Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8277
Gene name
LocationContig_53:4648..5487
Strand-
Gene length (bp)839
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain 6.5E-24 14 190

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9BKR0|NAT9_CAEEL N-acetyltransferase 9-like protein OS=Caenorhabditis elegans GN=Y67D2.5 PE=3 SV=2 1 205 6.0E-41
sp|A7SLC8|NAT9_NEMVE N-acetyltransferase 9-like protein OS=Nematostella vectensis GN=nat9 PE=3 SV=1 1 205 7.0E-35
sp|Q9USR6|NAT9_SCHPO N-acetyltransferase 9-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC577.03c PE=3 SV=1 1 205 9.0E-35
sp|Q3UG98|NAT9_MOUSE N-acetyltransferase 9 OS=Mus musculus GN=Nat9 PE=1 SV=2 1 206 1.0E-34
sp|Q9BTE0|NAT9_HUMAN N-acetyltransferase 9 OS=Homo sapiens GN=NAT9 PE=1 SV=1 1 232 4.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9BKR0|NAT9_CAEEL N-acetyltransferase 9-like protein OS=Caenorhabditis elegans GN=Y67D2.5 PE=3 SV=2 1 205 6.0E-41
sp|A7SLC8|NAT9_NEMVE N-acetyltransferase 9-like protein OS=Nematostella vectensis GN=nat9 PE=3 SV=1 1 205 7.0E-35
sp|Q9USR6|NAT9_SCHPO N-acetyltransferase 9-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC577.03c PE=3 SV=1 1 205 9.0E-35
sp|Q3UG98|NAT9_MOUSE N-acetyltransferase 9 OS=Mus musculus GN=Nat9 PE=1 SV=2 1 206 1.0E-34
sp|Q9BTE0|NAT9_HUMAN N-acetyltransferase 9 OS=Homo sapiens GN=NAT9 PE=1 SV=1 1 232 4.0E-33
sp|Q61FA3|NAT9_CAEBR N-acetyltransferase 9-like protein OS=Caenorhabditis briggsae GN=CBG11716 PE=3 SV=1 1 205 7.0E-33
sp|Q9V9V9|NAT9_DROME N-acetyltransferase 9-like protein OS=Drosophila melanogaster GN=CG11539 PE=2 SV=1 1 203 2.0E-29
sp|Q86II5|NAT9_DICDI N-acetyltransferase 9-like protein OS=Dictyostelium discoideum GN=nat9 PE=3 SV=1 1 201 7.0E-25
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8277
MRLNEKTAVATSDVLLVPYEEHHVRTYHAWMQDPGIREATASEALSLDEEYENQRSWRRARDKLTFIVCEPLAPS
EPAPARPDAEDRMRGDVNLFLHPCDDDSDDDDEGGGARRLTGEVDVMIAGPEHRGRGLGGAAVRALLAYLRRHGR
EALAEYAGAGAPPARLGRLMAKIRADNAGSAALFRRLGFRQTAGPDYFGELTFSLAWRDVEAAVDAWAPAHSGYR
ELPYGGG*
Coding >Hirsu2|8277
ATGAGGCTCAACGAGAAGACCGCGGTCGCGACGAGCGATGTGCTGCTGGTGCCGTACGAGGAGCATCACGTGCGA
ACGTATCACGCGTGGATGCAAGATCCGGGCATCCGCGAGGCGACGGCGTCCGAGGCCCTGAGCCTGGACGAGGAG
TACGAGAACCAGCGGTCGTGGCGGCGGGCGCGCGACAAGCTGACCTTTATCGTGTGCGAGCCGCTCGCACCGTCG
GAGCCGGCGCCGGCGAGGCCCGACGCCGAGGACCGGATGAGGGGCGACGTCAACCTGTTCCTGCACCCCTGCGAC
GACGACAGCGACGACGATGACGAGGGCGGCGGCGCCCGGCGCCTCACGGGCGAGGTGGACGTCATGATCGCCGGC
CCGGAGCACCGCGGGCGCGGCCTCGGCGGCGCGGCCGTCCGGGCCCTGCTGGCCTACCTGCGGCGGCACGGGCGC
GAGGCGCTGGCCGAGTACGCGGGCGCAGGCGCGCCGCCCGCGCGCCTCGGCCGCCTCATGGCCAAGATCCGCGCC
GACAACGCCGGCAGCGCCGCCCTCTTCCGCCGCCTCGGCTTCCGCCAGACGGCCGGGCCCGACTACTTCGGCGAG
CTGACCTTTTCCCTGGCCTGGCGCGACGTCGAGGCCGCCGTCGACGCCTGGGCGCCCGCGCACAGCGGCTACCGC
GAGCTGCCGTACGGGGGGGGCTGA
Transcript >Hirsu2|8277
ATGAGGCTCAACGAGAAGACCGCGGTCGCGACGAGCGATGTGCTGCTGGTGCCGTACGAGGAGCATCACGTGCGA
ACGTATCACGCGTGGATGCAAGATCCGGGCATCCGCGAGGCGACGGCGTCCGAGGCCCTGAGCCTGGACGAGGAG
TACGAGAACCAGCGGTCGTGGCGGCGGGCGCGCGACAAGCTGACCTTTATCGTGTGCGAGCCGCTCGCACCGTCG
GAGCCGGCGCCGGCGAGGCCCGACGCCGAGGACCGGATGAGGGGCGACGTCAACCTGTTCCTGCACCCCTGCGAC
GACGACAGCGACGACGATGACGAGGGCGGCGGCGCCCGGCGCCTCACGGGCGAGGTGGACGTCATGATCGCCGGC
CCGGAGCACCGCGGGCGCGGCCTCGGCGGCGCGGCCGTCCGGGCCCTGCTGGCCTACCTGCGGCGGCACGGGCGC
GAGGCGCTGGCCGAGTACGCGGGCGCAGGCGCGCCGCCCGCGCGCCTCGGCCGCCTCATGGCCAAGATCCGCGCC
GACAACGCCGGCAGCGCCGCCCTCTTCCGCCGCCTCGGCTTCCGCCAGACGGCCGGGCCCGACTACTTCGGCGAG
CTGACCTTTTCCCTGGCCTGGCGCGACGTCGAGGCCGCCGTCGACGCCTGGGCGCCCGCGCACAGCGGCTACCGC
GAGCTGCCGTACGGGGGGGGCTGA
Gene >Hirsu2|8277
ATGAGGCTCAACGAGAAGACCGGTAAGACGGGACACGCCTTATGCCGGTACCGCCCGATCTGACGCGTCGCAGCG
GTCGCGACGAGCGATGTGCTGCTGGTGCCGTACGAGGAGCATCACGTGCGAACGTATCACGCGTGGATGCAAGAT
CCGGTACGCACCGCCGCGGCCGAAGATGGAGAAGAAGAGGAGAGAAAAAGAGCGGGAGGCGGAAGAGGAGCGCGG
TGGCTGACGGCGTCCAGGGCATCCGCGAGGCGACGGCGTCCGAGGCCCTGAGCCTGGACGAGGAGTACGAGAACC
AGCGGTCGTGGCGGCGGGCGCGCGACAAGCTGACCTTTATCGTGTGCGAGCCGCTCGCACCGTCGGAGCCGGCGC
CGGCGAGGCCCGACGCCGAGGACCGGATGAGGGGCGACGTCAACCTGTTCCTGCACCCCTGCGACGACGACAGCG
ACGACGATGACGAGGGCGGCGGCGCCCGGCGCCTCACGGGCGAGGTGGACGTCATGATCGCCGGCCCGGAGCACC
GCGGGCGCGGCCTCGGCGGCGCGGCCGTCCGGGCCCTGCTGGCCTACCTGCGGCGGCACGGGCGCGAGGCGCTGG
CCGAGTACGCGGGCGCAGGCGCGCCGCCCGCGCGCCTCGGCCGCCTCATGGCCAAGATCCGCGCCGACAACGCCG
GCAGCGCCGCCCTCTTCCGCCGCCTCGGCTTCCGCCAGACGGCCGGGCCCGACTACTTCGGCGAGCTGACCTTTT
CCCTGGCCTGGCGCGACGTCGAGGCCGCCGTCGACGCCTGGGCGCCCGCGCACAGCGGCTACCGCGAGCTGCCGT
ACGGGGGGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail