Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8276
Gene name
LocationContig_53:1759..2788
Strand-
Gene length (bp)1029
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01344 Kelch_1 Kelch motif 5.0E-05 95 141
PF01344 Kelch_1 Kelch motif 4.1E-06 200 248

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5E9V5|KLD8B_BOVIN Kelch domain-containing protein 8B OS=Bos taurus GN=KLHDC8B PE=2 SV=1 39 336 7.0E-16
sp|Q04652|KELC_DROME Ring canal kelch protein OS=Drosophila melanogaster GN=kel PE=1 SV=4 47 340 1.0E-15
sp|Q9D2D9|KLD8B_MOUSE Kelch domain-containing protein 8B OS=Mus musculus GN=Klhdc8b PE=2 SV=1 38 336 2.0E-15
sp|F1MBP6|KLHL3_BOVIN Kelch-like protein 3 OS=Bos taurus GN=KLHL3 PE=3 SV=3 16 320 3.0E-15
sp|Q5REP9|KLHL3_PONAB Kelch-like protein 3 OS=Pongo abelii GN=KLHL3 PE=2 SV=1 16 320 6.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5E9V5|KLD8B_BOVIN Kelch domain-containing protein 8B OS=Bos taurus GN=KLHDC8B PE=2 SV=1 39 336 7.0E-16
sp|Q04652|KELC_DROME Ring canal kelch protein OS=Drosophila melanogaster GN=kel PE=1 SV=4 47 340 1.0E-15
sp|Q9D2D9|KLD8B_MOUSE Kelch domain-containing protein 8B OS=Mus musculus GN=Klhdc8b PE=2 SV=1 38 336 2.0E-15
sp|F1MBP6|KLHL3_BOVIN Kelch-like protein 3 OS=Bos taurus GN=KLHL3 PE=3 SV=3 16 320 3.0E-15
sp|Q5REP9|KLHL3_PONAB Kelch-like protein 3 OS=Pongo abelii GN=KLHL3 PE=2 SV=1 16 320 6.0E-15
sp|Q9UH77|KLHL3_HUMAN Kelch-like protein 3 OS=Homo sapiens GN=KLHL3 PE=1 SV=2 16 320 7.0E-15
sp|E7F6F9|KLHL3_DANRE Kelch-like protein 3 OS=Danio rerio GN=klhl3 PE=3 SV=1 11 340 7.0E-15
sp|E9QIN8|KL41A_DANRE Kelch-like protein 41a OS=Danio rerio GN=klhl41a PE=2 SV=1 76 340 8.0E-15
sp|Q5XIA9|KLD8B_RAT Kelch domain-containing protein 8B OS=Rattus norvegicus GN=Klhdc8b PE=2 SV=1 23 336 2.0E-14
sp|Q70JS2|KELC_ANOST Ring canal kelch homolog OS=Anopheles stephensi GN=kel PE=2 SV=2 47 340 2.0E-14
sp|Q5RCW7|KLD8B_PONAB Kelch domain-containing protein 8B OS=Pongo abelii GN=KLHDC8B PE=2 SV=1 42 336 2.0E-14
sp|Q8IXV7|KLD8B_HUMAN Kelch domain-containing protein 8B OS=Homo sapiens GN=KLHDC8B PE=2 SV=1 42 336 2.0E-14
sp|Q9NXS3|KLH28_HUMAN Kelch-like protein 28 OS=Homo sapiens GN=KLHL28 PE=2 SV=2 16 340 5.0E-14
sp|F1LZ52|KLHL3_RAT Kelch-like protein 3 OS=Rattus norvegicus GN=Klhl3 PE=2 SV=2 16 320 6.0E-14
sp|E0CZ16|KLHL3_MOUSE Kelch-like protein 3 OS=Mus musculus GN=Klhl3 PE=1 SV=2 16 320 9.0E-14
sp|Q8IYD2|KLD8A_HUMAN Kelch domain-containing protein 8A OS=Homo sapiens GN=KLHDC8A PE=2 SV=2 20 320 2.0E-13
sp|Q96PQ7|KLHL5_HUMAN Kelch-like protein 5 OS=Homo sapiens GN=KLHL5 PE=2 SV=3 43 311 2.0E-13
sp|Q9CR40|KLH28_MOUSE Kelch-like protein 28 OS=Mus musculus GN=Klhl28 PE=2 SV=1 16 340 4.0E-13
sp|Q8K430|KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus GN=Klhl17 PE=1 SV=1 72 340 7.0E-13
sp|Q6TDP3|KLH17_MOUSE Kelch-like protein 17 OS=Mus musculus GN=Klhl17 PE=1 SV=1 72 340 7.0E-13
sp|Q91XA8|KLD8A_MOUSE Kelch domain-containing protein 8A OS=Mus musculus GN=Klhdc8a PE=2 SV=1 20 325 1.0E-12
sp|Q53G59|KLH12_HUMAN Kelch-like protein 12 OS=Homo sapiens GN=KLHL12 PE=1 SV=2 16 320 2.0E-12
sp|Q8BZM0|KLH12_MOUSE Kelch-like protein 12 OS=Mus musculus GN=Klhl12 PE=2 SV=1 16 320 3.0E-12
sp|Q8R2H4|KLH12_RAT Kelch-like protein 12 OS=Rattus norvegicus GN=Klhl12 PE=2 SV=2 16 320 4.0E-12
sp|Q9Y573|IPP_HUMAN Actin-binding protein IPP OS=Homo sapiens GN=IPP PE=2 SV=1 69 320 5.0E-12
sp|E1B932|KLH12_BOVIN Kelch-like protein 12 OS=Bos taurus GN=KLHL12 PE=3 SV=2 16 320 7.0E-12
sp|P59280|KLHL8_MOUSE Kelch-like protein 8 OS=Mus musculus GN=Klhl8 PE=2 SV=2 49 337 8.0E-12
sp|Q6DEL7|KLH15_DANRE Kelch-like protein 15 OS=Danio rerio GN=klhl15 PE=2 SV=1 21 257 8.0E-12
sp|F1QEG2|KL41B_DANRE Kelch-like protein 41b OS=Danio rerio GN=klhl41b PE=2 SV=1 72 340 9.0E-12
sp|Q5U374|KLH12_DANRE Kelch-like protein 12 OS=Danio rerio GN=klhl12 PE=2 SV=2 16 320 1.0E-11
sp|Q6TDP4|KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens GN=KLHL17 PE=2 SV=1 72 340 1.0E-11
sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo sapiens GN=IVNS1ABP PE=1 SV=3 20 299 1.0E-11
sp|Q9Z2X8|KEAP1_MOUSE Kelch-like ECH-associated protein 1 OS=Mus musculus GN=Keap1 PE=1 SV=1 64 340 1.0E-11
sp|Q8R124|KLH36_MOUSE Kelch-like protein 36 OS=Mus musculus GN=Klhl36 PE=1 SV=1 42 320 2.0E-11
sp|Q920Q8|NS1BP_MOUSE Influenza virus NS1A-binding protein homolog OS=Mus musculus GN=Ivns1abp PE=1 SV=2 21 299 2.0E-11
sp|Q14145|KEAP1_HUMAN Kelch-like ECH-associated protein 1 OS=Homo sapiens GN=KEAP1 PE=1 SV=2 75 320 2.0E-11
sp|Q5R774|KEAP1_PONAB Kelch-like ECH-associated protein 1 OS=Pongo abelii GN=KEAP1 PE=2 SV=1 75 320 2.0E-11
sp|Q6NRH0|KLH12_XENLA Kelch-like protein 12 OS=Xenopus laevis GN=klhl12 PE=2 SV=2 16 268 2.0E-11
sp|Q66HD2|KLH36_RAT Kelch-like protein 36 OS=Rattus norvegicus GN=Klhl36 PE=2 SV=1 42 320 2.0E-11
sp|Q9P2G9|KLHL8_HUMAN Kelch-like protein 8 OS=Homo sapiens GN=KLHL8 PE=1 SV=4 49 337 3.0E-11
sp|Q3B7M1|KLH36_BOVIN Kelch-like protein 36 OS=Bos taurus GN=KLHL36 PE=2 SV=1 39 320 3.0E-11
sp|Q5ZKD9|KLH20_CHICK Kelch-like protein 20 OS=Gallus gallus GN=KLHL20 PE=2 SV=1 174 340 3.0E-11
sp|Q684M4|KEAP1_PIG Kelch-like ECH-associated protein 1 OS=Sus scrofa GN=KEAP1 PE=3 SV=1 75 320 3.0E-11
sp|Q6DFF6|KLH20_XENLA Kelch-like protein 20 OS=Xenopus laevis GN=klhl20 PE=2 SV=1 174 340 3.0E-11
sp|Q5U504|KLH40_XENLA Kelch-like protein 40 OS=Xenopus laevis GN=klhl40 PE=2 SV=1 76 320 4.0E-11
sp|Q8VCK5|KLH20_MOUSE Kelch-like protein 20 OS=Mus musculus GN=Klhl20 PE=2 SV=2 174 340 4.0E-11
sp|P28575|IPP_MOUSE Actin-binding protein IPP OS=Mus musculus GN=Ipp PE=2 SV=3 69 320 4.0E-11
sp|O95198|KLHL2_HUMAN Kelch-like protein 2 OS=Homo sapiens GN=KLHL2 PE=1 SV=2 14 320 4.0E-11
sp|Q9NR64|KLHL1_HUMAN Kelch-like protein 1 OS=Homo sapiens GN=KLHL1 PE=2 SV=1 16 340 5.0E-11
sp|Q5R7B8|KLH20_PONAB Kelch-like protein 20 OS=Pongo abelii GN=KLHL20 PE=2 SV=3 174 340 5.0E-11
sp|Q8N4N3|KLH36_HUMAN Kelch-like protein 36 OS=Homo sapiens GN=KLHL36 PE=1 SV=1 39 320 5.0E-11
sp|D3Z8N4|KLH20_RAT Kelch-like protein 20 OS=Rattus norvegicus GN=Klhl20 PE=3 SV=1 174 340 5.0E-11
sp|Q9Y2M5|KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens GN=KLHL20 PE=1 SV=4 174 340 5.0E-11
sp|Q08DK3|KLH20_BOVIN Kelch-like protein 20 OS=Bos taurus GN=KLHL20 PE=2 SV=3 174 340 5.0E-11
sp|Q9JI74|KLHL1_MOUSE Kelch-like protein 1 OS=Mus musculus GN=Klhl1 PE=2 SV=2 16 340 6.0E-11
sp|Q8JZP3|KLHL2_MOUSE Kelch-like protein 2 OS=Mus musculus GN=Klhl2 PE=1 SV=1 14 320 6.0E-11
sp|F1LZF0|KLHL2_RAT Kelch-like protein 2 OS=Rattus norvegicus GN=Klhl2 PE=1 SV=3 14 320 7.0E-11
sp|P57790|KEAP1_RAT Kelch-like ECH-associated protein 1 OS=Rattus norvegicus GN=Keap1 PE=2 SV=1 102 335 1.0E-10
sp|Q9C0H6|KLHL4_HUMAN Kelch-like protein 4 OS=Homo sapiens GN=KLHL4 PE=1 SV=2 177 340 1.0E-10
sp|O60662|KLH41_HUMAN Kelch-like protein 41 OS=Homo sapiens GN=KLHL41 PE=1 SV=2 137 320 2.0E-10
sp|Q5RG82|NS1BA_DANRE Influenza virus NS1A-binding protein homolog A OS=Danio rerio GN=ivns1abpa PE=2 SV=1 173 340 2.0E-10
sp|Q5ZLD3|KLH13_CHICK Kelch-like protein 13 OS=Gallus gallus GN=KLHL13 PE=2 SV=1 37 340 2.0E-10
sp|Q9NR64|KLHL1_HUMAN Kelch-like protein 1 OS=Homo sapiens GN=KLHL1 PE=2 SV=1 43 311 3.0E-10
sp|Q9C0H6|KLHL4_HUMAN Kelch-like protein 4 OS=Homo sapiens GN=KLHL4 PE=1 SV=2 16 320 3.0E-10
sp|Q6DFU2|NS1BP_XENLA Influenza virus NS1A-binding protein homolog OS=Xenopus laevis GN=ivns1abp PE=2 SV=1 27 340 3.0E-10
sp|Q9JI74|KLHL1_MOUSE Kelch-like protein 1 OS=Mus musculus GN=Klhl1 PE=2 SV=2 43 311 4.0E-10
sp|Q684M4|KEAP1_PIG Kelch-like ECH-associated protein 1 OS=Sus scrofa GN=KEAP1 PE=3 SV=1 154 340 5.0E-10
sp|B4J045|KLHDB_DROGR Kelch-like protein diablo OS=Drosophila grimshawi GN=dbo PE=3 SV=1 174 340 6.0E-10
sp|Q16RL8|KLHDB_AEDAE Kelch-like protein diablo OS=Aedes aegypti GN=dbo PE=3 SV=1 174 340 7.0E-10
sp|B4QLQ2|KLHDB_DROSI Kelch-like protein diablo OS=Drosophila simulans GN=dbo PE=3 SV=1 174 340 7.0E-10
sp|Q7QGL0|KLHDB_ANOGA Kelch-like protein diablo OS=Anopheles gambiae GN=dbo PE=3 SV=4 174 340 7.0E-10
sp|B0WWP2|KLHDB_CULQU Kelch-like protein diablo OS=Culex quinquefasciatus GN=dbo PE=3 SV=2 174 340 7.0E-10
sp|B4LIG6|KLHDB_DROVI Kelch-like protein diablo OS=Drosophila virilis GN=dbo PE=3 SV=1 174 340 7.0E-10
sp|B4L0G9|KLHDB_DROMO Kelch-like protein diablo OS=Drosophila mojavensis GN=dbo PE=3 SV=1 174 340 8.0E-10
sp|Q91XA8|KLD8A_MOUSE Kelch domain-containing protein 8A OS=Mus musculus GN=Klhdc8a PE=2 SV=1 73 320 9.0E-10
sp|Q7QGL0|KLHDB_ANOGA Kelch-like protein diablo OS=Anopheles gambiae GN=dbo PE=3 SV=4 128 320 9.0E-10
sp|Q9D2D9|KLD8B_MOUSE Kelch domain-containing protein 8B OS=Mus musculus GN=Klhdc8b PE=2 SV=1 78 327 1.0E-09
sp|Q96PQ7|KLHL5_HUMAN Kelch-like protein 5 OS=Homo sapiens GN=KLHL5 PE=2 SV=3 16 340 1.0E-09
sp|Q16RL8|KLHDB_AEDAE Kelch-like protein diablo OS=Aedes aegypti GN=dbo PE=3 SV=1 128 320 1.0E-09
sp|B4QLQ2|KLHDB_DROSI Kelch-like protein diablo OS=Drosophila simulans GN=dbo PE=3 SV=1 128 320 1.0E-09
sp|B0WWP2|KLHDB_CULQU Kelch-like protein diablo OS=Culex quinquefasciatus GN=dbo PE=3 SV=2 128 320 1.0E-09
sp|Q5EB39|KLH40_XENTR Kelch-like protein 40 OS=Xenopus tropicalis GN=klhl40 PE=2 SV=1 76 320 1.0E-09
sp|Q2M0J9|KLHDB_DROPS Kelch-like protein diablo OS=Drosophila pseudoobscura pseudoobscura GN=dbo PE=3 SV=2 174 340 1.0E-09
sp|Q2M0J9|KLHDB_DROPS Kelch-like protein diablo OS=Drosophila pseudoobscura pseudoobscura GN=dbo PE=3 SV=2 128 320 1.0E-09
sp|B4GRJ2|KLHDB_DROPE Kelch-like protein diablo OS=Drosophila persimilis GN=dbo PE=3 SV=1 174 340 1.0E-09
sp|B4GRJ2|KLHDB_DROPE Kelch-like protein diablo OS=Drosophila persimilis GN=dbo PE=3 SV=1 128 320 1.0E-09
sp|Q9P2G3|KLH14_HUMAN Kelch-like protein 14 OS=Homo sapiens GN=KLHL14 PE=1 SV=2 46 339 1.0E-09
sp|Q5XIA9|KLD8B_RAT Kelch domain-containing protein 8B OS=Rattus norvegicus GN=Klhdc8b PE=2 SV=1 78 327 2.0E-09
sp|Q14145|KEAP1_HUMAN Kelch-like ECH-associated protein 1 OS=Homo sapiens GN=KEAP1 PE=1 SV=2 157 340 2.0E-09
sp|Q5R774|KEAP1_PONAB Kelch-like ECH-associated protein 1 OS=Pongo abelii GN=KEAP1 PE=2 SV=1 157 340 2.0E-09
sp|Q503R4|KLH36_DANRE Kelch-like protein 36 OS=Danio rerio GN=klhl36 PE=2 SV=1 78 340 2.0E-09
sp|B4MXW3|KLHDB_DROWI Kelch-like protein diablo OS=Drosophila willistoni GN=dbo PE=3 SV=1 128 320 2.0E-09
sp|B4PD06|KLHDB_DROYA Kelch-like protein diablo OS=Drosophila yakuba GN=dbo PE=3 SV=1 128 320 2.0E-09
sp|B4PD06|KLHDB_DROYA Kelch-like protein diablo OS=Drosophila yakuba GN=dbo PE=3 SV=1 174 340 2.0E-09
sp|B4HIK1|KLHDB_DROSE Kelch-like protein diablo OS=Drosophila sechellia GN=dbo PE=3 SV=1 128 320 2.0E-09
sp|B4HIK1|KLHDB_DROSE Kelch-like protein diablo OS=Drosophila sechellia GN=dbo PE=3 SV=1 174 340 2.0E-09
sp|Q9VUU5|KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster GN=dbo PE=1 SV=1 128 320 2.0E-09
sp|Q9VUU5|KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster GN=dbo PE=1 SV=1 174 340 2.0E-09
sp|B3NDN0|KLHDB_DROER Kelch-like protein diablo OS=Drosophila erecta GN=dbo PE=3 SV=1 128 320 2.0E-09
sp|B3NDN0|KLHDB_DROER Kelch-like protein diablo OS=Drosophila erecta GN=dbo PE=3 SV=1 174 340 2.0E-09
sp|B3M9V8|KLHDB_DROAN Kelch-like protein diablo OS=Drosophila ananassae GN=dbo PE=3 SV=2 128 320 2.0E-09
sp|B3M9V8|KLHDB_DROAN Kelch-like protein diablo OS=Drosophila ananassae GN=dbo PE=3 SV=2 174 340 2.0E-09
sp|G5ED84|KLHL8_CAEEL Kelch-like protein 8 OS=Caenorhabditis elegans GN=kel-8 PE=1 SV=1 181 340 2.0E-09
sp|Q684M4|KEAP1_PIG Kelch-like ECH-associated protein 1 OS=Sus scrofa GN=KEAP1 PE=3 SV=1 102 335 3.0E-09
sp|A2AUC9|KLH41_MOUSE Kelch-like protein 41 OS=Mus musculus GN=Klhl41 PE=1 SV=1 72 320 3.0E-09
sp|Q9Z2X8|KEAP1_MOUSE Kelch-like ECH-associated protein 1 OS=Mus musculus GN=Keap1 PE=1 SV=1 2 258 4.0E-09
sp|Q920Q8|NS1BP_MOUSE Influenza virus NS1A-binding protein homolog OS=Mus musculus GN=Ivns1abp PE=1 SV=2 64 340 4.0E-09
sp|Q5RG82|NS1BA_DANRE Influenza virus NS1A-binding protein homolog A OS=Danio rerio GN=ivns1abpa PE=2 SV=1 35 340 4.0E-09
sp|D3ZZC3|KLH22_RAT Kelch-like protein 22 OS=Rattus norvegicus GN=Klhl22 PE=1 SV=1 80 320 4.0E-09
sp|Q9ER30|KLH41_RAT Kelch-like protein 41 OS=Rattus norvegicus GN=Klhl41 PE=1 SV=1 72 320 4.0E-09
sp|B3DIV9|KL40A_DANRE Kelch-like protein 40a OS=Danio rerio GN=klhl40a PE=2 SV=2 72 339 4.0E-09
sp|Q69ZK5|KLH14_MOUSE Kelch-like protein 14 OS=Mus musculus GN=Klhl14 PE=1 SV=2 46 339 4.0E-09
sp|Q5E9V5|KLD8B_BOVIN Kelch domain-containing protein 8B OS=Bos taurus GN=KLHDC8B PE=2 SV=1 78 327 5.0E-09
sp|Q9C0H6|KLHL4_HUMAN Kelch-like protein 4 OS=Homo sapiens GN=KLHL4 PE=1 SV=2 43 311 5.0E-09
sp|Q8IXV7|KLD8B_HUMAN Kelch domain-containing protein 8B OS=Homo sapiens GN=KLHDC8B PE=2 SV=1 78 327 6.0E-09
sp|D2HEW7|KLH22_AILME Kelch-like protein 22 OS=Ailuropoda melanoleuca GN=KLHL22 PE=3 SV=1 80 320 6.0E-09
sp|Q6GQU2|KLH23_MOUSE Kelch-like protein 23 OS=Mus musculus GN=Klhl23 PE=2 SV=1 46 338 6.0E-09
sp|B4J045|KLHDB_DROGR Kelch-like protein diablo OS=Drosophila grimshawi GN=dbo PE=3 SV=1 128 320 8.0E-09
sp|B4LIG6|KLHDB_DROVI Kelch-like protein diablo OS=Drosophila virilis GN=dbo PE=3 SV=1 128 320 8.0E-09
sp|Q96CT2|KLH29_HUMAN Kelch-like protein 29 OS=Homo sapiens GN=KLHL29 PE=2 SV=3 20 309 8.0E-09
sp|B4L0G9|KLHDB_DROMO Kelch-like protein diablo OS=Drosophila mojavensis GN=dbo PE=3 SV=1 128 320 9.0E-09
sp|Q80T74|KLH29_MOUSE Kelch-like protein 29 OS=Mus musculus GN=Klhl29 PE=2 SV=3 20 309 9.0E-09
sp|Q9P2G9|KLHL8_HUMAN Kelch-like protein 8 OS=Homo sapiens GN=KLHL8 PE=1 SV=4 174 340 1.0E-08
sp|O60662|KLH41_HUMAN Kelch-like protein 41 OS=Homo sapiens GN=KLHL41 PE=1 SV=2 87 320 1.0E-08
sp|B4MXW3|KLHDB_DROWI Kelch-like protein diablo OS=Drosophila willistoni GN=dbo PE=3 SV=1 174 340 1.0E-08
sp|Q6ZPT1|KLHL9_MOUSE Kelch-like protein 9 OS=Mus musculus GN=Klhl9 PE=2 SV=2 37 340 1.0E-08
sp|Q7ZVQ8|NS1BB_DANRE Influenza virus NS1A-binding protein homolog B OS=Danio rerio GN=ivns1abpb PE=2 SV=1 173 340 1.0E-08
sp|Q99JN2|KLH22_MOUSE Kelch-like protein 22 OS=Mus musculus GN=Klhl22 PE=1 SV=1 80 320 1.0E-08
sp|Q14145|KEAP1_HUMAN Kelch-like ECH-associated protein 1 OS=Homo sapiens GN=KEAP1 PE=1 SV=2 102 335 2.0E-08
sp|Q6DFU2|NS1BP_XENLA Influenza virus NS1A-binding protein homolog OS=Xenopus laevis GN=ivns1abp PE=2 SV=1 35 299 2.0E-08
sp|Q9P2J3|KLHL9_HUMAN Kelch-like protein 9 OS=Homo sapiens GN=KLHL9 PE=1 SV=2 37 340 2.0E-08
sp|Q8NBE8|KLH23_HUMAN Kelch-like protein 23 OS=Homo sapiens GN=KLHL23 PE=1 SV=1 46 338 2.0E-08
sp|Q5F3N5|KLH14_CHICK Kelch-like protein 14 OS=Gallus gallus GN=KLHL14 PE=2 SV=1 46 339 2.0E-08
sp|Q5RCQ9|KLH23_PONAB Kelch-like protein 23 OS=Pongo abelii GN=KLHL23 PE=2 SV=1 46 338 2.0E-08
sp|Q2T9Z7|KLHL9_BOVIN Kelch-like protein 9 OS=Bos taurus GN=KLHL9 PE=2 SV=1 37 340 2.0E-08
sp|Q5R774|KEAP1_PONAB Kelch-like ECH-associated protein 1 OS=Pongo abelii GN=KEAP1 PE=2 SV=1 102 335 3.0E-08
sp|Q684M4|KEAP1_PIG Kelch-like ECH-associated protein 1 OS=Sus scrofa GN=KEAP1 PE=3 SV=1 2 258 3.0E-08
sp|Q9ER30|KLH41_RAT Kelch-like protein 41 OS=Rattus norvegicus GN=Klhl41 PE=1 SV=1 123 320 3.0E-08
sp|Q96M94|KLH15_HUMAN Kelch-like protein 15 OS=Homo sapiens GN=KLHL15 PE=1 SV=2 21 257 3.0E-08
sp|Q5RCW7|KLD8B_PONAB Kelch domain-containing protein 8B OS=Pongo abelii GN=KLHDC8B PE=2 SV=1 78 327 4.0E-08
sp|P28575|IPP_MOUSE Actin-binding protein IPP OS=Mus musculus GN=Ipp PE=2 SV=3 241 340 4.0E-08
sp|Q9ER30|KLH41_RAT Kelch-like protein 41 OS=Rattus norvegicus GN=Klhl41 PE=1 SV=1 65 217 4.0E-08
sp|Q96NJ5|KLH32_HUMAN Kelch-like protein 32 OS=Homo sapiens GN=KLHL32 PE=2 SV=2 211 340 4.0E-08
sp|Q2M0J9|KLHDB_DROPS Kelch-like protein diablo OS=Drosophila pseudoobscura pseudoobscura GN=dbo PE=3 SV=2 12 305 5.0E-08
sp|B4GRJ2|KLHDB_DROPE Kelch-like protein diablo OS=Drosophila persimilis GN=dbo PE=3 SV=1 12 305 5.0E-08
sp|B4MXW3|KLHDB_DROWI Kelch-like protein diablo OS=Drosophila willistoni GN=dbo PE=3 SV=1 12 305 5.0E-08
sp|B4PD06|KLHDB_DROYA Kelch-like protein diablo OS=Drosophila yakuba GN=dbo PE=3 SV=1 12 305 5.0E-08
sp|B4HIK1|KLHDB_DROSE Kelch-like protein diablo OS=Drosophila sechellia GN=dbo PE=3 SV=1 12 305 5.0E-08
sp|Q9VUU5|KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster GN=dbo PE=1 SV=1 12 305 5.0E-08
sp|B3NDN0|KLHDB_DROER Kelch-like protein diablo OS=Drosophila erecta GN=dbo PE=3 SV=1 12 305 5.0E-08
sp|Q5F3N5|KLH14_CHICK Kelch-like protein 14 OS=Gallus gallus GN=KLHL14 PE=2 SV=1 69 244 5.0E-08
sp|P59280|KLHL8_MOUSE Kelch-like protein 8 OS=Mus musculus GN=Klhl8 PE=2 SV=2 174 340 6.0E-08
sp|B3M9V8|KLHDB_DROAN Kelch-like protein diablo OS=Drosophila ananassae GN=dbo PE=3 SV=2 12 305 7.0E-08
sp|A2AUC9|KLH41_MOUSE Kelch-like protein 41 OS=Mus musculus GN=Klhl41 PE=1 SV=1 123 320 7.0E-08
sp|Q8QQ16|KBTB1_CAMPS Kelch repeat and BTB domain-containing protein 1 OS=Camelpox virus (strain CMS) GN=KBTB1 PE=3 SV=1 194 340 7.0E-08
sp|Q8BWA5|KLH31_MOUSE Kelch-like protein 31 OS=Mus musculus GN=Klhl31 PE=1 SV=1 14 320 7.0E-08
sp|Q8CA72|GAN_MOUSE Gigaxonin OS=Mus musculus GN=Gan PE=1 SV=2 158 339 7.0E-08
sp|A2AUC9|KLH41_MOUSE Kelch-like protein 41 OS=Mus musculus GN=Klhl41 PE=1 SV=1 65 217 8.0E-08
sp|Q9P2N7|KLH13_HUMAN Kelch-like protein 13 OS=Homo sapiens GN=KLHL13 PE=1 SV=3 37 340 8.0E-08
sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo sapiens GN=IVNS1ABP PE=1 SV=3 64 320 9.0E-08
sp|P57790|KEAP1_RAT Kelch-like ECH-associated protein 1 OS=Rattus norvegicus GN=Keap1 PE=2 SV=1 2 258 9.0E-08
sp|Q7QGL0|KLHDB_ANOGA Kelch-like protein diablo OS=Anopheles gambiae GN=dbo PE=3 SV=4 12 305 9.0E-08
sp|Q9P2G3|KLH14_HUMAN Kelch-like protein 14 OS=Homo sapiens GN=KLHL14 PE=1 SV=2 69 244 9.0E-08
sp|A6QQY2|KLH13_BOVIN Kelch-like protein 13 OS=Bos taurus GN=KLHL13 PE=2 SV=1 37 340 9.0E-08
sp|Q6DEL7|KLH15_DANRE Kelch-like protein 15 OS=Danio rerio GN=klhl15 PE=2 SV=1 87 340 1.0E-07
sp|B4J045|KLHDB_DROGR Kelch-like protein diablo OS=Drosophila grimshawi GN=dbo PE=3 SV=1 12 305 1.0E-07
sp|Q16RL8|KLHDB_AEDAE Kelch-like protein diablo OS=Aedes aegypti GN=dbo PE=3 SV=1 12 305 1.0E-07
sp|B0WWP2|KLHDB_CULQU Kelch-like protein diablo OS=Culex quinquefasciatus GN=dbo PE=3 SV=2 12 305 1.0E-07
sp|B4LIG6|KLHDB_DROVI Kelch-like protein diablo OS=Drosophila virilis GN=dbo PE=3 SV=1 12 305 1.0E-07
sp|Q69ZK5|KLH14_MOUSE Kelch-like protein 14 OS=Mus musculus GN=Klhl14 PE=1 SV=2 69 244 1.0E-07
sp|Q96M94|KLH15_HUMAN Kelch-like protein 15 OS=Homo sapiens GN=KLHL15 PE=1 SV=2 87 340 1.0E-07
sp|Q80TF4|KLH13_MOUSE Kelch-like protein 13 OS=Mus musculus GN=Klhl13 PE=2 SV=3 37 340 1.0E-07
sp|Q9D783|KLH40_MOUSE Kelch-like protein 40 OS=Mus musculus GN=Klhl40 PE=1 SV=1 76 320 1.0E-07
sp|Q9H511|KLH31_HUMAN Kelch-like protein 31 OS=Homo sapiens GN=KLHL31 PE=2 SV=1 25 320 1.0E-07
sp|Q9Y573|IPP_HUMAN Actin-binding protein IPP OS=Homo sapiens GN=IPP PE=2 SV=1 241 340 2.0E-07
sp|Q6DFU2|NS1BP_XENLA Influenza virus NS1A-binding protein homolog OS=Xenopus laevis GN=ivns1abp PE=2 SV=1 64 340 2.0E-07
sp|B4L0G9|KLHDB_DROMO Kelch-like protein diablo OS=Drosophila mojavensis GN=dbo PE=3 SV=1 12 305 2.0E-07
sp|Q7ZVQ8|NS1BB_DANRE Influenza virus NS1A-binding protein homolog B OS=Danio rerio GN=ivns1abpb PE=2 SV=1 70 296 2.0E-07
sp|Q6DFF7|KLH25_XENLA Kelch-like protein 25 OS=Xenopus laevis GN=klhl25 PE=2 SV=1 211 326 2.0E-07
sp|Q920Q8|NS1BP_MOUSE Influenza virus NS1A-binding protein homolog OS=Mus musculus GN=Ivns1abp PE=1 SV=2 27 320 3.0E-07
sp|Q14145|KEAP1_HUMAN Kelch-like ECH-associated protein 1 OS=Homo sapiens GN=KEAP1 PE=1 SV=2 2 258 3.0E-07
sp|Q5R774|KEAP1_PONAB Kelch-like ECH-associated protein 1 OS=Pongo abelii GN=KEAP1 PE=2 SV=1 2 258 3.0E-07
sp|O60662|KLH41_HUMAN Kelch-like protein 41 OS=Homo sapiens GN=KLHL41 PE=1 SV=2 14 294 3.0E-07
sp|B4QLQ2|KLHDB_DROSI Kelch-like protein diablo OS=Drosophila simulans GN=dbo PE=3 SV=1 12 305 3.0E-07
sp|Q5ZI33|KLHL7_CHICK Kelch-like protein 7 OS=Gallus gallus GN=KLHL7 PE=2 SV=1 98 320 3.0E-07
sp|Q5EB39|KLH40_XENTR Kelch-like protein 40 OS=Xenopus tropicalis GN=klhl40 PE=2 SV=1 22 294 4.0E-07
sp|Q5RCW7|KLD8B_PONAB Kelch domain-containing protein 8B OS=Pongo abelii GN=KLHDC8B PE=2 SV=1 24 268 5.0E-07
sp|Q8IXV7|KLD8B_HUMAN Kelch domain-containing protein 8B OS=Homo sapiens GN=KLHDC8B PE=2 SV=1 24 268 5.0E-07
sp|Q9ER30|KLH41_RAT Kelch-like protein 41 OS=Rattus norvegicus GN=Klhl41 PE=1 SV=1 14 294 5.0E-07
sp|Q5E9V5|KLD8B_BOVIN Kelch domain-containing protein 8B OS=Bos taurus GN=KLHDC8B PE=2 SV=1 24 268 6.0E-07
sp|O94819|KBTBB_HUMAN Kelch repeat and BTB domain-containing protein 11 OS=Homo sapiens GN=KBTBD11 PE=1 SV=1 23 166 6.0E-07
sp|Q5U374|KLH12_DANRE Kelch-like protein 12 OS=Danio rerio GN=klhl12 PE=2 SV=2 170 338 7.0E-07
sp|Q9H2C0|GAN_HUMAN Gigaxonin OS=Homo sapiens GN=GAN PE=1 SV=1 158 339 8.0E-07
sp|Q53GT1|KLH22_HUMAN Kelch-like protein 22 OS=Homo sapiens GN=KLHL22 PE=1 SV=2 16 259 8.0E-07
sp|Q5U504|KLH40_XENLA Kelch-like protein 40 OS=Xenopus laevis GN=klhl40 PE=2 SV=1 22 293 9.0E-07
sp|A6NCF5|KLH33_HUMAN Kelch-like protein 33 OS=Homo sapiens GN=KLHL33 PE=4 SV=2 79 337 9.0E-07
sp|Q25386|SCRB_LIMPO Beta-scruin OS=Limulus polyphemus PE=2 SV=1 71 320 1.0E-06
sp|O94889|KLH18_HUMAN Kelch-like protein 18 OS=Homo sapiens GN=KLHL18 PE=1 SV=3 53 340 1.0E-06
sp|E9QJ30|KL40B_DANRE Kelch-like protein 40b OS=Danio rerio GN=klhl40b PE=2 SV=1 1 294 1.0E-06
sp|Q5XHZ6|KLHL7_RAT Kelch-like protein 7 OS=Rattus norvegicus GN=Klhl7 PE=2 SV=1 98 320 1.0E-06
sp|Q8BUL5|KLHL7_MOUSE Kelch-like protein 7 OS=Mus musculus GN=Klhl7 PE=2 SV=1 98 320 1.0E-06
sp|Q9D2D9|KLD8B_MOUSE Kelch domain-containing protein 8B OS=Mus musculus GN=Klhdc8b PE=2 SV=1 24 268 2.0E-06
sp|Q0D2A9|KLH25_XENTR Kelch-like protein 25 OS=Xenopus tropicalis GN=klhl25 PE=2 SV=1 211 326 2.0E-06
sp|Q9H0H3|KLH25_HUMAN Kelch-like protein 25 OS=Homo sapiens GN=KLHL25 PE=1 SV=1 211 326 2.0E-06
sp|Q8IXQ5|KLHL7_HUMAN Kelch-like protein 7 OS=Homo sapiens GN=KLHL7 PE=1 SV=2 98 320 2.0E-06
sp|Q4KLM4|KLH25_RAT Kelch-like protein 25 OS=Rattus norvegicus GN=Klhl25 PE=2 SV=1 211 326 2.0E-06
sp|Q8R2P1|KLH25_MOUSE Kelch-like protein 25 OS=Mus musculus GN=Klhl25 PE=2 SV=1 211 326 2.0E-06
sp|Q08CY1|KLH22_XENTR Kelch-like protein 22 OS=Xenopus tropicalis GN=klhl22 PE=2 SV=1 14 259 2.0E-06
sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo sapiens GN=IVNS1ABP PE=1 SV=3 33 320 3.0E-06
sp|Q6NRH0|KLH12_XENLA Kelch-like protein 12 OS=Xenopus laevis GN=klhl12 PE=2 SV=2 170 320 3.0E-06
sp|P28575|IPP_MOUSE Actin-binding protein IPP OS=Mus musculus GN=Ipp PE=2 SV=3 156 320 3.0E-06
sp|Q9UJP4|KLH21_HUMAN Kelch-like protein 21 OS=Homo sapiens GN=KLHL21 PE=1 SV=4 20 294 3.0E-06
sp|Q3U410|KLH21_MOUSE Kelch-like protein 21 OS=Mus musculus GN=Klhl21 PE=2 SV=1 20 294 4.0E-06
sp|P08073|VMT9_MYXVL Kelch repeat protein M-T9 OS=Myxoma virus (strain Lausanne) GN=m009L PE=3 SV=2 38 278 4.0E-06
sp|Q9H0H3|KLH25_HUMAN Kelch-like protein 25 OS=Homo sapiens GN=KLHL25 PE=1 SV=1 49 340 5.0E-06
sp|G5ED84|KLHL8_CAEEL Kelch-like protein 8 OS=Caenorhabditis elegans GN=kel-8 PE=1 SV=1 69 337 6.0E-06
sp|Q4KLM4|KLH25_RAT Kelch-like protein 25 OS=Rattus norvegicus GN=Klhl25 PE=2 SV=1 49 340 6.0E-06
sp|D2HEW7|KLH22_AILME Kelch-like protein 22 OS=Ailuropoda melanoleuca GN=KLHL22 PE=3 SV=1 14 259 8.0E-06
sp|Q6DFF7|KLH25_XENLA Kelch-like protein 25 OS=Xenopus laevis GN=klhl25 PE=2 SV=1 49 341 8.0E-06
sp|Q0D2K2|KLH30_HUMAN Kelch-like protein 30 OS=Homo sapiens GN=KLHL30 PE=2 SV=3 12 312 9.0E-06
sp|Q9Y573|IPP_HUMAN Actin-binding protein IPP OS=Homo sapiens GN=IPP PE=2 SV=1 64 259 1.0E-05
sp|Q6NYM1|KLH21_DANRE Kelch-like protein 21 OS=Danio rerio GN=klhl21 PE=2 SV=1 20 294 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8276
MRFTFALGALFGLAACAEDSPPSGKWHELADIADSPRGEHTTVALSPSTLAIVGGVLPQGDPLETTDRVQLYDIP
SDSWSAAPRIPVPLNHLNLAMVDGKVYLLGGLAVLDNGTWSATADCWVLDPRDGGGGDWTPLEPMPNGTARGSAA
VGVHGKSIYLAGGETINVPGAYQDSVTDVSAFDTEAGTWRVLPGRLPEGRNHAGGAVVDSTLYVVGGRVAGRDSI
RDTLFALDLERPDGEWEELPRMPTGRGGLSVAVVGKTIYAAGGEGNPAPGTDGVFNETEGFDTGRREWSRFAPMR
IPRHGTSVVAVDGCIYFPGGSVVQGGPPVNATDKFCPEEDGA*
Coding >Hirsu2|8276
ATGCGCTTCACGTTCGCCCTCGGGGCCCTCTTCGGGCTCGCCGCCTGCGCGGAAGACTCGCCGCCGTCCGGGAAA
TGGCATGAGCTCGCCGACATCGCCGACTCGCCCCGCGGAGAGCACACGACCGTCGCCCTCTCGCCCTCGACCCTG
GCCATCGTCGGGGGCGTCCTGCCGCAGGGCGACCCGCTCGAGACGACGGACAGGGTGCAGCTGTACGACATCCCC
TCGGACAGCTGGTCGGCGGCGCCCAGGATCCCGGTGCCGCTCAACCACCTCAACCTGGCCATGGTCGACGGCAAG
GTGTACCTGCTCGGCGGCCTCGCCGTGCTGGACAACGGGACGTGGAGCGCCACGGCCGACTGCTGGGTCTTGGAC
CCGCGCGACGGCGGCGGCGGCGACTGGACGCCGCTGGAGCCGATGCCCAACGGCACGGCCCGGGGCTCGGCCGCC
GTCGGCGTCCACGGCAAGAGCATCTACCTGGCGGGCGGCGAGACGATCAACGTGCCGGGCGCGTACCAGGACTCC
GTGACGGACGTCTCGGCCTTCGACACCGAGGCCGGCACGTGGCGCGTGCTGCCGGGCCGCCTGCCCGAGGGCCGC
AACCATGCGGGCGGCGCCGTCGTCGACTCGACCCTGTACGTCGTCGGCGGCCGTGTCGCCGGCCGAGACTCGATC
CGCGACACCCTCTTCGCCCTCGACCTCGAGCGCCCGGACGGCGAGTGGGAGGAGCTGCCGAGGATGCCGACGGGC
CGCGGCGGCCTCTCGGTCGCCGTCGTCGGCAAGACCATCTACGCCGCCGGCGGCGAGGGCAACCCGGCGCCCGGC
ACGGACGGCGTCTTCAACGAGACGGAGGGCTTCGACACGGGCCGCCGCGAGTGGTCCCGCTTTGCGCCGATGAGG
ATCCCGAGGCACGGCACGTCCGTCGTCGCCGTCGACGGCTGCATCTATTTCCCGGGCGGGAGCGTCGTCCAAGGC
GGCCCGCCCGTCAATGCCACGGACAAGTTTTGTCCCGAGGAAGATGGGGCTTAG
Transcript >Hirsu2|8276
ATGCGCTTCACGTTCGCCCTCGGGGCCCTCTTCGGGCTCGCCGCCTGCGCGGAAGACTCGCCGCCGTCCGGGAAA
TGGCATGAGCTCGCCGACATCGCCGACTCGCCCCGCGGAGAGCACACGACCGTCGCCCTCTCGCCCTCGACCCTG
GCCATCGTCGGGGGCGTCCTGCCGCAGGGCGACCCGCTCGAGACGACGGACAGGGTGCAGCTGTACGACATCCCC
TCGGACAGCTGGTCGGCGGCGCCCAGGATCCCGGTGCCGCTCAACCACCTCAACCTGGCCATGGTCGACGGCAAG
GTGTACCTGCTCGGCGGCCTCGCCGTGCTGGACAACGGGACGTGGAGCGCCACGGCCGACTGCTGGGTCTTGGAC
CCGCGCGACGGCGGCGGCGGCGACTGGACGCCGCTGGAGCCGATGCCCAACGGCACGGCCCGGGGCTCGGCCGCC
GTCGGCGTCCACGGCAAGAGCATCTACCTGGCGGGCGGCGAGACGATCAACGTGCCGGGCGCGTACCAGGACTCC
GTGACGGACGTCTCGGCCTTCGACACCGAGGCCGGCACGTGGCGCGTGCTGCCGGGCCGCCTGCCCGAGGGCCGC
AACCATGCGGGCGGCGCCGTCGTCGACTCGACCCTGTACGTCGTCGGCGGCCGTGTCGCCGGCCGAGACTCGATC
CGCGACACCCTCTTCGCCCTCGACCTCGAGCGCCCGGACGGCGAGTGGGAGGAGCTGCCGAGGATGCCGACGGGC
CGCGGCGGCCTCTCGGTCGCCGTCGTCGGCAAGACCATCTACGCCGCCGGCGGCGAGGGCAACCCGGCGCCCGGC
ACGGACGGCGTCTTCAACGAGACGGAGGGCTTCGACACGGGCCGCCGCGAGTGGTCCCGCTTTGCGCCGATGAGG
ATCCCGAGGCACGGCACGTCCGTCGTCGCCGTCGACGGCTGCATCTATTTCCCGGGCGGGAGCGTCGTCCAAGGC
GGCCCGCCCGTCAATGCCACGGACAAGTTTTGTCCCGAGGAAGATGGGGCTTAG
Gene >Hirsu2|8276
ATGCGCTTCACGTTCGCCCTCGGGGCCCTCTTCGGGCTCGCCGCCTGCGCGGAAGACTCGCCGCCGTCCGGGAAA
TGGCATGAGCTCGCCGACATCGCCGACTCGCCCCGCGGAGAGCACACGACCGTCGCCCTCTCGCCCTCGACCCTG
GCCATCGTCGGGGGCGTCCTGCCGCAGGGCGACCCGCTCGAGACGACGGACAGGGTGCAGCTGTACGACATCCCC
TCGGACAGCTGGTCGGCGGCGCCCAGGATCCCGGTGCCGCTCAACCACCTCAACCTGGCCATGGTCGACGGCAAG
GTGTACCTGCTCGGCGGCCTCGCCGTGCTGGACAACGGGACGTGGAGCGCCACGGCCGACTGCTGGGTCTTGGAC
CCGCGCGACGGCGGCGGCGGCGACTGGACGCCGCTGGAGCCGATGCCCAACGGCACGGCCCGGGGCTCGGCCGCC
GTCGGCGTCCACGGCAAGAGCATCTACCTGGCGGGCGGCGAGACGATCAACGTGCCGGGCGCGTACCAGGACTCC
GTGACGGACGTCTCGGCCTTCGACACCGAGGCCGGCACGTGGCGCGTGCTGCCGGGCCGCCTGCCCGAGGGCCGC
AACCATGCGGGCGGCGCCGTCGTCGACTCGACCCTGTACGTCGTCGGCGGCCGTGTCGCCGGCCGAGACTCGATC
CGCGACACCCTCTTCGCCCTCGACCTCGAGCGCCCGGACGGCGAGTGGGAGGAGCTGCCGAGGATGCCGACGGGC
CGCGGCGGCCTCTCGGTCGCCGTCGTCGGCAAGACCATCTACGCCGCCGGCGGCGAGGGCAACCCGGCGCCCGGC
ACGGACGGCGTCTTCAACGAGACGGAGGGCTTCGACACGGGCCGCCGCGAGTGGTCCCGCTTTGCGCCGATGAGG
ATCCCGAGGCACGGCACGTCCGTCGTCGCCGTCGACGGCTGCATCTATTTCCCGGGCGGGAGCGTCGTCCAAGGC
GGCCCGCCCGTCAATGCCACGGACAAGTTTTGTCCCGAGGAAGATGGGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail