Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8262
Gene name
LocationContig_527:13563..14222
Strand-
Gene length (bp)659
Transcript length (bp)576
Coding sequence length (bp)576
Protein length (aa) 192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08719 DUF1768 Domain of unknown function (DUF1768) 4.2E-52 13 185

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5UR67|RIBX_MIMIV N-glycosidase R617 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R617 PE=3 SV=1 43 181 2.0E-21
sp|K7WIZ6|RIBRX_MAIZE Riboflavin biosynthesis protein PYRR, chloroplastic OS=Zea mays GN=PYRR PE=1 SV=1 12 181 5.0E-08
sp|B2J4E5|RIBX_NOSP7 N-glycosidase Npun_R5314 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_R5314 PE=1 SV=1 11 186 1.0E-07
sp|Q9STY4|RIBRX_ARATH Riboflavin biosynthesis protein PYRR, chloroplastic OS=Arabidopsis thaliana GN=PYRR PE=1 SV=1 12 181 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8262
MPGFKNKPQGPIFFWKEWDDYTGWLCQWYYHPFHDDEIPEILYYTAEHYMMYQKAKLFRDFEIADEILRDKSPRW
AKYLGRRVRHFDETVWLAKREAIMLKGNMLKFSSPILPQLGAAGSSVQPPVEGSLRDMLLLTRDAELVEASPFDR
VWGVGFRAEEAEVNRSQWGLNLLGKALMKVRRILREQREMM*
Coding >Hirsu2|8262
ATGCCCGGTTTCAAGAACAAGCCGCAGGGGCCAATCTTCTTCTGGAAGGAGTGGGACGACTACACGGGCTGGCTA
TGTCAGTGGTACTACCACCCATTTCATGACGACGAGATCCCGGAGATTCTCTATTACACGGCCGAACACTATATG
ATGTACCAAAAGGCCAAGCTTTTCAGGGATTTCGAAATAGCCGACGAGATACTACGAGACAAGTCCCCTAGATGG
GCCAAATACCTCGGCCGCAGAGTAAGACACTTCGACGAGACAGTCTGGCTGGCCAAGCGTGAGGCCATTATGCTC
AAGGGCAACATGCTCAAGTTCAGCTCGCCCATCCTCCCCCAGCTAGGGGCCGCGGGCTCGTCCGTGCAGCCCCCC
GTCGAGGGCTCGCTGCGTGACATGCTGTTGCTTACAAGAGACGCCGAGCTAGTCGAGGCGAGTCCCTTCGACCGT
GTCTGGGGGGTCGGGTTCCGGGCCGAAGAGGCCGAGGTGAACCGTAGCCAATGGGGGCTGAACCTGCTCGGCAAG
GCGTTAATGAAGGTTCGTAGGATTCTGAGGGAACAGAGAGAGATGATGTGA
Transcript >Hirsu2|8262
ATGCCCGGTTTCAAGAACAAGCCGCAGGGGCCAATCTTCTTCTGGAAGGAGTGGGACGACTACACGGGCTGGCTA
TGTCAGTGGTACTACCACCCATTTCATGACGACGAGATCCCGGAGATTCTCTATTACACGGCCGAACACTATATG
ATGTACCAAAAGGCCAAGCTTTTCAGGGATTTCGAAATAGCCGACGAGATACTACGAGACAAGTCCCCTAGATGG
GCCAAATACCTCGGCCGCAGAGTAAGACACTTCGACGAGACAGTCTGGCTGGCCAAGCGTGAGGCCATTATGCTC
AAGGGCAACATGCTCAAGTTCAGCTCGCCCATCCTCCCCCAGCTAGGGGCCGCGGGCTCGTCCGTGCAGCCCCCC
GTCGAGGGCTCGCTGCGTGACATGCTGTTGCTTACAAGAGACGCCGAGCTAGTCGAGGCGAGTCCCTTCGACCGT
GTCTGGGGGGTCGGGTTCCGGGCCGAAGAGGCCGAGGTGAACCGTAGCCAATGGGGGCTGAACCTGCTCGGCAAG
GCGTTAATGAAGGTTCGTAGGATTCTGAGGGAACAGAGAGAGATGATGTGA
Gene >Hirsu2|8262
ATGCCCGGTTTCAAGAACAAGCCGCAGGGGCCAATCTTCTTCTGGAAGGAGTGGGACGACTACACGGGCTGGCTA
TGTCAGTGGTACTACCACCCATTTCATGACGACGAGATCCCGGAGATTCTCTATTACACGGCCGAACAGTAAGTT
CCCGCCCGATTTTGGCTCCGTGTATAATCTTCAAACTACTTTAGCATGCATTATTGACGCTCTCTCTTCCGAACA
GCTATATGATGTACCAAAAGGCCAAGCTTTTCAGGGATTTCGAAATAGCCGACGAGATACTACGAGACAAGTCCC
CTAGATGGGCCAAATACCTCGGCCGCAGAGTAAGACACTTCGACGAGACAGTCTGGCTGGCCAAGCGTGAGGCCA
TTATGCTCAAGGGCAACATGCTCAAGTTCAGCTCGCCCATCCTCCCCCAGCTAGGGGCCGCGGGCTCGTCCGTGC
AGCCCCCCGTCGAGGGCTCGCTGCGTGACATGCTGTTGCTTACAAGAGACGCCGAGCTAGTCGAGGCGAGTCCCT
TCGACCGTGTCTGGGGGGTCGGGTTCCGGGCCGAAGAGGCCGAGGTGAACCGTAGCCAATGGGGGCTGAACCTGC
TCGGCAAGGCGTTAATGAAGGTTCGTAGGATTCTGAGGGAACAGAGAGAGATGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail