Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8254
Gene name
LocationContig_526:11265..14848
Strand+
Gene length (bp)3583
Transcript length (bp)3504
Coding sequence length (bp)3504
Protein length (aa) 1168

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13886 DUF4203 Domain of unknown function (DUF4203) 2.5E-55 150 354

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 143 165 22
3 172 194 22
4 204 223 19
5 230 252 22
6 257 274 17
7 281 303 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8254
MLSKAARLWALLLLALALQLAAAQSFNQLWRRQNNPPPFINPRPVPAPAPENTGVRPGSESSSSSAAAASSAPAP
VTDVTTTAASSTGGPSATDSPPESSSTTAASSTDDAAAAATATNEPLVNPKFLNATIPAGQLPLPPEITPGWGVS
GVIMLLTGVIYTLVGIKNRWIHTFFSTAYITALGVAVLIVYVMTVPVSNAVQGGYVVAVVMSGCAVGAASMFFKE
LTEGLGCALGGFCVSMWLLCLVPGGLLRTVPSKAIFIACFTLVGFAFYFSRWTRDWALIVTIAFSGATVTVLGID
CFSRAGLKEFWAYIWDVNGNLFPLGADTYPVTKGIRVETAAIIVIFLMGIISQIKLWRIVRDRREKRAVERAEGQ
RNLELEEENVGRQVEQLNARERRQWERVYGHGTPGSAADSRMTDLGDTGSEKKLRGSNNGSLKRRSSVEVIEMAD
MSESDQSRCGHNPLMAAEEARDGKVTVRVGVDDVPDTPTDVDMCDELDEKVAAMSDRHPVSTPRKRLSQRTTASK
RVSQAQTVTEAPEVVPLPFHVPVMANEAAMSEGDRSSIATFAADDASPGLPPPRQSLAKRLSRGSITLLKSLPQM
SGIGADDFAREVGGSSEELVIPKSHRPDNDNESLVATVDGESVSGDDGRSVRSPDARRSIEINADLSNEKEPAEQ
PDQLSAGPANPDVASLNRTRSSSVAKAGTVATALSGDKVEQQGRGASARASAAGPSSGKPKSTASVSSTRVSLTQ
DRLPRSLSRVAMSYRTNEWAKHLSYAETPEPDEVHVDEPERPAKADRERSVPVDVTELQKTAEEGTPAPAAILRS
ESRASNRSYAHSVSRRASRLDGPAAFPPLERESPARNQASPFATPSPAAGIARVTSSTPVRRSSAGLKDRPAAPL
APNAPVTAIPEQRPEARPISVSLSLAGSEAPQRAPPPAVPGVVSYSSPQTLIGQREMFLRSKSQGNLLAGAAEVP
FVPPPPASDAASVYSTSMYPAPLSTADPDDIPLSQRKQIMRQSSMMSLPQSNPSFTRLPGLESSDSLPFNSHQPK
RMSTLPAQAVREAQLANFRQSVQHDLRSGTPIMSTSGRETPFTPASLLGNREAEVQRNIEMQRNVLMGQKEAEAQ
RKEMQRREKEYVDRAFDERMRTGDLLEAHREAMRKMQKNARE*
Coding >Hirsu2|8254
ATGCTGTCCAAGGCAGCCCGCCTGTGGGCCCTGCTGCTGCTGGCATTGGCCTTGCAGCTTGCCGCCGCCCAGAGC
TTCAACCAGCTCTGGCGGAGACAGAACAATCCGCCGCCCTTCATCAACCCGCGCCCCGTGCCCGCGCCCGCGCCC
GAGAATACCGGCGTCCGACCGGGGAGCGAGAGCAGCAGTAGTAGCGCTGCCGCCGCCTCGTCCGCCCCCGCCCCC
GTCACCGATGTTACAACCACCGCCGCCTCTTCGACCGGGGGACCTTCCGCCACAGATAGTCCGCCTGAATCATCC
TCCACCACCGCCGCCTCCTCCACCGACGATGCCGCCGCCGCCGCCACCGCCACCAACGAGCCCTTGGTCAACCCC
AAGTTTCTGAACGCCACCATTCCCGCCGGCCAGCTCCCGCTCCCGCCCGAGATCACTCCCGGCTGGGGCGTCTCC
GGCGTCATTATGCTTCTCACCGGCGTCATTTACACTCTGGTCGGCATCAAGAACCGGTGGATCCACACCTTCTTT
TCCACCGCCTACATTACCGCCCTCGGTGTCGCCGTCCTCATCGTCTATGTTATGACCGTGCCCGTCAGCAACGCC
GTCCAGGGCGGCTACGTCGTCGCCGTCGTCATGTCGGGATGCGCCGTTGGCGCTGCCTCCATGTTCTTCAAGGAG
CTCACCGAGGGCCTCGGATGCGCCCTCGGCGGCTTCTGCGTTAGCATGTGGCTGCTGTGCCTGGTACCCGGCGGC
CTGCTCCGCACCGTCCCCTCCAAGGCCATCTTCATCGCCTGCTTCACCCTCGTCGGTTTCGCCTTTTACTTCAGC
CGTTGGACGCGAGACTGGGCCCTCATCGTCACCATTGCCTTTTCCGGCGCTACCGTCACCGTCCTCGGCATCGAC
TGCTTCAGCCGCGCTGGTCTCAAGGAGTTTTGGGCCTACATCTGGGACGTCAACGGCAACCTGTTCCCGCTCGGA
GCCGACACCTACCCCGTCACCAAGGGAATCCGCGTCGAAACGGCCGCCATCATCGTCATCTTTCTCATGGGTATC
ATTTCCCAGATCAAGCTGTGGAGGATTGTGCGCGACAGGCGGGAGAAGAGGGCCGTCGAGCGCGCCGAGGGACAG
CGGAATCTCGAGCTGGAGGAGGAGAACGTGGGCCGCCAGGTCGAGCAGCTCAACGCTCGCGAGCGTCGCCAGTGG
GAACGCGTCTACGGCCACGGCACCCCTGGCAGCGCCGCCGACTCCCGCATGACGGATCTTGGCGACACGGGAAGC
GAGAAGAAGCTTCGGGGCAGCAACAATGGATCCCTCAAGCGGCGCTCTTCCGTCGAGGTCATCGAGATGGCCGAC
ATGTCCGAGTCCGATCAGTCGCGATGCGGCCACAACCCCCTGATGGCTGCCGAGGAGGCGCGCGATGGCAAGGTC
ACCGTGCGCGTCGGTGTCGACGACGTCCCCGACACGCCGACCGACGTGGACATGTGCGATGAGCTGGACGAAAAG
GTGGCCGCCATGAGCGACAGGCATCCCGTATCGACGCCGCGCAAAAGGCTGTCCCAGAGGACCACGGCGAGCAAG
CGAGTCTCCCAGGCCCAGACGGTGACCGAGGCACCCGAGGTCGTTCCGCTTCCTTTCCACGTGCCCGTCATGGCC
AACGAGGCCGCCATGTCAGAGGGTGATCGATCGTCCATAGCGACCTTCGCGGCCGACGACGCATCCCCTGGCCTC
CCCCCACCGCGCCAGTCACTGGCCAAGCGGCTTTCGCGGGGCTCCATCACCCTGCTCAAGAGCCTCCCTCAGATG
TCAGGGATCGGGGCTGACGACTTCGCGCGCGAGGTCGGCGGCAGCTCCGAGGAGCTGGTCATTCCCAAGTCTCAC
CGGCCCGACAATGACAATGAATCGCTGGTAGCTACTGTGGACGGAGAGAGCGTCAGCGGGGACGACGGTCGCTCC
GTCCGCAGCCCAGATGCGCGCAGGAGCATCGAGATCAACGCCGACCTTTCCAACGAGAAGGAGCCGGCCGAGCAG
CCGGATCAACTGAGCGCTGGCCCTGCCAACCCTGATGTGGCTTCGCTGAATCGCACCAGATCGAGCTCTGTTGCC
AAGGCCGGGACGGTAGCGACGGCGCTCTCGGGCGACAAGGTCGAGCAGCAGGGCCGTGGCGCCTCTGCCCGTGCT
TCTGCCGCCGGGCCCTCGTCTGGGAAACCCAAGTCTACGGCGTCGGTCTCGTCGACGCGCGTGAGCCTGACCCAA
GATCGCCTGCCGCGCTCCCTCTCCCGGGTCGCCATGTCGTACCGCACCAATGAATGGGCCAAGCATCTCAGCTAC
GCCGAGACCCCCGAGCCCGACGAGGTGCATGTCGACGAGCCTGAGCGACCTGCCAAGGCGGACAGGGAGAGATCC
GTCCCCGTCGACGTGACGGAGCTCCAGAAGACGGCGGAGGAAGGGACGCCGGCACCGGCGGCGATTCTGCGGTCC
GAGTCGCGCGCCTCGAACCGGTCGTACGCCCACAGCGTTTCGCGACGAGCCTCCAGACTCGACGGCCCCGCGGCC
TTCCCTCCACTAGAGAGGGAGTCGCCTGCCCGGAACCAAGCCTCACCTTTTGCGACGCCGAGCCCCGCAGCCGGC
ATCGCGCGCGTCACGTCGTCGACGCCCGTGCGGAGGTCCTCGGCGGGACTTAAGGACAGGCCGGCCGCCCCGTTG
GCGCCCAACGCCCCGGTCACGGCCATTCCTGAGCAGCGGCCGGAAGCCAGGCCCATTTCTGTCAGCCTATCGCTA
GCCGGAAGCGAGGCGCCACAACGTGCTCCGCCCCCGGCGGTGCCTGGCGTGGTGTCGTATAGCAGTCCCCAGACG
CTCATTGGGCAACGCGAGATGTTCCTGCGGAGCAAGTCCCAGGGCAACCTGCTCGCCGGCGCAGCCGAGGTCCCG
TTCGTGCCACCGCCGCCGGCGAGCGACGCCGCCTCCGTCTACAGCACGTCGATGTATCCGGCGCCGCTCAGCACC
GCCGACCCCGACGACATTCCCCTCAGCCAGCGGAAGCAAATCATGCGCCAGAGCAGCATGATGTCCCTGCCGCAG
TCGAACCCGTCCTTCACGCGCCTGCCCGGCCTCGAAAGCTCCGACAGCCTCCCCTTCAACTCGCACCAGCCCAAG
AGGATGTCGACGCTGCCCGCGCAAGCCGTGCGCGAGGCGCAGCTCGCCAACTTCCGACAGTCGGTGCAGCACGAC
CTCCGCTCAGGAACACCCATCATGTCCACCTCGGGCCGCGAAACGCCCTTCACGCCCGCGTCGCTGCTGGGCAAC
CGCGAGGCTGAAGTGCAGCGCAACATCGAGATGCAGCGAAATGTGCTCATGGGCCAGAAGGAGGCCGAGGCCCAG
CGCAAGGAGATGCAGCGGCGCGAAAAGGAGTACGTGGACCGGGCCTTCGACGAGCGGATGCGCACCGGCGACCTG
CTCGAGGCCCACCGGGAGGCGATGCGCAAGATGCAGAAAAACGCTCGCGAGTGA
Transcript >Hirsu2|8254
ATGCTGTCCAAGGCAGCCCGCCTGTGGGCCCTGCTGCTGCTGGCATTGGCCTTGCAGCTTGCCGCCGCCCAGAGC
TTCAACCAGCTCTGGCGGAGACAGAACAATCCGCCGCCCTTCATCAACCCGCGCCCCGTGCCCGCGCCCGCGCCC
GAGAATACCGGCGTCCGACCGGGGAGCGAGAGCAGCAGTAGTAGCGCTGCCGCCGCCTCGTCCGCCCCCGCCCCC
GTCACCGATGTTACAACCACCGCCGCCTCTTCGACCGGGGGACCTTCCGCCACAGATAGTCCGCCTGAATCATCC
TCCACCACCGCCGCCTCCTCCACCGACGATGCCGCCGCCGCCGCCACCGCCACCAACGAGCCCTTGGTCAACCCC
AAGTTTCTGAACGCCACCATTCCCGCCGGCCAGCTCCCGCTCCCGCCCGAGATCACTCCCGGCTGGGGCGTCTCC
GGCGTCATTATGCTTCTCACCGGCGTCATTTACACTCTGGTCGGCATCAAGAACCGGTGGATCCACACCTTCTTT
TCCACCGCCTACATTACCGCCCTCGGTGTCGCCGTCCTCATCGTCTATGTTATGACCGTGCCCGTCAGCAACGCC
GTCCAGGGCGGCTACGTCGTCGCCGTCGTCATGTCGGGATGCGCCGTTGGCGCTGCCTCCATGTTCTTCAAGGAG
CTCACCGAGGGCCTCGGATGCGCCCTCGGCGGCTTCTGCGTTAGCATGTGGCTGCTGTGCCTGGTACCCGGCGGC
CTGCTCCGCACCGTCCCCTCCAAGGCCATCTTCATCGCCTGCTTCACCCTCGTCGGTTTCGCCTTTTACTTCAGC
CGTTGGACGCGAGACTGGGCCCTCATCGTCACCATTGCCTTTTCCGGCGCTACCGTCACCGTCCTCGGCATCGAC
TGCTTCAGCCGCGCTGGTCTCAAGGAGTTTTGGGCCTACATCTGGGACGTCAACGGCAACCTGTTCCCGCTCGGA
GCCGACACCTACCCCGTCACCAAGGGAATCCGCGTCGAAACGGCCGCCATCATCGTCATCTTTCTCATGGGTATC
ATTTCCCAGATCAAGCTGTGGAGGATTGTGCGCGACAGGCGGGAGAAGAGGGCCGTCGAGCGCGCCGAGGGACAG
CGGAATCTCGAGCTGGAGGAGGAGAACGTGGGCCGCCAGGTCGAGCAGCTCAACGCTCGCGAGCGTCGCCAGTGG
GAACGCGTCTACGGCCACGGCACCCCTGGCAGCGCCGCCGACTCCCGCATGACGGATCTTGGCGACACGGGAAGC
GAGAAGAAGCTTCGGGGCAGCAACAATGGATCCCTCAAGCGGCGCTCTTCCGTCGAGGTCATCGAGATGGCCGAC
ATGTCCGAGTCCGATCAGTCGCGATGCGGCCACAACCCCCTGATGGCTGCCGAGGAGGCGCGCGATGGCAAGGTC
ACCGTGCGCGTCGGTGTCGACGACGTCCCCGACACGCCGACCGACGTGGACATGTGCGATGAGCTGGACGAAAAG
GTGGCCGCCATGAGCGACAGGCATCCCGTATCGACGCCGCGCAAAAGGCTGTCCCAGAGGACCACGGCGAGCAAG
CGAGTCTCCCAGGCCCAGACGGTGACCGAGGCACCCGAGGTCGTTCCGCTTCCTTTCCACGTGCCCGTCATGGCC
AACGAGGCCGCCATGTCAGAGGGTGATCGATCGTCCATAGCGACCTTCGCGGCCGACGACGCATCCCCTGGCCTC
CCCCCACCGCGCCAGTCACTGGCCAAGCGGCTTTCGCGGGGCTCCATCACCCTGCTCAAGAGCCTCCCTCAGATG
TCAGGGATCGGGGCTGACGACTTCGCGCGCGAGGTCGGCGGCAGCTCCGAGGAGCTGGTCATTCCCAAGTCTCAC
CGGCCCGACAATGACAATGAATCGCTGGTAGCTACTGTGGACGGAGAGAGCGTCAGCGGGGACGACGGTCGCTCC
GTCCGCAGCCCAGATGCGCGCAGGAGCATCGAGATCAACGCCGACCTTTCCAACGAGAAGGAGCCGGCCGAGCAG
CCGGATCAACTGAGCGCTGGCCCTGCCAACCCTGATGTGGCTTCGCTGAATCGCACCAGATCGAGCTCTGTTGCC
AAGGCCGGGACGGTAGCGACGGCGCTCTCGGGCGACAAGGTCGAGCAGCAGGGCCGTGGCGCCTCTGCCCGTGCT
TCTGCCGCCGGGCCCTCGTCTGGGAAACCCAAGTCTACGGCGTCGGTCTCGTCGACGCGCGTGAGCCTGACCCAA
GATCGCCTGCCGCGCTCCCTCTCCCGGGTCGCCATGTCGTACCGCACCAATGAATGGGCCAAGCATCTCAGCTAC
GCCGAGACCCCCGAGCCCGACGAGGTGCATGTCGACGAGCCTGAGCGACCTGCCAAGGCGGACAGGGAGAGATCC
GTCCCCGTCGACGTGACGGAGCTCCAGAAGACGGCGGAGGAAGGGACGCCGGCACCGGCGGCGATTCTGCGGTCC
GAGTCGCGCGCCTCGAACCGGTCGTACGCCCACAGCGTTTCGCGACGAGCCTCCAGACTCGACGGCCCCGCGGCC
TTCCCTCCACTAGAGAGGGAGTCGCCTGCCCGGAACCAAGCCTCACCTTTTGCGACGCCGAGCCCCGCAGCCGGC
ATCGCGCGCGTCACGTCGTCGACGCCCGTGCGGAGGTCCTCGGCGGGACTTAAGGACAGGCCGGCCGCCCCGTTG
GCGCCCAACGCCCCGGTCACGGCCATTCCTGAGCAGCGGCCGGAAGCCAGGCCCATTTCTGTCAGCCTATCGCTA
GCCGGAAGCGAGGCGCCACAACGTGCTCCGCCCCCGGCGGTGCCTGGCGTGGTGTCGTATAGCAGTCCCCAGACG
CTCATTGGGCAACGCGAGATGTTCCTGCGGAGCAAGTCCCAGGGCAACCTGCTCGCCGGCGCAGCCGAGGTCCCG
TTCGTGCCACCGCCGCCGGCGAGCGACGCCGCCTCCGTCTACAGCACGTCGATGTATCCGGCGCCGCTCAGCACC
GCCGACCCCGACGACATTCCCCTCAGCCAGCGGAAGCAAATCATGCGCCAGAGCAGCATGATGTCCCTGCCGCAG
TCGAACCCGTCCTTCACGCGCCTGCCCGGCCTCGAAAGCTCCGACAGCCTCCCCTTCAACTCGCACCAGCCCAAG
AGGATGTCGACGCTGCCCGCGCAAGCCGTGCGCGAGGCGCAGCTCGCCAACTTCCGACAGTCGGTGCAGCACGAC
CTCCGCTCAGGAACACCCATCATGTCCACCTCGGGCCGCGAAACGCCCTTCACGCCCGCGTCGCTGCTGGGCAAC
CGCGAGGCTGAAGTGCAGCGCAACATCGAGATGCAGCGAAATGTGCTCATGGGCCAGAAGGAGGCCGAGGCCCAG
CGCAAGGAGATGCAGCGGCGCGAAAAGGAGTACGTGGACCGGGCCTTCGACGAGCGGATGCGCACCGGCGACCTG
CTCGAGGCCCACCGGGAGGCGATGCGCAAGATGCAGAAAAACGCTCGCGAGTGA
Gene >Hirsu2|8254
ATGCTGTCCAAGGCAGCCCGCCTGTGGGCCCTGCTGCTGCTGGCATTGGCCTTGCAGCTTGCCGCCGCCCAGAGC
TTCAACCAGCTCTGGCGGAGACAGAACAATCCGCCGCCCTTCATCAACCCGCGCCCCGTGCCCGCGCCCGCGCCC
GAGAATACCGGCGTCCGACCGGGGAGCGAGAGCAGCAGTAGTAGCGCTGCCGCCGCCTCGTCCGCCCCCGCCCCC
GTCACCGATGTTACAACCACCGCCGCCTCTTCGACCGGGGGACCTTCCGCCACAGATAGTCCGCCTGAATCATCC
TCCACCACCGCCGCCTCCTCCACCGACGATGCCGCCGCCGCCGCCACCGCCACCAACGAGCCCTTGGTCAACCCC
AAGTTTCTGAACGGTATGGCTGACTGCCCCGTCCCTGAGCCCCGCCCCGGACACCCCCCCGGGCCCCGATGACTG
ACCTGCCCCGGACACAGCCACCATTCCCGCCGGCCAGCTCCCGCTCCCGCCCGAGATCACTCCCGGCTGGGGCGT
CTCCGGCGTCATTATGCTTCTCACCGGCGTCATTTACACTCTGGTCGGCATCAAGAACCGGTGGATCCACACCTT
CTTTTCCACCGCCTACATTACCGCCCTCGGTGTCGCCGTCCTCATCGTCTATGTTATGACCGTGCCCGTCAGCAA
CGCCGTCCAGGGCGGCTACGTCGTCGCCGTCGTCATGTCGGGATGCGCCGTTGGCGCTGCCTCCATGTTCTTCAA
GGAGCTCACCGAGGGCCTCGGATGCGCCCTCGGCGGCTTCTGCGTTAGCATGTGGCTGCTGTGCCTGGTACCCGG
CGGCCTGCTCCGCACCGTCCCCTCCAAGGCCATCTTCATCGCCTGCTTCACCCTCGTCGGTTTCGCCTTTTACTT
CAGCCGTTGGACGCGAGACTGGGCCCTCATCGTCACCATTGCCTTTTCCGGCGCTACCGTCACCGTCCTCGGCAT
CGACTGCTTCAGCCGCGCTGGTCTCAAGGAGTTTTGGGCCTACATCTGGGACGTCAACGGCAACCTGTTCCCGCT
CGGAGCCGACACCTACCCCGTCACCAAGGGAATCCGCGTCGAAACGGCCGCCATCATCGTCATCTTTCTCATGGG
TATCATTTCCCAGATCAAGCTGTGGAGGATTGTGCGCGACAGGCGGGAGAAGAGGGCCGTCGAGCGCGCCGAGGG
ACAGCGGAATCTCGAGCTGGAGGAGGAGAACGTGGGCCGCCAGGTCGAGCAGCTCAACGCTCGCGAGCGTCGCCA
GTGGGAACGCGTCTACGGCCACGGCACCCCTGGCAGCGCCGCCGACTCCCGCATGACGGATCTTGGCGACACGGG
AAGCGAGAAGAAGCTTCGGGGCAGCAACAATGGATCCCTCAAGCGGCGCTCTTCCGTCGAGGTCATCGAGATGGC
CGACATGTCCGAGTCCGATCAGTCGCGATGCGGCCACAACCCCCTGATGGCTGCCGAGGAGGCGCGCGATGGCAA
GGTCACCGTGCGCGTCGGTGTCGACGACGTCCCCGACACGCCGACCGACGTGGACATGTGCGATGAGCTGGACGA
AAAGGTGGCCGCCATGAGCGACAGGCATCCCGTATCGACGCCGCGCAAAAGGCTGTCCCAGAGGACCACGGCGAG
CAAGCGAGTCTCCCAGGCCCAGACGGTGACCGAGGCACCCGAGGTCGTTCCGCTTCCTTTCCACGTGCCCGTCAT
GGCCAACGAGGCCGCCATGTCAGAGGGTGATCGATCGTCCATAGCGACCTTCGCGGCCGACGACGCATCCCCTGG
CCTCCCCCCACCGCGCCAGTCACTGGCCAAGCGGCTTTCGCGGGGCTCCATCACCCTGCTCAAGAGCCTCCCTCA
GATGTCAGGGATCGGGGCTGACGACTTCGCGCGCGAGGTCGGCGGCAGCTCCGAGGAGCTGGTCATTCCCAAGTC
TCACCGGCCCGACAATGACAATGAATCGCTGGTAGCTACTGTGGACGGAGAGAGCGTCAGCGGGGACGACGGTCG
CTCCGTCCGCAGCCCAGATGCGCGCAGGAGCATCGAGATCAACGCCGACCTTTCCAACGAGAAGGAGCCGGCCGA
GCAGCCGGATCAACTGAGCGCTGGCCCTGCCAACCCTGATGTGGCTTCGCTGAATCGCACCAGATCGAGCTCTGT
TGCCAAGGCCGGGACGGTAGCGACGGCGCTCTCGGGCGACAAGGTCGAGCAGCAGGGCCGTGGCGCCTCTGCCCG
TGCTTCTGCCGCCGGGCCCTCGTCTGGGAAACCCAAGTCTACGGCGTCGGTCTCGTCGACGCGCGTGAGCCTGAC
CCAAGATCGCCTGCCGCGCTCCCTCTCCCGGGTCGCCATGTCGTACCGCACCAATGAATGGGCCAAGCATCTCAG
CTACGCCGAGACCCCCGAGCCCGACGAGGTGCATGTCGACGAGCCTGAGCGACCTGCCAAGGCGGACAGGGAGAG
ATCCGTCCCCGTCGACGTGACGGAGCTCCAGAAGACGGCGGAGGAAGGGACGCCGGCACCGGCGGCGATTCTGCG
GTCCGAGTCGCGCGCCTCGAACCGGTCGTACGCCCACAGCGTTTCGCGACGAGCCTCCAGACTCGACGGCCCCGC
GGCCTTCCCTCCACTAGAGAGGGAGTCGCCTGCCCGGAACCAAGCCTCACCTTTTGCGACGCCGAGCCCCGCAGC
CGGCATCGCGCGCGTCACGTCGTCGACGCCCGTGCGGAGGTCCTCGGCGGGACTTAAGGACAGGCCGGCCGCCCC
GTTGGCGCCCAACGCCCCGGTCACGGCCATTCCTGAGCAGCGGCCGGAAGCCAGGCCCATTTCTGTCAGCCTATC
GCTAGCCGGAAGCGAGGCGCCACAACGTGCTCCGCCCCCGGCGGTGCCTGGCGTGGTGTCGTATAGCAGTCCCCA
GACGCTCATTGGGCAACGCGAGATGTTCCTGCGGAGCAAGTCCCAGGGCAACCTGCTCGCCGGCGCAGCCGAGGT
CCCGTTCGTGCCACCGCCGCCGGCGAGCGACGCCGCCTCCGTCTACAGCACGTCGATGTATCCGGCGCCGCTCAG
CACCGCCGACCCCGACGACATTCCCCTCAGCCAGCGGAAGCAAATCATGCGCCAGAGCAGCATGATGTCCCTGCC
GCAGTCGAACCCGTCCTTCACGCGCCTGCCCGGCCTCGAAAGCTCCGACAGCCTCCCCTTCAACTCGCACCAGCC
CAAGAGGATGTCGACGCTGCCCGCGCAAGCCGTGCGCGAGGCGCAGCTCGCCAACTTCCGACAGTCGGTGCAGCA
CGACCTCCGCTCAGGAACACCCATCATGTCCACCTCGGGCCGCGAAACGCCCTTCACGCCCGCGTCGCTGCTGGG
CAACCGCGAGGCTGAAGTGCAGCGCAACATCGAGATGCAGCGAAATGTGCTCATGGGCCAGAAGGAGGCCGAGGC
CCAGCGCAAGGAGATGCAGCGGCGCGAAAAGGAGTACGTGGACCGGGCCTTCGACGAGCGGATGCGCACCGGCGA
CCTGCTCGAGGCCCACCGGGAGGCGATGCGCAAGATGCAGAAAAACGCTCGCGAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail