Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8270
Gene name
LocationContig_529:5563..8147
Strand-
Gene length (bp)2584
Transcript length (bp)2382
Coding sequence length (bp)2382
Protein length (aa) 794

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17285 PRMT5_TIM PRMT5 TIM barrel domain 1.8E-66 47 330
PF05185 PRMT5 PRMT5 arginine-N-methyltransferase 8.1E-66 390 568
PF17286 PRMT5_C PRMT5 oligomerisation domain 2.7E-56 571 793

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78963|SKB1_SCHPO Protein arginine N-methyltransferase skb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skb1 PE=1 SV=2 44 793 3.0E-125
sp|Q6YXZ7|ANM5_ORYSJ Protein arginine N-methyltransferase 5 OS=Oryza sativa subsp. japonica GN=PRMT5 PE=2 SV=1 98 766 8.0E-96
sp|A2X0Q3|ANM5_ORYSI Protein arginine N-methyltransferase 5 OS=Oryza sativa subsp. indica GN=PRMT5 PE=3 SV=2 98 766 2.0E-95
sp|Q6NUA1|ANM5_XENLA Protein arginine N-methyltransferase 5 OS=Xenopus laevis GN=prmt5 PE=1 SV=1 25 764 4.0E-92
sp|Q8GWT4|ANM15_ARATH Protein arginine N-methyltransferase 1.5 OS=Arabidopsis thaliana GN=PMRT15 PE=1 SV=2 42 766 6.0E-91
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78963|SKB1_SCHPO Protein arginine N-methyltransferase skb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skb1 PE=1 SV=2 44 793 3.0E-125
sp|Q6YXZ7|ANM5_ORYSJ Protein arginine N-methyltransferase 5 OS=Oryza sativa subsp. japonica GN=PRMT5 PE=2 SV=1 98 766 8.0E-96
sp|A2X0Q3|ANM5_ORYSI Protein arginine N-methyltransferase 5 OS=Oryza sativa subsp. indica GN=PRMT5 PE=3 SV=2 98 766 2.0E-95
sp|Q6NUA1|ANM5_XENLA Protein arginine N-methyltransferase 5 OS=Xenopus laevis GN=prmt5 PE=1 SV=1 25 764 4.0E-92
sp|Q8GWT4|ANM15_ARATH Protein arginine N-methyltransferase 1.5 OS=Arabidopsis thaliana GN=PMRT15 PE=1 SV=2 42 766 6.0E-91
sp|O14744|ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 119 766 9.0E-91
sp|Q4R5M3|ANM5_MACFA Protein arginine N-methyltransferase 5 OS=Macaca fascicularis GN=PRMT5 PE=2 SV=3 29 766 1.0E-90
sp|Q5R698|ANM5_PONAB Protein arginine N-methyltransferase 5 OS=Pongo abelii GN=PRMT5 PE=2 SV=3 119 766 2.0E-90
sp|A7YW45|ANM5_BOVIN Protein arginine N-methyltransferase 5 OS=Bos taurus GN=PRMT5 PE=2 SV=1 29 766 5.0E-90
sp|Q8CIG8|ANM5_MOUSE Protein arginine N-methyltransferase 5 OS=Mus musculus GN=Prmt5 PE=1 SV=3 119 766 1.0E-89
sp|Q54KI3|ANM5_DICDI Protein arginine N-methyltransferase 5 OS=Dictyostelium discoideum GN=prmt5 PE=3 SV=1 123 762 9.0E-80
sp|P38274|HSL7_YEAST Protein arginine N-methyltransferase HSL7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL7 PE=1 SV=1 114 770 4.0E-73
sp|P46580|ANM5_CAEEL Protein arginine N-methyltransferase 5 OS=Caenorhabditis elegans GN=prmt-5 PE=1 SV=2 119 782 2.0E-56
sp|Q9U6Y9|ANM5_DROME Protein arginine N-methyltransferase 5 OS=Drosophila melanogaster GN=csul PE=1 SV=2 234 764 1.0E-54
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8270
MASGDEAASVMAEGFGPRQPVFHIGKHDSARDVPLTDLQYGHLLNQGISFVTTPITNQRFRSRVFKLVADYLASL
DGDGLAETTSTATSSRAEPILPPLTPDDTSLFPSSAVNTYTACVSPWIDLCSLDPFIASISRQVLNLEINYANFC
GVRSIMVPGPSCDAGKDGGSQGLVQYSRAVQEALAIGNCLSFLIHLPMYREPVGGGPDETLSSLKPQGGNPETKG
GEIDLFSCWESWHHIRTVCNYNLRLFVALKLPKMMPEKDLQSRWFAEPLHYLTIGPEVFQANRSGYPCFSKHHQE
MISSCMRLKAAPWLLLRDVGPDASHFQADSPSLLATRPPMTEEDFPSLADAHQPVKATQGQAGWGNAHMAYLQWL
ESQQAPFTALESSTLTNFQDWLQSPLQPLSDNLESATYEVFEGDPVKYDQYEAAIVRALSEWEELGLPTSKDGVV
VMAVAGSGRGPLVTRALRAAEYTGVPVEVWAVEKNPNAYVYLLRQNQTQWGGQVRVVKTDMRAWKGPVVSESAGA
GPVHGKVDILISELLGSFGDNELSPECLDGIQHVMAEPHGISIPSSYTAHVSPISTPKVHAEILTRSASDVTAFD
TPWVVRLYALDFVCQRVPGHARFQQAWEFSHPIPASTLQAVQARRSGGVVGGGGGSMAGAAGANDHNSRYCHLTF
VCRSPGLIHGLAGYFESTLYESRLDGRAGEKVEISTHPERIDSKSKDMVSWFPIFFPLKNPISFPADTELEISMW
RQTDDSKVWYEWLVEAWTWVGPSTRIKVASSNLCSSRKVACLM*
Coding >Hirsu2|8270
ATGGCCTCGGGCGACGAGGCGGCATCGGTCATGGCCGAGGGCTTCGGCCCCCGGCAGCCCGTCTTCCACATCGGA
AAGCATGACTCGGCCCGCGATGTCCCGCTGACGGACCTACAGTACGGTCATTTGCTGAACCAGGGTATCAGCTTC
GTGACGACGCCCATCACCAATCAGCGCTTCCGATCCAGGGTCTTCAAGCTGGTGGCCGACTACTTGGCCTCGCTG
GACGGGGACGGCCTGGCAGAGACGACCAGCACAGCCACCTCGTCTCGAGCGGAGCCCATCTTGCCGCCGCTGACT
CCCGACGACACCAGCCTTTTCCCGTCGTCGGCCGTCAACACGTATACGGCCTGTGTCAGCCCCTGGATCGACCTC
TGCTCCTTGGACCCCTTCATCGCCAGCATCTCGCGCCAGGTCCTGAACCTCGAGATCAACTACGCCAACTTTTGC
GGCGTCAGGAGCATCATGGTCCCTGGGCCGTCCTGTGACGCGGGCAAGGACGGCGGCAGCCAGGGCCTGGTCCAG
TACTCCCGGGCCGTTCAAGAGGCCCTGGCCATCGGGAACTGCCTGTCCTTTCTCATCCACCTGCCGATGTATCGG
GAGCCTGTAGGCGGCGGCCCGGACGAAACCCTTTCGTCGCTCAAGCCGCAGGGCGGCAATCCTGAGACGAAAGGA
GGGGAGATCGACCTCTTCAGCTGCTGGGAATCGTGGCATCACATACGGACAGTGTGCAACTACAACCTGAGGCTC
TTCGTCGCGCTCAAGCTACCGAAGATGATGCCTGAGAAGGACCTACAGAGCAGGTGGTTCGCGGAGCCCCTTCAT
TATCTGACGATCGGGCCCGAAGTTTTCCAAGCAAATCGGAGCGGATATCCTTGTTTTTCCAAGCATCACCAGGAA
ATGATCTCGTCCTGCATGCGGCTCAAAGCCGCCCCCTGGCTCTTGCTGCGCGACGTCGGCCCAGATGCCTCTCAC
TTCCAGGCGGACTCGCCGTCACTGCTGGCCACGAGACCGCCGATGACGGAGGAAGACTTCCCGAGTCTGGCCGAT
GCCCACCAGCCGGTCAAGGCGACGCAGGGCCAGGCCGGCTGGGGAAACGCCCACATGGCGTATCTGCAGTGGCTG
GAGTCGCAGCAAGCACCCTTTACGGCCCTGGAATCTTCAACCTTGACCAACTTCCAGGACTGGCTGCAGTCGCCG
CTGCAACCGCTGTCGGACAACCTGGAATCGGCCACTTATGAGGTGTTCGAGGGCGACCCGGTCAAGTACGACCAG
TACGAGGCGGCCATCGTCAGGGCCTTGAGCGAGTGGGAGGAGCTCGGGCTGCCGACCTCCAAGGACGGCGTCGTC
GTCATGGCCGTCGCCGGCTCGGGCCGGGGCCCGCTCGTCACGCGGGCGCTCCGGGCAGCGGAATACACGGGCGTG
CCGGTGGAGGTGTGGGCGGTCGAGAAGAACCCCAATGCCTACGTTTATCTCCTGCGCCAGAACCAGACGCAGTGG
GGCGGGCAGGTCAGGGTGGTCAAGACGGACATGCGGGCCTGGAAGGGCCCCGTCGTGTCCGAGTCGGCGGGCGCG
GGCCCAGTCCACGGCAAGGTCGACATCCTCATCTCGGAGCTGCTCGGCTCCTTTGGCGACAACGAGCTGTCCCCG
GAATGCCTGGACGGCATCCAGCATGTCATGGCCGAGCCGCACGGCATATCGATCCCCAGCTCCTACACGGCGCAC
GTCAGCCCCATCTCGACGCCCAAGGTGCACGCCGAGATCCTGACGCGGTCCGCCTCCGACGTCACGGCCTTCGAC
ACGCCCTGGGTCGTCAGGCTCTACGCGCTCGACTTCGTCTGCCAGCGGGTGCCGGGCCACGCCCGGTTTCAGCAG
GCCTGGGAGTTCTCGCACCCCATCCCGGCCTCGACCCTGCAGGCCGTCCAGGCGAGGCGCTCGGGCGGCGTCGTC
GGCGGCGGCGGCGGCAGCATGGCGGGCGCAGCCGGGGCCAACGACCACAACTCGCGCTACTGCCACCTCACCTTC
GTCTGTCGCAGCCCCGGCCTCATCCACGGCCTGGCCGGCTACTTCGAGTCGACGCTGTACGAGTCCCGGTTGGAC
GGCCGGGCGGGCGAAAAGGTCGAGATCAGCACGCACCCGGAGAGGATCGACAGCAAGAGCAAGGACATGGTCTCA
TGGTTCCCCATCTTCTTCCCCCTCAAGAACCCCATCTCGTTCCCCGCCGACACGGAGCTCGAGATCAGCATGTGG
CGCCAGACGGACGACAGCAAGGTGTGGTACGAGTGGCTCGTCGAGGCCTGGACGTGGGTAGGGCCCAGCACGCGG
ATCAAGGTTGCCTCTTCGAACCTGTGCAGCAGCCGGAAGGTTGCCTGTCTGATGTAA
Transcript >Hirsu2|8270
ATGGCCTCGGGCGACGAGGCGGCATCGGTCATGGCCGAGGGCTTCGGCCCCCGGCAGCCCGTCTTCCACATCGGA
AAGCATGACTCGGCCCGCGATGTCCCGCTGACGGACCTACAGTACGGTCATTTGCTGAACCAGGGTATCAGCTTC
GTGACGACGCCCATCACCAATCAGCGCTTCCGATCCAGGGTCTTCAAGCTGGTGGCCGACTACTTGGCCTCGCTG
GACGGGGACGGCCTGGCAGAGACGACCAGCACAGCCACCTCGTCTCGAGCGGAGCCCATCTTGCCGCCGCTGACT
CCCGACGACACCAGCCTTTTCCCGTCGTCGGCCGTCAACACGTATACGGCCTGTGTCAGCCCCTGGATCGACCTC
TGCTCCTTGGACCCCTTCATCGCCAGCATCTCGCGCCAGGTCCTGAACCTCGAGATCAACTACGCCAACTTTTGC
GGCGTCAGGAGCATCATGGTCCCTGGGCCGTCCTGTGACGCGGGCAAGGACGGCGGCAGCCAGGGCCTGGTCCAG
TACTCCCGGGCCGTTCAAGAGGCCCTGGCCATCGGGAACTGCCTGTCCTTTCTCATCCACCTGCCGATGTATCGG
GAGCCTGTAGGCGGCGGCCCGGACGAAACCCTTTCGTCGCTCAAGCCGCAGGGCGGCAATCCTGAGACGAAAGGA
GGGGAGATCGACCTCTTCAGCTGCTGGGAATCGTGGCATCACATACGGACAGTGTGCAACTACAACCTGAGGCTC
TTCGTCGCGCTCAAGCTACCGAAGATGATGCCTGAGAAGGACCTACAGAGCAGGTGGTTCGCGGAGCCCCTTCAT
TATCTGACGATCGGGCCCGAAGTTTTCCAAGCAAATCGGAGCGGATATCCTTGTTTTTCCAAGCATCACCAGGAA
ATGATCTCGTCCTGCATGCGGCTCAAAGCCGCCCCCTGGCTCTTGCTGCGCGACGTCGGCCCAGATGCCTCTCAC
TTCCAGGCGGACTCGCCGTCACTGCTGGCCACGAGACCGCCGATGACGGAGGAAGACTTCCCGAGTCTGGCCGAT
GCCCACCAGCCGGTCAAGGCGACGCAGGGCCAGGCCGGCTGGGGAAACGCCCACATGGCGTATCTGCAGTGGCTG
GAGTCGCAGCAAGCACCCTTTACGGCCCTGGAATCTTCAACCTTGACCAACTTCCAGGACTGGCTGCAGTCGCCG
CTGCAACCGCTGTCGGACAACCTGGAATCGGCCACTTATGAGGTGTTCGAGGGCGACCCGGTCAAGTACGACCAG
TACGAGGCGGCCATCGTCAGGGCCTTGAGCGAGTGGGAGGAGCTCGGGCTGCCGACCTCCAAGGACGGCGTCGTC
GTCATGGCCGTCGCCGGCTCGGGCCGGGGCCCGCTCGTCACGCGGGCGCTCCGGGCAGCGGAATACACGGGCGTG
CCGGTGGAGGTGTGGGCGGTCGAGAAGAACCCCAATGCCTACGTTTATCTCCTGCGCCAGAACCAGACGCAGTGG
GGCGGGCAGGTCAGGGTGGTCAAGACGGACATGCGGGCCTGGAAGGGCCCCGTCGTGTCCGAGTCGGCGGGCGCG
GGCCCAGTCCACGGCAAGGTCGACATCCTCATCTCGGAGCTGCTCGGCTCCTTTGGCGACAACGAGCTGTCCCCG
GAATGCCTGGACGGCATCCAGCATGTCATGGCCGAGCCGCACGGCATATCGATCCCCAGCTCCTACACGGCGCAC
GTCAGCCCCATCTCGACGCCCAAGGTGCACGCCGAGATCCTGACGCGGTCCGCCTCCGACGTCACGGCCTTCGAC
ACGCCCTGGGTCGTCAGGCTCTACGCGCTCGACTTCGTCTGCCAGCGGGTGCCGGGCCACGCCCGGTTTCAGCAG
GCCTGGGAGTTCTCGCACCCCATCCCGGCCTCGACCCTGCAGGCCGTCCAGGCGAGGCGCTCGGGCGGCGTCGTC
GGCGGCGGCGGCGGCAGCATGGCGGGCGCAGCCGGGGCCAACGACCACAACTCGCGCTACTGCCACCTCACCTTC
GTCTGTCGCAGCCCCGGCCTCATCCACGGCCTGGCCGGCTACTTCGAGTCGACGCTGTACGAGTCCCGGTTGGAC
GGCCGGGCGGGCGAAAAGGTCGAGATCAGCACGCACCCGGAGAGGATCGACAGCAAGAGCAAGGACATGGTCTCA
TGGTTCCCCATCTTCTTCCCCCTCAAGAACCCCATCTCGTTCCCCGCCGACACGGAGCTCGAGATCAGCATGTGG
CGCCAGACGGACGACAGCAAGGTGTGGTACGAGTGGCTCGTCGAGGCCTGGACGTGGGTAGGGCCCAGCACGCGG
ATCAAGGTTGCCTCTTCGAACCTGTGCAGCAGCCGGAAGGTTGCCTGTCTGATGTAA
Gene >Hirsu2|8270
ATGGCCTCGGGCGACGAGGCGGCATCGGTCATGGCCGAGGGCTTCGGCCCCCGGCAGCCCGTCTTCCACATCGGA
AAGCATGACTCGGCCCGCGATGTCCCGCTGACGGACCTACAGTACGGTCATTTGCTGAACCAGGGTGTTAGTGGC
GGCCGTCCTCGCGTGAACCGAAGGCCGTGGTGGTCCCTAACTCGGAGACAAGATCAGCTTCGTGACGACGCCCAT
CACCAATCAGCGCTTCCGATCCAGGGTCTTCAAGCTGGTGGCCGACTACTTGGCCTCGCTGGACGGGGACGGCCT
GGCAGAGACGACCAGCACAGCCACCTCGTCTCGAGCGGAGCCCATCTTGCCGCCGCTGACTCCCGACGACACCAG
CCTTTTCCCGTCGTCGGCCGTCAACACGTATACGGCCTGTGTCAGCCCCTGGATCGACCTCTGCTCCTTGGACCC
CTTCATCGCCAGCATCTCGCGCCAGGTCCTGAACCTCGAGATCAACTACGCCAACTTTTGCGGCGTCAGGAGCAT
CATGGTCCCTGGGCCGTCCTGTGACGCGGGCAAGGACGGCGGCAGCCAGGGCCTGGTCCAGTACTCCCGGGCCGT
TCAAGAGGCCCTGGCCATCGGGAACTGCCTGTCCTTTCTCATCCACCTGCCGATGTATCGGGAGCCTGTAGGCGG
CGGCCCGGACGAAACCCTTTCGTCGCTCAAGCCGCAGGGCGGCAATCCTGAGACGAAAGGAGGGGAGATCGACCT
CTTCAGCTGCTGGGAATCGTGGCATCACATACGGACAGTGTGCAACTACAACCTGAGGCTCTTCGTCGGTAAGCT
CCAGGCGCGAACCCGAGGAGGCGTCGTTCCGGAACATTACTGTGCTGACAACCTGGTTTTTCGTCCAGCGCTCAA
GCTACCGAAGATGATGCCTGAGAAGGACCTACAGAGCAGGTGGTTCGCGGAGCCCCTTCATTATCTGACGATCGG
GCCCGAAGTTTTCCAAGCAAATCGGAGCGGATATCCTTGTTTTTCCAAGCATCACCAGGAAATGATCTCGTCCTG
CATGCGGCTCAAAGCCGCCCCCTGGCTCTTGCTGCGCGACGTCGGCCCAGATGCCTCTCACTTCCAGGCGGACTC
GCCGTCACTGCTGGCCACGAGACCGCCGATGACGGAGGAAGACTTCCCGAGTCTGGCCGATGCCCACCAGCCGGT
CAAGGCGACGCAGGGCCAGGCCGGCTGGGGAAACGCCCACATGGCGTATCTGCAGTGGCTGGAGTCGCAGCAAGC
ACCCTTTACGGCCCTGGAATCTTCAACCTTGACCAACTTCCAGGACTGGCTGCAGTCGCCGCTGCAACCGCTGTC
GGACAACCTGGAATCGGCCACTTATGAGGTGTTCGAGGGCGACCCGGTCAAGTACGACCAGTACGAGGCGGCCAT
CGTCAGGGCCTTGAGCGAGTGGGAGGAGCTCGGGCTGCCGACCTCCAAGGACGGCGTCGTCGTCATGGCCGTCGC
CGGCTCGGGCCGGGGCCCGCTCGTCACGCGGGCGCTCCGGGCAGCGGAATACACGGGCGTGCCGGTGGAGGTGTG
GGCGGTCGAGAAGAACCCCAATGCCTACGTTTATCTCCTGCGCCAGAACCAGACGCAGTGGGGCGGGCAGGTCAG
GGTGGTCAAGACGGACATGCGGGCCTGGAAGGGCCCCGTCGTGTCCGAGTCGGCGGGCGCGGGCCCAGTCCACGG
CAAGGTCGACATCCTCATCTCGGAGCTGCTCGGCTCCTTTGGCGACAACGAGCTGTCCCCGGAATGCCTGGACGG
CATCCAGCATGTCATGGCCGAGCCGCACGGCATATCGATCCCCAGCTCCTACACGGCGCACGTCAGCCCCATCTC
GACGCCCAAGGTGCACGCCGAGATCCTGACGCGGTCCGCCTCCGACGTCACGGCCTTCGACACGCCCTGGGTCGT
CAGGCTCTACGCGCTCGACTTCGTCTGCCAGCGGGTGCCGGGCCACGCCCGGTTTCAGCAGGCCTGGGAGTTCTC
GCACCCCATCCCGGCCTCGACCCTGCAGGCCGTCCAGGCGAGGCGCTCGGGCGGCGTCGTCGGCGGCGGCGGCGG
CAGCATGGCGGGCGCAGCCGGGGCCAACGACCACAACTCGCGCTACTGCCACCTCACCTTCGTCTGTCGCAGCCC
CGGCCTCATCCACGGCCTGGCCGGCTACTTCGAGTCGACGCTGTACGAGTCCCGGTTGGACGGCCGGGCGGGCGA
AAAGGTCGAGATCAGCACGCACCCGGAGAGGATCGACAGCAAGAGCAAGGACATGGTCTCATGGTTCCCCATCTT
CTTCCCCCTCAAGGTGAGTCGCGTGCGCATCTCTTATCAAGTGGTCGGGAGAAGCTGACGGAGAGGGCCGGCCGC
GCAGAACCCCATCTCGTTCCCCGCCGACACGGAGCTCGAGATCAGCATGTGGCGCCAGACGGACGACAGCAAGGT
GTGGTACGAGTGGCTCGTCGAGGCCTGGACGTGGGTAGGGCCCAGCACGCGGATCAAGGTTGCCTCTTCGAACCT
GTGCAGCAGCCGGAAGGTTGCCTGTCTGATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail