Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8261
Gene name
LocationContig_527:8909..9913
Strand-
Gene length (bp)1004
Transcript length (bp)939
Coding sequence length (bp)939
Protein length (aa) 313

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A5DNX8|KFA_PICGU Kynurenine formamidase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=BNA7 PE=3 SV=2 23 289 6.0E-25
sp|Q59ZV4|KFA_CANAL Kynurenine formamidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BNA7 PE=3 SV=1 17 255 2.0E-15
sp|A3GGU3|KFA_PICST Kynurenine formamidase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=BNA7 PE=3 SV=2 23 219 3.0E-15
sp|Q6BT11|KFA_DEBHA Kynurenine formamidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BNA7 PE=3 SV=2 24 212 5.0E-13
sp|Q759T3|KFA_ASHGO Kynurenine formamidase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BNA7 PE=3 SV=1 54 296 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A5DNX8|KFA_PICGU Kynurenine formamidase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=BNA7 PE=3 SV=2 23 289 6.0E-25
sp|Q59ZV4|KFA_CANAL Kynurenine formamidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BNA7 PE=3 SV=1 17 255 2.0E-15
sp|A3GGU3|KFA_PICST Kynurenine formamidase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=BNA7 PE=3 SV=2 23 219 3.0E-15
sp|Q6BT11|KFA_DEBHA Kynurenine formamidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BNA7 PE=3 SV=2 24 212 5.0E-13
sp|Q759T3|KFA_ASHGO Kynurenine formamidase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BNA7 PE=3 SV=1 54 296 1.0E-08
sp|Q04066|KFA_YEAST Kynurenine formamidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA7 PE=1 SV=1 44 296 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8261
MKLFAITCCLVAFGATAQQVQFKVMSYGQEKHQEVGVIENDDAQQDTTSQRYWLVFIHGGAWREDNDGVNGFSPT
VEKIMSSSDVPKSKIRGFASIDYRLSPCNEEDQQGKKPCPEGSKVQHPDHILDVRAGLNELQEKYKIDSGYILMG
HSAGATLAFQLLMGKDLLDGQESPDVPLPKAIVGMAGIYDFPQLLKDFTRPFYNLFVTDAYGDDKAVQDKVSPSK
FTGSYKEVWPGNNSVLLAQSPDDGIVNFQQRDNMQAKLEKDGLSVSLQQLTGDHHLVWKEGTQAARLAGQILNQV
DGQPAKANATQA*
Coding >Hirsu2|8261
ATGAAGCTATTCGCTATAACCTGCTGCCTGGTGGCGTTTGGCGCAACGGCGCAACAAGTACAGTTTAAGGTCATG
AGCTATGGCCAGGAAAAGCACCAAGAAGTCGGCGTCATCGAGAATGACGACGCTCAGCAGGACACGACGTCTCAA
CGGTATTGGCTAGTATTCATTCATGGAGGAGCATGGCGAGAAGACAATGATGGCGTCAACGGCTTTTCGCCCACA
GTCGAAAAGATCATGAGTTCGTCGGATGTTCCCAAATCCAAGATTCGCGGATTCGCCAGCATTGACTACCGGCTG
TCGCCATGCAATGAGGAAGACCAGCAGGGGAAGAAACCATGCCCCGAGGGGTCCAAAGTCCAGCACCCTGACCAT
ATCCTGGACGTCCGCGCGGGGCTCAATGAGCTCCAGGAGAAGTACAAGATCGACAGCGGCTATATCCTCATGGGG
CACTCAGCCGGGGCGACATTGGCTTTCCAGCTGCTCATGGGCAAGGACCTTCTCGACGGCCAGGAGTCCCCGGAT
GTCCCGCTGCCAAAGGCTATCGTCGGCATGGCGGGCATATACGACTTCCCACAGCTTCTGAAAGACTTCACGAGA
CCTTTTTACAACCTGTTCGTCACGGATGCGTACGGCGACGACAAAGCGGTCCAGGACAAGGTCTCCCCCTCCAAG
TTCACCGGCAGTTATAAAGAGGTGTGGCCTGGAAATAACTCGGTGCTGTTGGCGCAGTCTCCCGACGACGGAATC
GTCAACTTCCAGCAGCGTGATAACATGCAGGCTAAACTCGAAAAGGATGGCCTGAGTGTGTCCCTGCAGCAGCTT
ACGGGCGACCATCACCTGGTTTGGAAAGAAGGGACTCAAGCTGCTCGGCTCGCCGGCCAGATCCTCAACCAGGTT
GATGGTCAGCCAGCTAAGGCAAATGCCACACAGGCGTGA
Transcript >Hirsu2|8261
ATGAAGCTATTCGCTATAACCTGCTGCCTGGTGGCGTTTGGCGCAACGGCGCAACAAGTACAGTTTAAGGTCATG
AGCTATGGCCAGGAAAAGCACCAAGAAGTCGGCGTCATCGAGAATGACGACGCTCAGCAGGACACGACGTCTCAA
CGGTATTGGCTAGTATTCATTCATGGAGGAGCATGGCGAGAAGACAATGATGGCGTCAACGGCTTTTCGCCCACA
GTCGAAAAGATCATGAGTTCGTCGGATGTTCCCAAATCCAAGATTCGCGGATTCGCCAGCATTGACTACCGGCTG
TCGCCATGCAATGAGGAAGACCAGCAGGGGAAGAAACCATGCCCCGAGGGGTCCAAAGTCCAGCACCCTGACCAT
ATCCTGGACGTCCGCGCGGGGCTCAATGAGCTCCAGGAGAAGTACAAGATCGACAGCGGCTATATCCTCATGGGG
CACTCAGCCGGGGCGACATTGGCTTTCCAGCTGCTCATGGGCAAGGACCTTCTCGACGGCCAGGAGTCCCCGGAT
GTCCCGCTGCCAAAGGCTATCGTCGGCATGGCGGGCATATACGACTTCCCACAGCTTCTGAAAGACTTCACGAGA
CCTTTTTACAACCTGTTCGTCACGGATGCGTACGGCGACGACAAAGCGGTCCAGGACAAGGTCTCCCCCTCCAAG
TTCACCGGCAGTTATAAAGAGGTGTGGCCTGGAAATAACTCGGTGCTGTTGGCGCAGTCTCCCGACGACGGAATC
GTCAACTTCCAGCAGCGTGATAACATGCAGGCTAAACTCGAAAAGGATGGCCTGAGTGTGTCCCTGCAGCAGCTT
ACGGGCGACCATCACCTGGTTTGGAAAGAAGGGACTCAAGCTGCTCGGCTCGCCGGCCAGATCCTCAACCAGGTT
GATGGTCAGCCAGCTAAGGCAAATGCCACACAGGCGTGA
Gene >Hirsu2|8261
ATGAAGCTATTCGCTATAACCTGCTGCCTGGTGGCGTTTGGCGCAACGGCGCAACAAGTACAGTTTAAGGTCATG
AGCTATGGCCAGGAAAAGCACCAAGAAGTCGGCGTCATCGAGAATGACGACGCTCAGCAGGACACGACGTCTCAA
CGGTATTGGCTAGTGTACGTTATATCGCTGGGCAATCCCTTGGGAGTCACTGTTGGCGGCTGACAGCCAAGCCTC
GAAGATTCATTCATGGAGGAGCATGGCGAGAAGACAATGATGGCGTCAACGGCTTTTCGCCCACAGTCGAAAAGA
TCATGAGTTCGTCGGATGTTCCCAAATCCAAGATTCGCGGATTCGCCAGCATTGACTACCGGCTGTCGCCATGCA
ATGAGGAAGACCAGCAGGGGAAGAAACCATGCCCCGAGGGGTCCAAAGTCCAGCACCCTGACCATATCCTGGACG
TCCGCGCGGGGCTCAATGAGCTCCAGGAGAAGTACAAGATCGACAGCGGCTATATCCTCATGGGGCACTCAGCCG
GGGCGACATTGGCTTTCCAGCTGCTCATGGGCAAGGACCTTCTCGACGGCCAGGAGTCCCCGGATGTCCCGCTGC
CAAAGGCTATCGTCGGCATGGCGGGCATATACGACTTCCCACAGCTTCTGAAAGACTTCACGAGACCTTTTTACA
ACCTGTTCGTCACGGATGCGTACGGCGACGACAAAGCGGTCCAGGACAAGGTCTCCCCCTCCAAGTTCACCGGCA
GTTATAAAGAGGTGTGGCCTGGAAATAACTCGGTGCTGTTGGCGCAGTCTCCCGACGACGGAATCGTCAACTTCC
AGCAGCGTGATAACATGCAGGCTAAACTCGAAAAGGATGGCCTGAGTGTGTCCCTGCAGCAGCTTACGGGCGACC
ATCACCTGGTTTGGAAAGAAGGGACTCAAGCTGCTCGGCTCGCCGGCCAGATCCTCAACCAGGTTGATGGTCAGC
CAGCTAAGGCAAATGCCACACAGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail