548 5.0E-26
sp|Q971C1|SYM_SULTO Methionine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=metG PE=3 SV=1 61 565 5.0E-26
sp|C4K759|SYM_HAMD5 Methionine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=metG PE=3 SV=1 51 548 5.0E-26
sp|B9MEX0|SYM_ACIET Methionine--tRNA ligase OS=Acidovorax ebreus (strain TPSY) GN=metG PE=3 SV=1 49 670 6.0E-26
sp|P59077|SYM_CHLTE Methionine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=metG PE=3 SV=1 55 559 6.0E-26
sp|Q7N6J6|SYM_PHOLL Methionine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=metG PE=3 SV=1 47 551 6.0E-26
sp|A1JTX6|SYM_YERE8 Methionine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=metG PE=3 SV=1 51 549 6.0E-26
sp|Q8NRZ4|SYM_CORGL Methionine--tRNA ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metG PE=3 SV=1 61 559 7.0E-26
sp|A4QCN5|SYM_CORGB Methionine--tRNA ligase OS=Corynebacterium glutamicum (strain R) GN=metG PE=3 SV=1 61 559 7.0E-26
sp|Q5R0G6|SYM_IDILO Methionine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=metG PE=3 SV=1 47 554 7.0E-26
sp|Q492J8|SYM_BLOPB Methionine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=metG PE=3 SV=1 49 552 7.0E-26
sp|A1WUY7|SYM_HALHL Methionine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=metG PE=3 SV=1 55 553 7.0E-26
sp|A2SEY3|SYM_METPP Methionine--tRNA ligase OS=Methylibium petroleiphilum (strain PM1) GN=metG PE=3 SV=1 54 600 8.0E-26
sp|A9N7I2|SYM_SALPB Methionine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=metG PE=3 SV=2 51 577 9.0E-26
sp|Q44951|SYM_BORBU Methionine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=metG PE=3 SV=2 55 572 9.0E-26
sp|Q4JU18|SYM_CORJK Methionine--tRNA ligase OS=Corynebacterium jeikeium (strain K411) GN=metG PE=3 SV=1 61 559 9.0E-26
sp|B7J2F0|SYM_BORBZ Methionine--tRNA ligase OS=Borrelia burgdorferi (strain ZS7) GN=metG PE=3 SV=1 55 572 1.0E-25
sp|B5BE81|SYM_SALPK Methionine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=metG PE=3 SV=1 51 577 1.0E-25
sp|Q5PJ43|SYM_SALPA Methionine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metG PE=3 SV=1 51 577 1.0E-25
sp|A5F2P8|SYM_VIBC3 Methionine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=metG PE=3 SV=2 55 551 1.0E-25
sp|A4IXI6|SYM_FRATW Methionine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=metG PE=3 SV=1 55 561 1.0E-25
sp|Q5NFE7|SYM_FRATT Methionine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=metG PE=3 SV=1 55 561 1.0E-25
sp|Q14GV0|SYM_FRAT1 Methionine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=metG PE=3 SV=1 55 561 1.0E-25
sp|C4LEX5|SYM_TOLAT Methionine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=metG PE=3 SV=1 47 576 1.0E-25
sp|B4SXY7|SYM_SALNS Methionine--tRNA ligase OS=Salmonella newport (strain SL254) GN=metG PE=3 SV=1 51 577 1.0E-25
sp|B4T9X0|SYM_SALHS Methionine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=metG PE=3 SV=1 51 577 1.0E-25
sp|B5EXZ5|SYM_SALA4 Methionine--tRNA ligase OS=Salmonella agona (strain SL483) GN=metG PE=3 SV=1 51 577 1.0E-25
sp|Q8ZNN4|SYM_SALTY Methionine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metG PE=3 SV=3 51 577 1.0E-25
sp|B5FMX1|SYM_SALDC Methionine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=metG PE=3 SV=1 51 577 1.0E-25
sp|Q3BVP1|SYM_XANC5 Methionine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=metG PE=3 SV=1 55 553 1.0E-25
sp|Q9PFV8|SYM_XYLFA Methionine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=metG PE=3 SV=1 55 548 1.0E-25
sp|C0Q0Y1|SYM_SALPC Methionine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=metG PE=3 SV=1 51 554 1.0E-25
sp|Q87B68|SYM_XYLFT Methionine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metG PE=3 SV=1 55 548 2.0E-25
sp|B2I7S0|SYM_XYLF2 Methionine--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=metG PE=3 SV=1 55 548 2.0E-25
sp|B5RBZ5|SYM_SALG2 Methionine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=metG PE=3 SV=1 51 554 2.0E-25
sp|B5R0E7|SYM_SALEP Methionine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=metG PE=3 SV=1 51 554 2.0E-25
sp|Q57MI5|SYM_SALCH Methionine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=metG PE=3 SV=2 51 554 2.0E-25
sp|B0U472|SYM_XYLFM Methionine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=metG PE=3 SV=1 55 548 2.0E-25
sp|Q7W0F7|SYM_BORPE Methionine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=metG PE=3 SV=1 54 558 2.0E-25
sp|Q9KT69|SYM_VIBCH Methionine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=metG PE=3 SV=2 55 551 2.0E-25
sp|Q8Z5C3|SYM_SALTI Methionine--tRNA ligase OS=Salmonella typhi GN=metG PE=3 SV=3 51 554 2.0E-25
sp|Q7W1D8|SYM_BORPA Methionine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=metG PE=3 SV=1 54 558 2.0E-25
sp|A7MHL3|SYM_CROS8 Methionine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=metG PE=3 SV=2 51 548 2.0E-25
sp|Q7WP45|SYM_BORBR Methionine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=metG PE=3 SV=1 54 558 2.0E-25
sp|Q9HJ12|SYM_THEAC Methionine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=metG PE=3 SV=1 55 560 2.0E-25
sp|Q2A4Y6|SYM_FRATH Methionine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=metG PE=3 SV=1 55 561 2.0E-25
sp|A1WBH1|SYM_ACISJ Methionine--tRNA ligase OS=Acidovorax sp. (strain JS42) GN=metG PE=3 SV=1 49 655 2.0E-25
sp|Q21TB9|SYM_RHOFT Methionine--tRNA ligase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=metG PE=3 SV=1 54 554 2.0E-25
sp|A7NAE2|SYM_FRATF Methionine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=metG PE=3 SV=2 55 561 2.0E-25
sp|B5FG53|SYM_VIBFM Methionine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=metG PE=3 SV=1 48 552 2.0E-25
sp|A4WCF6|SYM_ENT38 Methionine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=metG PE=3 SV=2 51 549 2.0E-25
sp|Q0BNA8|SYM_FRATO Methionine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=metG PE=3 SV=1 55 561 2.0E-25
sp|Q6MMA3|SYM_BDEBA Methionine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=metG PE=3 SV=1 55 559 3.0E-25
sp|B8D715|SYM_BUCAT Methionine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=metG PE=3 SV=1 47 551 3.0E-25
sp|P57210|SYM_BUCAI Methionine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=metG PE=3 SV=1 47 551 3.0E-25
sp|B8D8R1|SYM_BUCA5 Methionine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=metG PE=3 SV=1 47 551 3.0E-25
sp|Q8PMP0|SYM_XANAC Methionine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=metG PE=3 SV=1 55 553 3.0E-25
sp|A1RRE2|SYM_PYRIL Methionine--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=metG PE=3 SV=1 61 562 3.0E-25
sp|A0L8S1|SYM_MAGMM Methionine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=metG PE=3 SV=1 55 554 3.0E-25
sp|A7MZT3|SYM_VIBCB Methionine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=metG PE=3 SV=2 55 552 4.0E-25
sp|A9MKV0|SYM_SALAR Methionine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=metG PE=3 SV=2 51 554 4.0E-25
sp|B4SRG1|SYM_STRM5 Methionine--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=metG PE=3 SV=1 55 549 4.0E-25
sp|B1VFI1|SYM_CORU7 Methionine--tRNA ligase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=metG PE=3 SV=1 61 559 4.0E-25
sp|Q5H1J3|SYM_XANOR Methionine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=metG PE=3 SV=1 55 553 4.0E-25
sp|B2SRQ4|SYM_XANOP Methionine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=metG PE=3 SV=1 55 553 4.0E-25
sp|Q2P4E9|SYM_XANOM Methionine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=metG PE=3 SV=1 55 553 4.0E-25
sp|Q12F12|SYM_POLSJ Methionine--tRNA ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=metG PE=3 SV=1 54 558 5.0E-25
sp|Q0ANL8|SYM_MARMM Methionine--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=metG PE=3 SV=1 55 569 5.0E-25
sp|B7VLW8|SYM_VIBTL Methionine--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=metG PE=3 SV=1 48 552 5.0E-25
sp|Q31GU1|SYM_THICR Methionine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=metG PE=3 SV=1 55 551 5.0E-25
sp|A3MVB7|SYM_PYRCJ Methionine--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=metG PE=3 SV=1 53 559 6.0E-25
sp|Q6LSZ7|SYM_PHOPR Methionine--tRNA ligase OS=Photobacterium profundum GN=metG PE=3 SV=1 47 548 6.0E-25
sp|B2FPT0|SYM_STRMK Methionine--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=metG PE=3 SV=1 55 549 7.0E-25
sp|Q8A3M1|SYM_BACTN Methionine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=metG PE=3 SV=1 55 575 8.0E-25
sp|Q2NUD0|SYM_SODGM Methionine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=metG PE=3 SV=1 51 551 9.0E-25
sp|B8F3E3|SYM_HAEPS Methionine--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=metG PE=3 SV=1 55 551 1.0E-24
sp|Q5E3Z7|SYM_VIBF1 Methionine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=metG PE=3 SV=1 48 552 1.0E-24
sp|B2RHF5|SYM_PORG3 Methionine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=metG PE=3 SV=1 55 558 1.0E-24
sp|Q6A707|SYM_PROAC Methionine--tRNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=metG PE=3 SV=1 47 559 1.0E-24
sp|Q2T9L8|SYMC_BOVIN Methionine--tRNA ligase, cytoplasmic OS=Bos taurus GN=MARS PE=2 SV=1 48 558 1.0E-24
sp|Q9ZTS1|SYM_ORYSJ Probable methionine--tRNA ligase OS=Oryza sativa subsp. japonica GN=Os06g0508700 PE=2 SV=2 55 560 1.0E-24
sp|A6KYR3|SYM_BACV8 Methionine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=metG PE=3 SV=1 55 574 1.0E-24
sp|B0RWA1|SYM_XANCB Methionine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=metG PE=3 SV=1 55 553 2.0E-24
sp|Q87N07|SYM_VIBPA Methionine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metG PE=3 SV=2 55 552 2.0E-24
sp|Q8ZU56|SYM_PYRAE Methionine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=metG PE=3 SV=1 61 560 2.0E-24
sp|Q8PAY7|SYM_XANCP Methionine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=metG PE=3 SV=1 55 553 2.0E-24
sp|Q4USM5|SYM_XANC8 Methionine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=metG PE=3 SV=1 55 553 2.0E-24
sp|Q7MM14|SYM_VIBVY Methionine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=metG PE=3 SV=1 55 552 2.0E-24
sp|Q7URP3|SYM_RHOBA Methionine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=metG PE=3 SV=1 55 559 2.0E-24
sp|Q8D8F2|SYM_VIBVU Methionine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=metG PE=3 SV=2 55 552 3.0E-24
sp|Q5L7I8|SYM_BACFN Methionine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=metG PE=3 SV=1 55 575 3.0E-24
sp|B7NCE4|SYM_ECOLU Methionine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=metG PE=3 SV=1 51 548 3.0E-24
sp|Q64MP7|SYM_BACFR Methionine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=metG PE=3 SV=2 55 575 3.0E-24
sp|Q32EI8|SYM_SHIDS Methionine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metG PE=3 SV=1 51 548 3.0E-24
sp|P00959|SYM_ECOLI Methionine--tRNA ligase OS=Escherichia coli (strain K12) GN=metG PE=1 SV=2 51 548 3.0E-24
sp|B1X7K4|SYM_ECODH Methionine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=metG PE=3 SV=1 51 548 3.0E-24
sp|C4ZSJ8|SYM_ECOBW Methionine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=metG PE=3 SV=1 51 548 3.0E-24
sp|Q3Z096|SYM_SHISS Methionine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=metG PE=3 SV=1 51 548 3.0E-24
sp|Q0TFX8|SYM_ECOL5 Methionine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metG PE=3 SV=2 51 548 4.0E-24
sp|Q83KH0|SYM_SHIFL Methionine--tRNA ligase OS=Shigella flexneri GN=metG PE=3 SV=4 51 548 4.0E-24
sp|Q0T324|SYM_SHIF8 Methionine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=metG PE=3 SV=1 51 548 4.0E-24
sp|B2TVX7|SYM_SHIB3 Methionine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=metG PE=3 SV=1 51 548 4.0E-24
sp|B7LV75|SYM_ESCF3 Methionine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=metG PE=3 SV=1 51 548 4.0E-24
sp|B1LN54|SYM_ECOSM Methionine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=metG PE=3 SV=1 51 548 4.0E-24
sp|B6HYV5|SYM_ECOSE Methionine--tRNA ligase OS=Escherichia coli (strain SE11) GN=metG PE=3 SV=1 51 548 4.0E-24
sp|B7M4V9|SYM_ECO8A Methionine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=metG PE=3 SV=1 51 548 4.0E-24
sp|B7NPL8|SYM_ECO7I Methionine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=metG PE=3 SV=1 51 548 4.0E-24
sp|B7L9Y6|SYM_ECO55 Methionine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=metG PE=3 SV=1 51 548 4.0E-24
sp|A7ZNT3|SYM_ECO24 Methionine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=metG PE=3 SV=1 51 548 4.0E-24
sp|Q20970|SYMC_CAEEL Methionine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=mrs-1 PE=3 SV=1 55 650 4.0E-24
sp|Q7MXK7|SYM_PORGI Methionine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=metG PE=3 SV=1 55 558 4.0E-24
sp|Q1R9V8|SYM_ECOUT Methionine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=metG PE=3 SV=2 51 548 5.0E-24
sp|B1IYW7|SYM_ECOLC Methionine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=metG PE=3 SV=1 51 548 5.0E-24
sp|Q8FFX8|SYM_ECOL6 Methionine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metG PE=3 SV=3 51 548 5.0E-24
sp|A1ACX8|SYM_ECOK1 Methionine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=metG PE=3 SV=2 51 548 5.0E-24
sp|A8A1X8|SYM_ECOHS Methionine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=metG PE=3 SV=1 51 548 5.0E-24
sp|B7MEG9|SYM_ECO45 Methionine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=metG PE=3 SV=1 51 548 5.0E-24
sp|Q68FL6|SYMC_MOUSE Methionine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Mars PE=1 SV=1 55 558 5.0E-24
sp|B5YV64|SYM_ECO5E Methionine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=metG PE=3 SV=1 51 548 5.0E-24
sp|Q8X7E7|SYM_ECO57 Methionine--tRNA ligase OS=Escherichia coli O157:H7 GN=metG PE=3 SV=3 51 548 5.0E-24
sp|A6LFP0|SYM_PARD8 Methionine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=metG PE=3 SV=1 55 548 5.0E-24
sp|B7MX36|SYM_ECO81 Methionine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=metG PE=3 SV=1 51 548 6.0E-24
sp|B7UFD1|SYM_ECO27 Methionine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=metG PE=3 SV=1 51 548 6.0E-24
sp|Q3AQR4|SYM_CHLCH Methionine--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=metG PE=3 SV=1 55 562 6.0E-24
sp|A6TBK7|SYM_KLEP7 Methionine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=metG PE=3 SV=1 51 552 6.0E-24
sp|B6EIY5|SYM_ALISL Methionine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=metG PE=3 SV=1 48 552 6.0E-24
sp|A8GC37|SYM_SERP5 Methionine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=metG PE=3 SV=1 51 549 6.0E-24
sp|B5XP89|SYM_KLEP3 Methionine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=metG PE=3 SV=1 51 552 7.0E-24
sp|A9R2M7|SYM_YERPG Methionine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=metG PE=3 SV=1 51 549 7.0E-24
sp|B2JZK3|SYM_YERPB Methionine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=metG PE=3 SV=1 51 549 7.0E-24
sp|A4TKM9|SYM_YERPP Methionine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=metG PE=3 SV=1 51 549 7.0E-24
sp|Q1CGU4|SYM_YERPN Methionine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metG PE=3 SV=1 51 549 7.0E-24
sp|Q8ZG01|SYM_YERPE Methionine--tRNA ligase OS=Yersinia pestis GN=metG PE=3 SV=1 51 549 7.0E-24
sp|Q1C9T8|SYM_YERPA Methionine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metG PE=3 SV=1 51 549 7.0E-24
sp|A7FJJ6|SYM_YERP3 Methionine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=metG PE=3 SV=1 51 549 7.0E-24
sp|Q65S22|SYM_MANSM Methionine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metG PE=3 SV=1 55 551 7.0E-24
sp|B1JPY8|SYM_YERPY Methionine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=metG PE=3 SV=1 51 549 8.0E-24
sp|A4G3S6|SYM_HERAR Methionine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=metG PE=3 SV=1 54 670 9.0E-24
sp|Q6PF21|SYMC_XENLA Methionine--tRNA ligase, cytoplasmic OS=Xenopus laevis GN=mars PE=2 SV=1 50 567 1.0E-23
sp|A0KKF6|SYM_AERHH Methionine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=metG PE=3 SV=1 48 551 1.0E-23
sp|Q323B4|SYM_SHIBS Methionine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=metG PE=3 SV=1 51 548 1.0E-23
sp|Q8SQW5|SYMC_ENCCU Probable methionine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_0890 PE=3 SV=1 54 576 2.0E-23
sp|A1RXT9|SYM_THEPD Methionine--tRNA ligase OS=Thermofilum pendens (strain Hrk 5) GN=metG PE=3 SV=1 61 579 2.0E-23
sp|P57838|SYM_PASMU Methionine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=metG PE=3 SV=1 55 548 2.0E-23
sp|B1YAZ7|SYM_PYRNV Methionine--tRNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=metG PE=3 SV=1 53 562 2.0E-23
sp|P43828|SYM_HAEIN Methionine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metG PE=3 SV=1 55 551 2.0E-23
sp|A5UF42|SYM_HAEIG Methionine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=metG PE=3 SV=1 55 551 2.0E-23
sp|Q2S2A3|SYM_SALRD Methionine--tRNA ligase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=metG PE=3 SV=1 55 567 2.0E-23
sp|Q66C72|SYM_YERPS Methionine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metG PE=3 SV=1 51 549 2.0E-23
sp|A1AWL4|SYM_RUTMC Methionine--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=metG PE=3 SV=1 49 551 2.0E-23
sp|A1KR57|SYM_NEIMF Methionine--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=metG PE=3 SV=1 55 553 3.0E-23
sp|A1VKF9|SYM_POLNA Methionine--tRNA ligase OS=Polaromonas naphthalenivorans (strain CJ2) GN=metG PE=3 SV=1 54 554 3.0E-23
sp|A0Q556|SYM_FRATN Methionine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=metG PE=3 SV=2 55 561 3.0E-23
sp|Q3IL10|SYM_PSEHT Methionine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=metG PE=3 SV=1 55 554 3.0E-23
sp|Q0AES9|SYM_NITEC Methionine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=metG PE=3 SV=1 55 554 4.0E-23
sp|Q660T5|SYM_BORBP Methionine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=metG PE=3 SV=1 55 559 4.0E-23
sp|A9FBU8|SYM1_SORC5 Methionine--tRNA ligase 1 OS=Sorangium cellulosum (strain So ce56) GN=metG1 PE=3 SV=1 51 591 5.0E-23
sp|A8ABN0|SYM_IGNH4 Methionine--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=metG PE=3 SV=1 61 559 6.0E-23
sp|P56192|SYMC_HUMAN Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=MARS PE=1 SV=2 48 558 7.0E-23
sp|Q474X7|SYM_CUPPJ Methionine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=metG PE=3 SV=1 55 554 7.0E-23
sp|Q2KYS4|SYM_BORA1 Methionine--tRNA ligase OS=Bordetella avium (strain 197N) GN=metG PE=3 SV=1 54 563 9.0E-23
sp|Q7VRX4|SYM_BLOFL Methionine--tRNA ligase OS=Blochmannia floridanus GN=metG PE=3 SV=1 50 548 1.0E-22
sp|A4XS54|SYM_PSEMY Methionine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=metG PE=3 SV=1 55 561 1.0E-22
sp|Q5F585|SYM_NEIG1 Methionine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=metG PE=3 SV=1 55 567 1.0E-22
sp|Q4QJZ5|SYM_HAEI8 Methionine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=metG PE=3 SV=1 55 551 1.0E-22
sp|B3R678|SYM_CUPTR Methionine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=metG PE=3 SV=1 55 560 2.0E-22
sp|A9LZS9|SYM_NEIM0 Methionine--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=metG PE=3 SV=2 55 553 3.0E-22
sp|Q54X95|SYMC_DICDI Probable methionine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=metS PE=3 SV=1 55 569 3.0E-22
sp|A1SVA5|SYM_PSYIN Methionine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=metG PE=3 SV=1 55 563 3.0E-22
sp|A3PLG8|SYM_RHOS1 Methionine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=metG PE=3 SV=1 55 560 3.0E-22
sp|Q82F60|SYM_STRAW Methionine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=metG PE=3 SV=1 53 611 3.0E-22
sp|Q8XWT9|SYM_RALSO Methionine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=metG PE=3 SV=1 55 554 3.0E-22
sp|B1J1D1|SYM_PSEPW Methionine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=metG PE=3 SV=1 55 553 3.0E-22
sp|A1KAG3|SYM_AZOSB Methionine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=metG PE=3 SV=1 55 554 3.0E-22
sp|A5UBS8|SYM_HAEIE Methionine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=metG PE=3 SV=1 55 551 3.0E-22
sp|Q5WST1|SYM_LEGPL Methionine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=metG PE=3 SV=1 49 551 4.0E-22
sp|Q0C161|SYM_HYPNA Methionine--tRNA ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=metG PE=3 SV=1 55 567 4.0E-22
sp|Q9JWP0|SYM_NEIMA Methionine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=metG PE=3 SV=1 55 553 4.0E-22
sp|A1TTU1|SYM_ACIAC Methionine--tRNA ligase OS=Acidovorax citrulli (strain AAC00-1) GN=metG PE=3 SV=1 54 561 4.0E-22
sp|Q9K1Q0|SYM_NEIMB Methionine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=metG PE=3 SV=1 55 553 5.0E-22
sp|Q1LJN4|SYM_CUPMC Methionine--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=metG PE=3 SV=1 55 560 5.0E-22
sp|Q0K7K0|SYM_CUPNH Methionine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=metG PE=3 SV=1 55 560 5.0E-22
sp|Q6MDG0|SYM_PARUW Methionine--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=metG PE=3 SV=1 55 561 5.0E-22
sp|B9KKH3|SYM_RHOSK Methionine--tRNA ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=metG PE=3 SV=1 55 560 5.0E-22
sp|Q82WP0|SYM_NITEU Methionine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=metG PE=3 SV=1 55 560 6.0E-22
sp|A5II55|SYM_LEGPC Methionine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=metG PE=3 SV=1 49 551 6.0E-22
sp|A8ZQ66|SYM1_ACAM1 Methionine--tRNA ligase 1 OS=Acaryochloris marina (strain MBIC 11017) GN=metG1 PE=3 SV=1 53 616 7.0E-22
sp|Q0SMS1|SYM_BORAP Methionine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=metG PE=3 SV=1 55 572 8.0E-22
sp|Q3J0T3|SYM_RHOS4 Methionine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=metG PE=3 SV=1 55 560 1.0E-21
sp|Q5X105|SYM_LEGPA Methionine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=metG PE=3 SV=1 49 551 2.0E-21
sp|Q5ZRJ9|SYM_LEGPH Methionine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=metG PE=3 SV=2 49 551 2.0E-21
sp|Q48LT7|SYM_PSE14 Methionine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metG PE=3 SV=1 55 567 2.0E-21
sp|Q2SKU2|SYM_HAHCH Methionine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=metG PE=3 SV=1 55 552 2.0E-21
sp|A6V1U3|SYM_PSEA7 Methionine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=metG PE=3 SV=1 55 552 4.0E-21
sp|B1JWS3|SYM_BURCC Methionine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=metG PE=3 SV=1 55 560 4.0E-21
sp|Q480H5|SYM_COLP3 Methionine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=metG PE=3 SV=1 44 551 4.0E-21
sp|Q2Y7P0|SYM_NITMU Methionine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=metG PE=3 SV=1 55 560 5.0E-21
sp|Q02QX1|SYM_PSEAB Methionine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metG PE=3 SV=1 55 552 6.0E-21
sp|B7UWJ8|SYM_PSEA8 Methionine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=metG PE=3 SV=1 55 552 6.0E-21
sp|Q0BCT3|SYM_BURCM Methionine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metG PE=3 SV=1 55 560 6.0E-21
sp|Q9HYC7|SYM_PSEAE Methionine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metG PE=3 SV=1 55 552 6.0E-21
sp|Q5LTL1|SYM_RUEPO Methionine--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=metG PE=3 SV=1 55 570 7.0E-21
sp|B1YUT2|SYM_BURA4 Methionine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=metG PE=3 SV=1 55 560 7.0E-21
sp|A5CWL9|SYM_VESOH Methionine--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=metG PE=3 SV=1 49 558 7.0E-21
sp|Q0VP51|SYM_ALCBS Methionine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=metG PE=3 SV=1 47 551 8.0E-21
sp|Q88NV7|SYM_PSEPK Methionine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=metG PE=3 SV=1 55 560 8.0E-21
sp|A4WV24|SYM_RHOS5 Methionine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=metG PE=3 SV=1 55 560 1.0E-20
sp|A5VZI8|SYM_PSEP1 Methionine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=metG PE=3 SV=2 55 560 1.0E-20
sp|B0KUD8|SYM_PSEPG Methionine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=metG PE=3 SV=1 55 560 2.0E-20
sp|Q7NYR7|SYM_CHRVO Methionine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=metG PE=3 SV=1 49 554 2.0E-20
sp|A0K9L0|SYM_BURCH Methionine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=metG PE=3 SV=1 55 560 2.0E-20
sp|Q1BUH6|SYM_BURCA Methionine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=metG PE=3 SV=2 55 560 2.0E-20
sp|Q1IDZ3|SYM_PSEE4 Methionine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=metG PE=3 SV=1 55 553 2.0E-20
sp|Q3K7L0|SYM_PSEPF Methionine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=metG PE=3 SV=1 55 560 3.0E-20
sp|A8MA54|SYM_CALMQ Methionine--tRNA ligase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=metG PE=3 SV=1 61 591 3.0E-20
sp|Q4K758|SYM_PSEF5 Methionine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metG PE=3 SV=1 55 553 3.0E-20
sp|Q39DV4|SYM_BURL3 Methionine--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metG PE=3 SV=1 44 560 4.0E-20
sp|C1DEF4|SYM_AZOVD Methionine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=metG PE=3 SV=1 55 552 4.0E-20
sp|Q87XN0|SYM_PSESM Methionine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metG PE=3 SV=1 55 560 5.0E-20
sp|Q143I7|SYM_BURXL Methionine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=metG PE=3 SV=1 55 561 5.0E-20
sp|B4E8E0|SYM_BURCJ Methionine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=metG PE=3 SV=1 55 560 6.0E-20
sp|C3KBZ7|SYM_PSEFS Methionine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=metG PE=3 SV=1 55 553 9.0E-20
sp|Q9ZHD7|SYM_BUCAP Methionine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=metG PE=3 SV=2 51 551 1.0E-19
sp|A1WRC4|SYM_VEREI Methionine--tRNA ligase OS=Verminephrobacter eiseniae (strain EF01-2) GN=metG PE=3 SV=1 54 564 1.0E-19
sp|Q15UM1|SYM_PSEA6 Methionine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=metG PE=3 SV=1 47 551 1.0E-19
sp|Q6FE36|SYM_ACIAD Methionine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metG PE=3 SV=1 55 554 4.0E-19
sp|A9AHJ8|SYM_BURM1 Methionine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=metG PE=3 SV=1 55 560 4.0E-19
sp|Q4ZPK6|SYM_PSEU2 Methionine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metG PE=3 SV=1 55 567 4.0E-19
sp|A5WG58|SYM_PSYWF Methionine--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=metG PE=3 SV=1 55 548 6.0E-19
sp|C4V943|SYMC_NOSCE Probable methionine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_101052 PE=3 SV=2 55 427 6.0E-19
sp|Q5P239|SYM_AROAE Methionine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=metG PE=3 SV=1 55 554 1.0E-18
sp|Q73NT9|SYM_TREDE Methionine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=metG PE=3 SV=1 55 561 1.0E-18
sp|A4WKG3|SYM_PYRAR Methionine--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=metG PE=3 SV=1 53 560 1.0E-18
sp|A4JGW6|SYM_BURVG Methionine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=metG PE=3 SV=1 55 560 2.0E-18
sp|A4VJ05|SYM_PSEU5 Methionine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=metG PE=3 SV=2 55 388 2.0E-18
sp|Q1GEI7|SYM_RUEST Methionine--tRNA ligase OS=Ruegeria sp. (strain TM1040) GN=metG PE=3 SV=2 55 564 2.0E-18
sp|P00958|SYMC_YEAST Methionine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MES1 PE=1 SV=4 55 565 3.0E-18
sp|A8LIJ9|SYM_DINSH Methionine--tRNA ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=metG PE=3 SV=1 55 555 3.0E-18
sp|Q21I21|SYM_SACD2 Methionine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=metG PE=3 SV=1 55 561 7.0E-18
sp|Q166L9|SYM_ROSDO Methionine--tRNA ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=metG PE=3 SV=1 53 559 2.0E-17
sp|Q63W90|SYM_BURPS Methionine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=metG PE=3 SV=1 55 560 3.0E-17
sp|A3NSL6|SYM_BURP0 Methionine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=metG PE=3 SV=1 55 560 3.0E-17
sp|A1V5W0|SYM_BURMS Methionine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=metG PE=3 SV=2 55 560 3.0E-17
sp|Q62LE0|SYM_BURMA Methionine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=metG PE=3 SV=1 55 560 3.0E-17
sp|A2SAF7|SYM_BURM9 Methionine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=metG PE=3 SV=2 55 560 3.0E-17
sp|A3MLM5|SYM_BURM7 Methionine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=metG PE=3 SV=2 55 560 3.0E-17
sp|A3N6Y1|SYM_BURP6 Methionine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=metG PE=3 SV=2 55 560 3.0E-17
sp|Q3JUY1|SYM_BURP1 Methionine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=metG PE=3 SV=1 55 560 4.0E-17
sp|Q4FRS8|SYM_PSYA2 Methionine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=metG PE=3 SV=1 55 560 8.0E-17
sp|Q1QAD0|SYM_PSYCK Methionine--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=metG PE=3 SV=1 55 560 8.0E-17
sp|Q28MK0|SYM_JANSC Methionine--tRNA ligase OS=Jannaschia sp. (strain CCS1) GN=metG PE=3 SV=1 55 551 1.0E-16
sp|Q2T087|SYM_BURTA Methionine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=metG PE=3 SV=2 55 560 5.0E-16
sp|A1B3P3|SYM_PARDP Methionine--tRNA ligase OS=Paracoccus denitrificans (strain Pd 1222) GN=metG PE=3 SV=1 53 555 2.0E-15
sp|Q9UUF2|SYMC_SCHPO Probable methionine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rar1 PE=3 SV=1 55 558 3.0E-15
sp|B0T3J0|SYM_CAUSK Methionine--tRNA ligase OS=Caulobacter sp. (strain K31) GN=metG PE=3 SV=1 55 554 2.0E-13
sp|B5YID4|SYC_THEYD Cysteine--tRNA ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=cysS PE=3 SV=1 343 510 1.0E-09
sp|Q3ITY7|SYI_NATPD Isoleucine--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ileS PE=3 SV=1 288 402 4.0E-09
sp|Q9HN72|SYL_HALSA Leucine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=leuS PE=3 SV=1 50 256 5.0E-08
sp|Q5KWL3|SYV_GEOKA Valine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=valS PE=3 SV=1 316 432 2.0E-07
sp|P11931|SYV_GEOSE Valine--tRNA ligase OS=Geobacillus stearothermophilus GN=valS PE=1 SV=1 316 432 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0000166 nucleotide binding Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0005488 binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0008152 metabolic process No
GO:0016874 ligase activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0046483 heterocycle metabolic process No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0006399 tRNA metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0043039 tRNA aminoacylation No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0043038 amino acid activation No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006520 cellular amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8278
MKPSSRHVLPWTLFAPGGRRLVAQRRCPARLDRPPASLGQCRWSSASATDKPYYVTTPIFYVNDSPHLGHLYTMV
LADAFKRWQQINGRRAFLCTGTDEHGMKIQQAAARQDMPPRAFCDLYSGRFRDLTAAANVGHDLFMRTTDEDHRE
VVQGLWRQLKKSLPEGRGLYKGVHKGWYCVSDECFYPESVIEASIVPQTGHKILINTETGNQVEWVEEETWFFPL
TKYKDDLLKFYNENPEWITPAFRMVEVRNWVENQLEDLSVTRPASRLSWGISDPDDANITIYVWVDALFNYLTNA
GYGSRWHSPKEDTGLWPPDLQIIGKDILRFHGVYWPALLLALGLPLPKRILCHSHWTLANRKMSKSLGNVVNPFT
AMQRWDTDPLRYFLMQNGSLGKDMSYSNPLVGASYAKHLQANYGNLVLRIARAKVANAWSTQEAVAAFRRDGFRD
FIALHKDDASMACYFGHDALLNRVRADFSKAMQNCSTSAAVAVMFEFLRETNRYVTDAKPWDLVKNTDEQGRTLL
NWVVFNAGEAVRIASILLQPFMPTKASDVLDELGVRQDRRTVEYAEMGKDVDYGTPSRVKLSEGRPKIWGTVFPP
VPDAEDSDEEVMEQLKTMLWPKTKNKMNQRVELLAMEARMGEEAVAKLLSDAAEAAGMDGAHRTDKTTGKDGTTQ
RSGESIRVALEGRGA*
Coding >Hirsu2|8278
ATGAAGCCGTCATCGCGCCACGTCCTTCCATGGACGCTGTTCGCTCCGGGCGGCCGGCGCCTTGTCGCGCAACGC
CGTTGTCCCGCGCGCCTGGACCGACCGCCGGCCTCCCTTGGCCAGTGTCGTTGGAGCTCCGCCTCGGCGACGGAC
AAGCCGTACTACGTCACAACCCCCATCTTCTACGTCAATGACTCTCCGCATCTCGGCCACCTGTATACCATGGTC
CTGGCCGACGCCTTCAAGCGATGGCAGCAGATCAACGGCCGGCGCGCCTTTCTCTGCACCGGCACCGACGAGCAC
GGCATGAAGATCCAGCAAGCGGCGGCAAGGCAAGACATGCCCCCGAGGGCGTTTTGCGACCTCTATTCCGGCCGG
TTCAGAGACTTGACCGCCGCAGCCAACGTCGGGCACGACCTTTTCATGCGCACGACCGACGAGGACCACCGAGAG
GTCGTGCAGGGCCTCTGGCGACAGCTCAAAAAGAGCCTCCCGGAAGGGCGCGGGCTCTACAAGGGCGTCCACAAG
GGCTGGTACTGCGTTAGCGACGAGTGCTTCTACCCCGAGTCCGTCATCGAGGCCAGCATCGTGCCGCAGACGGGC
CACAAGATTCTCATCAACACCGAGACGGGGAATCAGGTCGAATGGGTCGAAGAGGAGACCTGGTTCTTTCCGCTG
ACCAAGTACAAAGACGACCTGCTCAAGTTCTACAATGAGAACCCGGAATGGATCACGCCCGCCTTCCGGATGGTC
GAGGTGCGCAACTGGGTGGAGAACCAGCTCGAAGACCTCTCCGTCACGCGCCCGGCCTCGCGCCTCAGCTGGGGC
ATCTCGGACCCGGACGACGCCAACATCACCATCTACGTCTGGGTAGACGCCCTCTTCAACTACCTCACCAACGCC
GGCTACGGCTCCCGGTGGCATTCGCCCAAGGAGGACACGGGCCTGTGGCCGCCCGACCTGCAGATCATCGGCAAG
GACATTCTCCGATTCCACGGCGTCTACTGGCCGGCCCTCCTCCTGGCCCTGGGACTTCCCCTGCCAAAGAGGATC
CTCTGTCACAGCCACTGGACGCTGGCGAACCGCAAGATGTCCAAGTCTCTCGGCAACGTCGTCAATCCCTTCACG
GCCATGCAGCGCTGGGATACCGACCCGTTGCGCTACTTTCTCATGCAAAACGGCAGCCTCGGCAAGGACATGAGC
TACTCGAACCCGCTGGTCGGGGCCAGCTACGCCAAGCATCTCCAGGCCAACTACGGCAACTTGGTCCTCCGAATT
GCCAGGGCGAAAGTGGCCAACGCCTGGTCGACACAAGAGGCTGTTGCCGCGTTCCGTCGCGACGGCTTCCGCGAC
TTCATCGCGTTGCACAAGGATGACGCCTCCATGGCTTGCTACTTCGGCCACGATGCCCTTCTTAATAGGGTCAGG
GCCGACTTTAGCAAAGCCATGCAAAACTGCTCCACGTCAGCCGCCGTGGCAGTCATGTTCGAGTTTCTGAGAGAG
ACGAACCGGTATGTGACGGACGCGAAGCCGTGGGATCTCGTGAAGAACACGGACGAACAAGGCCGCACGCTGCTC
AACTGGGTCGTCTTCAACGCCGGCGAGGCGGTGCGAATCGCGAGCATCCTGCTGCAGCCGTTCATGCCGACAAAG
GCCAGCGACGTCCTCGACGAGCTCGGGGTCCGGCAGGACAGGCGGACAGTCGAGTACGCGGAGATGGGCAAAGAC
GTCGACTACGGAACGCCGAGCCGGGTCAAGCTCTCTGAGGGCAGGCCCAAGATATGGGGCACGGTATTCCCGCCG
GTGCCGGACGCCGAAGACTCGGACGAGGAGGTGATGGAGCAGCTGAAGACAATGCTCTGGCCCAAGACGAAGAAC
AAGATGAATCAGAGGGTCGAGCTGCTGGCCATGGAGGCGCGCATGGGCGAGGAGGCCGTGGCGAAGCTGCTGTCG
GACGCGGCTGAGGCAGCCGGGATGGACGGGGCGCACAGGACGGACAAGACGACCGGGAAGGACGGGACGACCCAG
AGATCAGGGGAGTCAATCAGGGTGGCTTTGGAAGGACGAGGCGCGTGA
Transcript >Hirsu2|8278
ATGAAGCCGTCATCGCGCCACGTCCTTCCATGGACGCTGTTCGCTCCGGGCGGCCGGCGCCTTGTCGCGCAACGC
CGTTGTCCCGCGCGCCTGGACCGACCGCCGGCCTCCCTTGGCCAGTGTCGTTGGAGCTCCGCCTCGGCGACGGAC
AAGCCGTACTACGTCACAACCCCCATCTTCTACGTCAATGACTCTCCGCATCTCGGCCACCTGTATACCATGGTC
CTGGCCGACGCCTTCAAGCGATGGCAGCAGATCAACGGCCGGCGCGCCTTTCTCTGCACCGGCACCGACGAGCAC
GGCATGAAGATCCAGCAAGCGGCGGCAAGGCAAGACATGCCCCCGAGGGCGTTTTGCGACCTCTATTCCGGCCGG
TTCAGAGACTTGACCGCCGCAGCCAACGTCGGGCACGACCTTTTCATGCGCACGACCGACGAGGACCACCGAGAG
GTCGTGCAGGGCCTCTGGCGACAGCTCAAAAAGAGCCTCCCGGAAGGGCGCGGGCTCTACAAGGGCGTCCACAAG
GGCTGGTACTGCGTTAGCGACGAGTGCTTCTACCCCGAGTCCGTCATCGAGGCCAGCATCGTGCCGCAGACGGGC
CACAAGATTCTCATCAACACCGAGACGGGGAATCAGGTCGAATGGGTCGAAGAGGAGACCTGGTTCTTTCCGCTG
ACCAAGTACAAAGACGACCTGCTCAAGTTCTACAATGAGAACCCGGAATGGATCACGCCCGCCTTCCGGATGGTC
GAGGTGCGCAACTGGGTGGAGAACCAGCTCGAAGACCTCTCCGTCACGCGCCCGGCCTCGCGCCTCAGCTGGGGC
ATCTCGGACCCGGACGACGCCAACATCACCATCTACGTCTGGGTAGACGCCCTCTTCAACTACCTCACCAACGCC
GGCTACGGCTCCCGGTGGCATTCGCCCAAGGAGGACACGGGCCTGTGGCCGCCCGACCTGCAGATCATCGGCAAG
GACATTCTCCGATTCCACGGCGTCTACTGGCCGGCCCTCCTCCTGGCCCTGGGACTTCCCCTGCCAAAGAGGATC
CTCTGTCACAGCCACTGGACGCTGGCGAACCGCAAGATGTCCAAGTCTCTCGGCAACGTCGTCAATCCCTTCACG
GCCATGCAGCGCTGGGATACCGACCCGTTGCGCTACTTTCTCATGCAAAACGGCAGCCTCGGCAAGGACATGAGC
TACTCGAACCCGCTGGTCGGGGCCAGCTACGCCAAGCATCTCCAGGCCAACTACGGCAACTTGGTCCTCCGAATT
GCCAGGGCGAAAGTGGCCAACGCCTGGTCGACACAAGAGGCTGTTGCCGCGTTCCGTCGCGACGGCTTCCGCGAC
TTCATCGCGTTGCACAAGGATGACGCCTCCATGGCTTGCTACTTCGGCCACGATGCCCTTCTTAATAGGGTCAGG
GCCGACTTTAGCAAAGCCATGCAAAACTGCTCCACGTCAGCCGCCGTGGCAGTCATGTTCGAGTTTCTGAGAGAG
ACGAACCGGTATGTGACGGACGCGAAGCCGTGGGATCTCGTGAAGAACACGGACGAACAAGGCCGCACGCTGCTC
AACTGGGTCGTCTTCAACGCCGGCGAGGCGGTGCGAATCGCGAGCATCCTGCTGCAGCCGTTCATGCCGACAAAG
GCCAGCGACGTCCTCGACGAGCTCGGGGTCCGGCAGGACAGGCGGACAGTCGAGTACGCGGAGATGGGCAAAGAC
GTCGACTACGGAACGCCGAGCCGGGTCAAGCTCTCTGAGGGCAGGCCCAAGATATGGGGCACGGTATTCCCGCCG
GTGCCGGACGCCGAAGACTCGGACGAGGAGGTGATGGAGCAGCTGAAGACAATGCTCTGGCCCAAGACGAAGAAC
AAGATGAATCAGAGGGTCGAGCTGCTGGCCATGGAGGCGCGCATGGGCGAGGAGGCCGTGGCGAAGCTGCTGTCG
GACGCGGCTGAGGCAGCCGGGATGGACGGGGCGCACAGGACGGACAAGACGACCGGGAAGGACGGGACGACCCAG
AGATCAGGGGAGTCAATCAGGGTGGCTTTGGAAGGACGAGGCGCGTGA
Gene >Hirsu2|8278
ATGAAGCCGTCATCGCGCCACGTCCTTCCATGGACGCTGTTCGCTCCGGGCGGCCGGCGCCTTGTCGCGCAACGC
CGTTGTCCCGCGCGCCTGGACCGACCGCCGGCCTCCCTTGGCCAGTGTCGTTGGAGCTCCGCCTCGGCGACGGAC
AAGCCGTACTACGTCACAACCCCCATCTTCTACGTCAATGACTGTAGGGCACTCCGAAGCATGCAGCCGACCGCT
CGCCCGCTCACTGAACCTGCCCGTCACCAGCTCCGCATCTCGGCCACCTGTATACCATGGTCCTGGCCGACGCCT
TCAAGCGATGGCAGCAGATCAACGGCCGGCGCGCCTTTCTCTGCACCGGCACCGACGAGCACGGCATGAAGATCC
AGCAAGCGGCGGCAAGGCAAGACATGCCCCCGAGGGCGTTTTGCGACCTCTATTCCGGCCGGTTCAGAGACTTGA
CCGCCGCAGCCAACGTCGGGCACGACCTTTTCATGCGCACGACCGACGAGGACCACCGAGAGGTCGTGCAGGGCC
TCTGGCGACAGCTCAAAAAGAGCCTCCCGGAAGGGCGCGGGCTCTACAAGGGCGTCCACAAGGGCTGGTACTGCG
TTAGCGACGAGTGCTTCTACCCCGAGTCCGTCATCGAGGCCAGCATCGTGCCGCAGACGGGCCACAAGATTCTCA
TCAACACCGAGACGGGGAATCAGGTCGAATGGGTCGAAGAGGAGACCTGGTTCTTTCCGCTGACCAAGTACAAAG
ACGACCTGCTCAAGTTCTACAATGAGAACCCGGAATGGATCACGCCCGCCTTCCGGATGGTCGAGGTGCGCAACT
GGGTGGAGAACCAGCTCGAAGACCTCTCCGTCACGCGCCCGGCCTCGCGCCTCAGCTGGGGCATCTCGGACCCGG
ACGACGCCAACATCACCATCTACGTCTGGGTAGACGCCCTCTTCAACTACCTCACCAACGCCGGCTACGGCTCCC
GGTGGCATTCGCCCAAGGAGGACACGGGCCTGTGGCCGCCCGACCTGCAGATCATCGGCAAGGACATTCTCCGAT
TCCACGGCGTCTACTGGCCGGCCCTCCTCCTGGCCCTGGGACTTCCCCTGCCAAAGAGGATCCTCTGTCACAGCC
ACTGGACGCTGGCGAACCGCAAGATGTCCAAGTCTCTCGGCAACGTCGTCAATCCCTTCACGGCCATGCAGCGCT
GGGATACCGACCCGTTGCGCTACTTTCTCATGCAAAACGGCAGCCTCGGCAAGGACATGAGCTACTCGAACCCGC
TGGTCGGGGCCAGCTACGCCAAGCATCTCCAGGCCAACTACGGCAACTTGGTCCTCCGAATTGCCAGGGCGAAAG
TGGCCAACGCCTGGTCGACACAAGAGGCTGTTGCCGCGTTCCGTCGCGACGGCTTCCGCGACTTCATCGCGTTGC
ACAAGGATGACGCCTCCATGGCTTGCTACTTCGGCCACGATGCCCTTCTTAATAGGGTCAGGGCCGACTTTAGCA
AAGCCATGCAAAACTGCTCCACGTCAGCCGCCGTGGCAGTCATGTTCGAGTTTCTGAGAGAGGCAAGTCGTGAAA
CGCTGCTATGATGTTTGCAAGACTAACAAACACCCTTTTTACTCGCCGACAGACGAACCGGTATGTGACGGACGC
GAAGCCGTGGGATCTCGTGAAGAACACGGACGAACAAGGCCGCACGCTGCTCAACTGGGTCGTCTTCAACGCCGG
CGAGGCGGTGCGAATCGCGAGCATCCTGCTGCAGCCGTTCATGCCGACAAAGGCCAGCGACGTCCTCGACGAGCT
CGGGGTCCGGCAGGACAGGCGGACAGTCGAGTACGCGGAGATGGGCAAAGACGTCGACTACGGAACGCCGAGCCG
GGTCAAGCTCTCTGAGGGCAGGCCCAAGATATGGGGCACGGTATTCCCGCCGGTGCCGGACGCCGAAGACTCGGA
CGAGGAGGTGATGGAGCAGCTGAAGACAATGCTCTGGCCCAAGACGAAGAACAAGATGAATCAGAGGGTCGAGCT
GCTGGCCATGGAGGCGCGCATGGGCGAGGAGGCCGTGGCGAAGCTGCTGTCGGACGCGGCTGAGGCAGCCGGGAT
GGACGGGGCGCACAGGACGGACAAGACGACCGGGAAGGACGGGACGACCCAGAGATCAGGGGAGTCAATCAGGGT
GGCTTTGGAAGGACGAGGCGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail