Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8267
Gene name
LocationContig_528:14576..15866
Strand+
Gene length (bp)1290
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03239 FTR1 Iron permease FTR1 family 6.6E-78 8 310

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40088|FTR1_YEAST Plasma membrane iron permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FTR1 PE=1 SV=1 16 333 3.0E-110
sp|Q09919|FIP1_SCHPO Plasma membrane iron permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fip1 PE=1 SV=1 1 316 9.0E-94
sp|P38310|FTH1_YEAST Iron transporter FTH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FTH1 PE=1 SV=2 42 324 4.0E-87
sp|Q3Z398|EFEU_SHISS Ferrous iron permease EfeU OS=Shigella sonnei (strain Ss046) GN=efeU PE=3 SV=2 8 224 7.0E-10
sp|Q8XAS8|EFEU_ECO57 Ferrous iron permease EfeU OS=Escherichia coli O157:H7 GN=efeU PE=1 SV=3 8 224 7.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40088|FTR1_YEAST Plasma membrane iron permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FTR1 PE=1 SV=1 16 333 3.0E-110
sp|Q09919|FIP1_SCHPO Plasma membrane iron permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fip1 PE=1 SV=1 1 316 9.0E-94
sp|P38310|FTH1_YEAST Iron transporter FTH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FTH1 PE=1 SV=2 42 324 4.0E-87
sp|Q3Z398|EFEU_SHISS Ferrous iron permease EfeU OS=Shigella sonnei (strain Ss046) GN=efeU PE=3 SV=2 8 224 7.0E-10
sp|Q8XAS8|EFEU_ECO57 Ferrous iron permease EfeU OS=Escherichia coli O157:H7 GN=efeU PE=1 SV=3 8 224 7.0E-10
sp|Q1RDK0|EFEU_ECOUT Ferrous iron permease EfeU OS=Escherichia coli (strain UTI89 / UPEC) GN=efeU PE=3 SV=2 8 224 9.0E-10
sp|Q0TJ50|EFEU_ECOL5 Ferrous iron permease EfeU OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=efeU PE=3 SV=1 8 224 9.0E-10
sp|Q1CHD3|EFEU_YERPN Ferrous iron permease EfeU OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=efeU PE=3 SV=1 8 238 2.0E-09
sp|Q0WFU0|EFEU_YERPE Ferrous iron permease EfeU OS=Yersinia pestis GN=efeU PE=3 SV=1 8 238 2.0E-09
sp|Q1C8M3|EFEU_YERPA Ferrous iron permease EfeU OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=efeU PE=3 SV=1 8 238 2.0E-09
sp|Q66BP6|EFEU_YERPS Ferrous iron permease EfeU OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=efeU PE=3 SV=1 8 238 3.0E-09
sp|Q8FJ36|EFEU_ECOL6 Ferrous iron permease EfeU OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=efeU PE=1 SV=2 8 224 3.0E-09
sp|P75901|EFEU_ECOLI Putative inactive ferrous iron permease EfeU OS=Escherichia coli (strain K12) GN=efeU PE=5 SV=2 8 224 2.0E-08
sp|P39595|EFEU_BACSU Ferrous iron permease EfeU OS=Bacillus subtilis (strain 168) GN=efeU PE=1 SV=2 12 233 7.0E-07
sp|Q83LK5|EFEU_SHIFL Ferrous iron permease EfeU OS=Shigella flexneri GN=efeU PE=3 SV=2 84 224 7.0E-07
sp|Q0T618|EFEU_SHIF8 Ferrous iron permease EfeU OS=Shigella flexneri serotype 5b (strain 8401) GN=efeU PE=3 SV=2 84 224 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005381 iron ion transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0034755 iron ion transmembrane transport Yes
GO:0033573 high-affinity iron permease complex Yes
GO:0008324 cation transmembrane transporter activity No
GO:1990204 oxidoreductase complex No
GO:0000041 transition metal ion transport No
GO:1990351 transporter complex No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0046873 metal ion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:1905862 ferroxidase complex No
GO:0032991 protein-containing complex No
GO:0051234 establishment of localization No
GO:0016021 integral component of membrane No
GO:0098655 cation transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0044464 cell part No
GO:0006812 cation transport No
GO:0051179 localization No
GO:0055085 transmembrane transport No
GO:0098797 plasma membrane protein complex No
GO:0044425 membrane part No
GO:0098660 inorganic ion transmembrane transport No
GO:0006826 iron ion transport No
GO:0031226 intrinsic component of plasma membrane No
GO:0031224 intrinsic component of membrane No
GO:1902494 catalytic complex No
GO:0006811 ion transport No
GO:0005887 integral component of plasma membrane No
GO:1902495 transmembrane transporter complex No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0044459 plasma membrane part No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0030001 metal ion transport No
GO:0003674 molecular_function No
GO:0098796 membrane protein complex No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 53 75 22
3 90 112 22
4 146 168 22
5 178 197 19
6 209 231 22
7 290 312 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8267
MAANVFAFPVFLIVFRETLETVIIVSVLLAFLKQTLGGPDRDVQLYKFLRRQVWIGVAAGFFICMVIAGAIIGVW
YTVRLNTWETHENIYEGVFCLVASVIITIMGAALLRIGKMQDKWRAKVARTIDAPLRAGSRRWWARLFEKYAMFF
LPFITVLREGVEAVVFTAGVSFSAPATAVPLPVFVGLLVGVLVGWLLYKGASTAKLHIFLVISTCLLYLVAAGLF
SRGVWHLETQQWNTAVGGDAAETGNGAGSYDIDKSVWHVNCCQPMGPDAGGWGIFNAILGWQNSATYGSVISYNV
YWIVVIAGFILMRFRETHGHWPFMKAKAHPGPGSSRSGSESHQGGIQKGTQEATVASTA*
Coding >Hirsu2|8267
ATGGCCGCCAACGTCTTCGCCTTCCCCGTCTTCCTCATCGTCTTCCGAGAGACGCTCGAGACGGTCATCATTGTT
TCCGTCTTGCTTGCCTTCCTCAAGCAGACTCTCGGCGGTCCCGACCGCGATGTCCAGCTGTACAAGTTCCTGAGG
CGGCAGGTCTGGATCGGCGTTGCCGCCGGCTTCTTTATCTGTATGGTCATTGCCGGCGCCATCATCGGCGTCTGG
TATACCGTGCGGCTCAACACATGGGAGACCCATGAGAACATCTATGAGGGCGTCTTCTGCCTTGTCGCGTCCGTC
ATCATCACCATCATGGGCGCCGCCCTGCTGCGCATCGGTAAGATGCAGGACAAGTGGCGCGCCAAGGTGGCCAGG
ACCATCGACGCGCCCCTCAGGGCCGGCAGCCGCCGCTGGTGGGCGCGCCTCTTCGAGAAATACGCCATGTTCTTT
CTCCCCTTCATCACTGTCCTGCGCGAGGGTGTCGAGGCTGTCGTCTTCACCGCCGGCGTCTCCTTCTCCGCCCCG
GCCACAGCTGTGCCGCTTCCCGTCTTCGTCGGCCTCCTTGTCGGAGTCCTTGTTGGCTGGCTCCTGTACAAGGGT
GCTTCCACGGCCAAGCTCCACATTTTCCTCGTCATCTCGACGTGCCTGCTATATCTCGTCGCCGCCGGTCTCTTC
TCCCGAGGCGTCTGGCACTTGGAGACGCAGCAGTGGAATACGGCCGTTGGTGGGGATGCCGCCGAGACCGGGAAT
GGGGCTGGATCCTATGACATCGACAAGAGCGTATGGCACGTCAACTGCTGTCAGCCAATGGGCCCGGACGCCGGC
GGCTGGGGCATCTTCAACGCCATACTGGGTTGGCAAAACTCGGCGACTTACGGCTCAGTCATCTCCTACAATGTC
TACTGGATCGTCGTCATCGCAGGGTTCATCCTCATGCGCTTCCGCGAGACTCACGGCCACTGGCCTTTTATGAAG
GCAAAGGCTCATCCCGGGCCCGGCAGCAGTCGCAGCGGAAGTGAGAGTCACCAGGGTGGCATTCAGAAGGGCACA
CAGGAGGCGACGGTTGCCTCGACGGCATGA
Transcript >Hirsu2|8267
ATGGCCGCCAACGTCTTCGCCTTCCCCGTCTTCCTCATCGTCTTCCGAGAGACGCTCGAGACGGTCATCATTGTT
TCCGTCTTGCTTGCCTTCCTCAAGCAGACTCTCGGCGGTCCCGACCGCGATGTCCAGCTGTACAAGTTCCTGAGG
CGGCAGGTCTGGATCGGCGTTGCCGCCGGCTTCTTTATCTGTATGGTCATTGCCGGCGCCATCATCGGCGTCTGG
TATACCGTGCGGCTCAACACATGGGAGACCCATGAGAACATCTATGAGGGCGTCTTCTGCCTTGTCGCGTCCGTC
ATCATCACCATCATGGGCGCCGCCCTGCTGCGCATCGGTAAGATGCAGGACAAGTGGCGCGCCAAGGTGGCCAGG
ACCATCGACGCGCCCCTCAGGGCCGGCAGCCGCCGCTGGTGGGCGCGCCTCTTCGAGAAATACGCCATGTTCTTT
CTCCCCTTCATCACTGTCCTGCGCGAGGGTGTCGAGGCTGTCGTCTTCACCGCCGGCGTCTCCTTCTCCGCCCCG
GCCACAGCTGTGCCGCTTCCCGTCTTCGTCGGCCTCCTTGTCGGAGTCCTTGTTGGCTGGCTCCTGTACAAGGGT
GCTTCCACGGCCAAGCTCCACATTTTCCTCGTCATCTCGACGTGCCTGCTATATCTCGTCGCCGCCGGTCTCTTC
TCCCGAGGCGTCTGGCACTTGGAGACGCAGCAGTGGAATACGGCCGTTGGTGGGGATGCCGCCGAGACCGGGAAT
GGGGCTGGATCCTATGACATCGACAAGAGCGTATGGCACGTCAACTGCTGTCAGCCAATGGGCCCGGACGCCGGC
GGCTGGGGCATCTTCAACGCCATACTGGGTTGGCAAAACTCGGCGACTTACGGCTCAGTCATCTCCTACAATGTC
TACTGGATCGTCGTCATCGCAGGGTTCATCCTCATGCGCTTCCGCGAGACTCACGGCCACTGGCCTTTTATGAAG
GCAAAGGCTCATCCCGGGCCCGGCAGCAGTCGCAGCGGAAGTGAGAGTCACCAGGGTGGCATTCAGAAGGGCACA
CAGGAGGCGACGGTTGCCTCGACGGCATGA
Gene >Hirsu2|8267
ATGGCCGCCAACGTCTTCGCCTTCCCCGTCTTCCTCATCGTCTTCCGAGAGACGCTCGAGACGGTCATCATTGTT
TCCGTCTTGCTTGCCTTCCTCAAGCAGACTCTCGGCGGTCCCGACCGCGATGTCCAGCTGTACAAGTTCCTGAGG
CGGCAGGTAAGCCCCCTCTCTCCCTTCACCCATTCCCTCCCCTCTGACCCTCGCTCGAAGGGACAGTGGGCTCCT
GCTGACGGAATCTCAAGGTCTGGATCGGCGTTGCCGCCGGCTTCTTTATCTGTATGGTCATTGCCGGCGCCATCA
TCGGCGTCTGGTATACCGTGCGGCTCAACACATGGGAGACCCATGAGAACATCTATGAGGGCGTCTTCTGCCTTG
TCGCGTCCGTCATCATCACCATCATGGGCGCCGCCCTGCTGCGCATCGGTAAGATGCAGGACAAGTGGCGCGCCA
AGGTGGCCAGGACCATCGACGCGCCCCTCAGGGCCGGCAGCCGCCGCTGGTGGGCGCGCCTCTTCGAGAAATACG
CCATGTTCTTTCTCCCCTTCATCACTGTCCTGCGCGAGGGTGTCGAGGCTGTCGTCTTCACCGCCGGCGTCTCCT
TCTCCGCCCCGGCCACAGCTGTGCCGCTTCCCGTCTTCGTCGGCCTCCTTGTCGGAGTCCTTGTTGGCTGGCTCC
TGTACAAGTGCGTGTCCTCGTCAGCCCCCGACCACTTACCCCTGCCGTCTCCGTTCTAAACAGCAAGAGTAGGGG
TGCTTCCACGGCCAAGCTCCACATTTTCCTCGTCATCTCGACGTGCCTGCTATATCTCGTCGCCGCCGGTCTCTT
CTCCCGAGGCGTCTGGCACTTGGAGACGCAGCAGTGGAATACGGCCGTTGGTGGGGATGCCGCCGAGACCGGGAA
TGGGGCTGGATCCTATGACATCGACAAGAGCGTATGGCACGTCAACGTAGGTCGCCTCGGGACCCAGACTGGCTC
TGATGTCTGCCGTACTGACCAGATGCATAGTGCTGTCAGCCAATGGGCCCGGACGCCGGCGGCTGGGGCATCTTC
AACGCCATACTGGGTTGGCAAAACTCGGCGACTTACGGCTCAGTCATCTCCTACAATGTCTACTGGATCGTCGTC
ATCGCAGGGTTCATCCTCATGCGCTTCCGCGAGACTCACGGCCACTGGCCTTTTATGAAGGCAAAGGCTCATCCC
GGGCCCGGCAGCAGTCGCAGCGGAAGTGAGAGTCACCAGGGTGGCATTCAGAAGGGCACACAGGAGGCGACGGTT
GCCTCGACGGCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail