Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8243
Gene name
LocationContig_524:13944..17168
Strand+
Gene length (bp)3224
Transcript length (bp)2976
Coding sequence length (bp)2976
Protein length (aa) 992

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 1.3E-46 148 357
PF01061 ABC2_membrane ABC-2 type transporter 4.6E-22 824 973
PF06422 PDR_CDR CDR ABC transporter 2.8E-25 370 456
PF00005 ABC_tran ABC transporter 5.7E-20 526 677

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 4 974 0.0E+00
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 5 987 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 4 974 0.0E+00
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 1 975 0.0E+00
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 1 973 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 4 974 0.0E+00
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 5 987 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 4 974 0.0E+00
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 1 975 0.0E+00
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 1 973 0.0E+00
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 1 975 0.0E+00
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 1 975 0.0E+00
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 4 974 0.0E+00
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 1 973 0.0E+00
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 1 952 0.0E+00
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 3 970 0.0E+00
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 1 973 0.0E+00
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 1 974 0.0E+00
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 3 956 0.0E+00
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 11 955 0.0E+00
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 3 956 0.0E+00
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 4 970 0.0E+00
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 1 952 0.0E+00
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 8 948 0.0E+00
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 1 975 0.0E+00
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 2 956 0.0E+00
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 9 973 9.0E-148
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 8 973 2.0E-143
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 1 986 1.0E-125
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 1 948 1.0E-119
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 4 969 4.0E-109
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 7 766 2.0E-108
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 1 964 2.0E-107
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 9 948 5.0E-106
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 1 964 2.0E-105
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 10 964 2.0E-105
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 4 962 3.0E-105
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 10 972 6.0E-105
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 4 948 9.0E-105
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 4 969 2.0E-104
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 4 969 6.0E-104
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 4 948 3.0E-103
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 10 948 1.0E-102
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 1 973 4.0E-102
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 10 948 6.0E-102
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 4 948 2.0E-101
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 1 962 7.0E-101
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 9 973 1.0E-100
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 4 973 3.0E-100
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 1 948 9.0E-100
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 11 964 1.0E-99
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 4 948 1.0E-99
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 10 969 1.0E-99
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 10 968 5.0E-99
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 10 969 6.0E-99
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 10 948 9.0E-99
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 10 973 1.0E-97
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 5 948 2.0E-97
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 1 948 5.0E-97
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 1 954 5.0E-97
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 4 987 8.0E-97
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 4 987 2.0E-96
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 1 948 1.0E-95
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 10 947 3.0E-95
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 1 964 9.0E-95
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 10 972 1.0E-92
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 4 948 1.0E-91
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 2 988 2.0E-90
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 2 988 8.0E-90
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 10 948 2.0E-88
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 1 765 2.0E-85
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 10 978 3.0E-80
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 507 948 5.0E-72
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 508 969 8.0E-71
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 508 968 6.0E-66
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 508 972 3.0E-65
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 505 973 7.0E-63
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 505 969 3.0E-62
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 506 971 2.0E-54
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 507 948 6.0E-54
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 506 948 6.0E-52
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 523 946 2.0E-51
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 489 948 1.0E-50
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 506 963 5.0E-50
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 509 948 8.0E-50
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 506 971 3.0E-49
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 497 928 1.0E-48
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 505 981 4.0E-48
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 509 948 4.0E-48
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 506 981 5.0E-48
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 490 973 2.0E-47
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 499 771 4.0E-47
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 505 981 1.0E-46
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 470 948 1.0E-46
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 470 948 1.0E-46
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 519 960 3.0E-46
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 523 953 2.0E-45
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 505 948 3.0E-45
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 506 948 3.0E-45
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 518 969 3.0E-45
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 459 775 4.0E-45
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 508 961 4.0E-45
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 502 948 8.0E-45
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 505 792 1.0E-44
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 465 954 2.0E-44
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 518 948 4.0E-44
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 466 953 4.0E-44
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 490 766 5.0E-44
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 511 954 7.0E-44
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 499 954 1.0E-43
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 509 948 2.0E-43
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 502 776 2.0E-43
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 508 948 5.0E-43
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 466 953 5.0E-43
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 510 948 7.0E-43
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 490 948 1.0E-42
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 507 772 1.0E-42
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 509 973 2.0E-42
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 525 973 4.0E-42
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 515 970 4.0E-42
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 520 863 8.0E-42
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 470 954 2.0E-41
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 507 787 5.0E-41
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 525 948 9.0E-41
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 523 956 2.0E-40
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 493 973 4.0E-40
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 510 929 4.0E-40
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 505 958 1.0E-39
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 510 832 1.0E-39
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 509 827 3.0E-39
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 493 950 2.0E-38
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 510 929 2.0E-38
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 505 766 1.0E-37
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 485 863 3.0E-37
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 525 983 1.0E-36
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 522 930 2.0E-36
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 522 775 2.0E-36
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 510 948 3.0E-36
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 507 948 3.0E-36
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 533 768 7.0E-36
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 533 938 7.0E-36
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 522 766 9.0E-36
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 494 804 1.0E-35
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 452 767 3.0E-35
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 533 768 7.0E-35
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 536 844 6.0E-34
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 460 948 3.0E-33
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 508 802 2.0E-32
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 525 954 5.0E-32
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 9 433 1.0E-31
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 9 433 1.0E-28
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 503 951 2.0E-28
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 10 357 2.0E-27
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 516 840 3.0E-27
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 494 901 5.0E-27
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 525 984 6.0E-27
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 525 967 7.0E-27
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 525 964 8.0E-27
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 503 770 8.0E-27
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 1 360 3.0E-26
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 517 770 4.0E-26
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 525 954 9.0E-26
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 518 953 1.0E-25
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 6 430 2.0E-25
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 521 732 3.0E-25
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 525 770 3.0E-25
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 525 770 3.0E-25
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 6 430 4.0E-25
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 519 770 4.0E-25
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 6 430 7.0E-25
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 525 954 1.0E-24
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 525 963 2.0E-24
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 525 953 2.0E-24
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 525 964 3.0E-24
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 525 964 3.0E-24
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 6 430 3.0E-24
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 6 430 4.0E-24
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 6 430 4.0E-24
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 513 990 5.0E-24
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 519 770 6.0E-24
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 504 770 1.0E-23
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 525 964 1.0E-23
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 513 954 1.0E-23
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 10 357 1.0E-23
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 461 860 3.0E-23
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 525 770 4.0E-23
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 525 770 6.0E-23
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 525 947 7.0E-23
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 525 972 7.0E-23
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 525 770 9.0E-23
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 525 962 9.0E-23
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 525 967 1.0E-22
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 525 770 1.0E-22
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 525 770 2.0E-22
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 525 989 3.0E-22
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 525 990 3.0E-22
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 525 770 3.0E-22
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 525 768 3.0E-22
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 525 781 3.0E-22
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 525 962 4.0E-22
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 525 770 8.0E-22
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 525 770 9.0E-22
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 511 770 1.0E-21
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 525 770 2.0E-21
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 525 770 3.0E-21
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 525 770 3.0E-21
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 523 963 5.0E-21
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 525 963 1.0E-20
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 525 963 3.0E-20
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 493 695 4.0E-20
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 4 378 5.0E-20
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 6 437 8.0E-20
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 6 357 1.0E-19
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 525 770 1.0E-19
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 509 695 2.0E-19
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 500 770 3.0E-19
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 6 363 5.0E-19
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 439 978 1.0E-18
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 6 427 2.0E-18
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 525 978 2.0E-18
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 6 396 2.0E-18
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 525 759 3.0E-18
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 453 978 1.0E-17
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 525 987 1.0E-17
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 6 357 1.0E-17
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 6 363 2.0E-17
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 6 363 2.0E-17
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 6 357 2.0E-17
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 1 438 3.0E-17
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 6 432 4.0E-17
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 525 948 5.0E-17
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 6 359 5.0E-17
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 6 357 5.0E-17
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 525 948 6.0E-17
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 6 361 7.0E-17
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 6 369 1.0E-16
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 6 360 1.0E-16
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 6 368 1.0E-16
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 453 759 4.0E-16
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 514 766 4.0E-16
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 6 357 4.0E-16
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 6 369 8.0E-16
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 6 357 8.0E-16
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 1 433 8.0E-16
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 10 395 9.0E-16
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 6 357 9.0E-16
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 522 740 1.0E-15
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 484 725 1.0E-15
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 6 357 1.0E-15
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 10 395 2.0E-15
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 522 725 2.0E-15
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 6 359 2.0E-15
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 515 727 3.0E-15
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 6 360 3.0E-15
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 494 770 3.0E-15
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 6 363 4.0E-15
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 6 377 4.0E-15
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 6 412 6.0E-15
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 6 368 6.0E-15
sp|Q9Z3I3|NODI_BRASS Nod factor export ATP-binding protein I OS=Bradyrhizobium sp. (strain SNU001) GN=nodI PE=3 SV=1 516 706 6.0E-15
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 522 759 7.0E-15
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 525 963 7.0E-15
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 496 725 7.0E-15
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 6 373 1.0E-14
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 525 963 1.0E-14
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 522 706 1.0E-14
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 522 706 1.0E-14
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 522 706 1.0E-14
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 6 363 1.0E-14
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 6 357 1.0E-14
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 586 917 2.0E-14
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 10 367 2.0E-14
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 496 725 2.0E-14
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 496 725 2.0E-14
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 521 727 2.0E-14
sp|Q8TIW9|Y4021_METAC Putative ABC transporter ATP-binding protein MA_4021 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4021 PE=3 SV=1 505 734 2.0E-14
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 6 351 3.0E-14
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 525 732 3.0E-14
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 496 725 3.0E-14
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 496 725 3.0E-14
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 496 725 3.0E-14
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 1 431 4.0E-14
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 10 375 4.0E-14
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 496 725 4.0E-14
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 496 725 4.0E-14
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 496 725 4.0E-14
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 516 727 5.0E-14
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 496 725 5.0E-14
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 496 725 5.0E-14
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 496 725 5.0E-14
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 6 357 5.0E-14
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 525 963 6.0E-14
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 496 725 6.0E-14
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 496 725 6.0E-14
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 496 725 6.0E-14
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 496 725 6.0E-14
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 6 357 6.0E-14
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 6 356 7.0E-14
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 510 732 7.0E-14
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 6 357 7.0E-14
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 6 370 8.0E-14
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 496 725 8.0E-14
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 515 939 9.0E-14
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 510 756 9.0E-14
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 510 760 9.0E-14
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 6 437 1.0E-13
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 6 437 1.0E-13
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 6 426 1.0E-13
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 6 360 1.0E-13
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 6 357 1.0E-13
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 6 417 2.0E-13
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 6 357 2.0E-13
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 521 725 2.0E-13
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 525 726 2.0E-13
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 491 732 2.0E-13
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 491 732 2.0E-13
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 491 732 2.0E-13
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 525 960 3.0E-13
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 6 465 3.0E-13
sp|Q7NRX5|UGPC_CHRVO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ugpC PE=3 SV=1 507 736 3.0E-13
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 6 368 4.0E-13
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 6 419 4.0E-13
sp|Q13ZJ1|NODI_BURXL Nod factor export ATP-binding protein I OS=Burkholderia xenovorans (strain LB400) GN=nodI PE=3 SV=1 516 706 4.0E-13
sp|Q1LKJ2|NODI_CUPMC Nod factor export ATP-binding protein I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nodI PE=3 SV=1 504 706 4.0E-13
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 520 732 5.0E-13
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 6 437 6.0E-13
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 10 369 7.0E-13
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 6 357 8.0E-13
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 6 359 9.0E-13
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 484 725 9.0E-13
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 495 727 1.0E-12
sp|Q92AF9|MNTB_LISIN Manganese transport system ATP-binding protein MntB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mntB PE=3 SV=1 522 724 1.0E-12
sp|Q399M3|MACB_BURL3 Macrolide export ATP-binding/permease protein MacB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=macB PE=3 SV=1 510 715 1.0E-12
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 6 357 1.0E-12
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 6 364 2.0E-12
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 6 372 2.0E-12
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 6 357 2.0E-12
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 520 732 2.0E-12
sp|Q7NX01|CYSA1_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA1 PE=3 SV=1 515 725 2.0E-12
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 510 706 2.0E-12
sp|P42360|YSC1_STRGN Uncharacterized ABC transporter ATP-binding protein in scaA 5'region OS=Streptococcus gordonii PE=3 SV=1 523 732 2.0E-12
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 510 706 2.0E-12
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 6 357 2.0E-12
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 6 368 3.0E-12
sp|Q83HT1|PSTB_TROW8 Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain TW08/27) GN=pstB PE=3 SV=1 526 726 3.0E-12
sp|Q1BPZ6|MACB_BURCA Macrolide export ATP-binding/permease protein MacB OS=Burkholderia cenocepacia (strain AU 1054) GN=macB PE=3 SV=2 510 725 5.0E-12
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 496 733 5.0E-12
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 6 344 5.0E-12
sp|A0B212|MACB_BURCH Macrolide export ATP-binding/permease protein MacB OS=Burkholderia cenocepacia (strain HI2424) GN=macB PE=3 SV=1 510 715 6.0E-12
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 5 357 6.0E-12
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 1 370 7.0E-12
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 534 725 7.0E-12
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 501 725 7.0E-12
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 510 706 7.0E-12
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 495 732 7.0E-12
sp|Q2SXD1|LOLD_BURTA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=lolD PE=3 SV=1 525 725 8.0E-12
sp|Q83GE8|PSTB_TROWT Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain Twist) GN=pstB PE=3 SV=2 526 726 8.0E-12
sp|O52618|NODI_RHIME Nod factor export ATP-binding protein I OS=Rhizobium meliloti (strain 1021) GN=nodI PE=3 SV=3 521 727 8.0E-12
sp|Q8G7F4|PSTB_BIFLO Phosphate import ATP-binding protein PstB OS=Bifidobacterium longum (strain NCC 2705) GN=pstB PE=3 SV=1 521 750 9.0E-12
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 533 725 9.0E-12
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 6 442 1.0E-11
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 6 357 1.0E-11
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 526 794 1.0E-11
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 510 725 1.0E-11
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 536 725 1.0E-11
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 495 683 1.0E-11
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 495 683 1.0E-11
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 495 683 1.0E-11
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 495 683 1.0E-11
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 496 732 1.0E-11
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 6 368 1.0E-11
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 507 725 2.0E-11
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 526 739 2.0E-11
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 493 749 2.0E-11
sp|Q7UX73|LOLD1_RHOBA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lolD1 PE=3 SV=1 520 747 2.0E-11
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 507 725 2.0E-11
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 495 747 2.0E-11
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 515 726 2.0E-11
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 6 357 2.0E-11
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 1 439 3.0E-11
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 6 372 3.0E-11
sp|Q92NU9|MACB_RHIME Macrolide export ATP-binding/permease protein MacB OS=Rhizobium meliloti (strain 1021) GN=macB PE=3 SV=1 533 725 3.0E-11
sp|A1SWH9|UGPC_PSYIN sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Psychromonas ingrahamii (strain 37) GN=ugpC PE=3 SV=1 533 725 3.0E-11
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 515 726 3.0E-11
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 515 726 3.0E-11
sp|Q8KLG1|NODI_RHIEC Nod factor export ATP-binding protein I OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nodI PE=3 SV=3 521 813 3.0E-11
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 515 726 3.0E-11
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 517 725 3.0E-11
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 509 725 3.0E-11
sp|Q8EEV5|LOLD_SHEON Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella oneidensis (strain MR-1) GN=lolD PE=3 SV=1 525 725 3.0E-11
sp|P48243|GLUA_CORGL Glutamate transport ATP-binding protein GluA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gluA PE=3 SV=2 521 725 3.0E-11
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 10 356 4.0E-11
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 10 433 4.0E-11
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 6 357 4.0E-11
sp|P94420|YCLP_BACSU Uncharacterized ABC transporter ATP-binding protein YclP OS=Bacillus subtilis (strain 168) GN=yclP PE=3 SV=1 521 706 4.0E-11
sp|Q65S66|FBPC_MANSM Fe(3+) ions import ATP-binding protein FbpC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fbpC PE=3 SV=2 502 725 4.0E-11
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 505 725 4.0E-11
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 509 726 4.0E-11
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 526 725 4.0E-11
sp|Q8G838|Y043_BIFLO Putative ABC transporter ATP-binding protein BL0043 OS=Bifidobacterium longum (strain NCC 2705) GN=BL0043 PE=3 SV=2 464 706 5.0E-11
sp|P31134|POTG_ECOLI Putrescine transport ATP-binding protein PotG OS=Escherichia coli (strain K12) GN=potG PE=3 SV=2 526 733 5.0E-11
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 523 725 5.0E-11
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 6 357 5.0E-11
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 536 725 5.0E-11
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 510 748 6.0E-11
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 496 725 6.0E-11
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 526 809 6.0E-11
sp|Q8GNH6|NODI_RHIML Nod factor export ATP-binding protein I OS=Rhizobium meliloti GN=nodI PE=3 SV=1 521 727 7.0E-11
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 501 725 7.0E-11
sp|Q0S0Z3|FBPC2_RHOJR Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhodococcus jostii (strain RHA1) GN=fbpC2 PE=3 SV=1 525 725 7.0E-11
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 496 683 7.0E-11
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 526 809 7.0E-11
sp|Q659V4|HMUV_PHODD Hemin import ATP-binding protein HmuV OS=Photobacterium damselae subsp. damselae GN=hmuV PE=3 SV=1 521 767 7.0E-11
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 1 373 7.0E-11
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 166 367 8.0E-11
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 516 726 8.0E-11
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 536 725 8.0E-11
sp|Q2W1R8|MODC_MAGSA Molybdenum import ATP-binding protein ModC OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=modC PE=3 SV=1 528 812 8.0E-11
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 526 809 8.0E-11
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 524 733 9.0E-11
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 494 725 9.0E-11
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 516 726 9.0E-11
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 526 732 9.0E-11
sp|Q217L2|MACB_RHOPB Macrolide export ATP-binding/permease protein MacB OS=Rhodopseudomonas palustris (strain BisB18) GN=macB PE=3 SV=1 500 725 9.0E-11
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 533 725 9.0E-11
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 6 357 1.0E-10
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 6 393 1.0E-10
sp|Q7MJ01|LOLD_VIBVY Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio vulnificus (strain YJ016) GN=lolD PE=3 SV=2 522 725 1.0E-10
sp|Q8DAV6|LOLD_VIBVU Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio vulnificus (strain CMCP6) GN=lolD PE=3 SV=1 522 725 1.0E-10
sp|Q8KFD6|Y391_CHLTE Putative ABC transporter ATP-binding protein CT0391 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0391 PE=3 SV=1 524 736 1.0E-10
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 509 732 1.0E-10
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 526 732 1.0E-10
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 493 760 1.0E-10
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 500 725 1.0E-10
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 494 726 1.0E-10
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 526 725 1.0E-10
sp|Q88ZJ6|POTA_LACPL Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=potA PE=3 SV=1 521 725 1.0E-10
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 536 693 1.0E-10
sp|A1URR2|UGPC_BARBK sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ugpC PE=3 SV=1 525 725 1.0E-10
sp|Q8Y651|MNTB_LISMO Manganese transport system ATP-binding protein MntB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mntB PE=3 SV=1 522 724 1.0E-10
sp|Q0SBZ1|FBPC1_RHOJR Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhodococcus jostii (strain RHA1) GN=fbpC1 PE=3 SV=1 525 732 1.0E-10
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 6 432 2.0E-10
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 509 726 2.0E-10
sp|Q4KFA2|LOLD_PSEF5 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=lolD PE=3 SV=2 505 725 2.0E-10
sp|Q1GIE5|POTA_RUEST Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria sp. (strain TM1040) GN=potA PE=3 SV=1 526 680 2.0E-10
sp|Q0RYP7|FBPC3_RHOJR Fe(3+) ions import ATP-binding protein FbpC 3 OS=Rhodococcus jostii (strain RHA1) GN=fbpC3 PE=3 SV=1 525 714 2.0E-10
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 525 683 2.0E-10
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 525 683 2.0E-10
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 525 683 2.0E-10
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 526 794 2.0E-10
sp|Q98DW6|TAUB_RHILO Taurine import ATP-binding protein TauB OS=Rhizobium loti (strain MAFF303099) GN=tauB PE=3 SV=1 519 773 2.0E-10
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 508 725 2.0E-10
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 510 725 2.0E-10
sp|Q9CL63|RBSA2_PASMU Ribose import ATP-binding protein RbsA 2 OS=Pasteurella multocida (strain Pm70) GN=rbsA2 PE=3 SV=1 526 748 2.0E-10
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 521 725 2.0E-10
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 521 725 2.0E-10
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 521 725 2.0E-10
sp|Q70GD4|HMUV_PHODP Hemin import ATP-binding protein HmuV OS=Photobacterium damsela subsp. piscicida GN=hmuV PE=3 SV=1 521 767 2.0E-10
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 519 732 3.0E-10
sp|Q63SP4|LOLD_BURPS Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia pseudomallei (strain K96243) GN=lolD PE=3 SV=2 525 725 3.0E-10
sp|Q62J04|LOLD_BURMA Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia mallei (strain ATCC 23344) GN=lolD PE=3 SV=2 525 725 3.0E-10
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 533 725 3.0E-10
sp|Q0HVQ0|LOLD_SHESR Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella sp. (strain MR-7) GN=lolD PE=3 SV=2 525 725 3.0E-10
sp|Q7VZ31|LOLD_BORPE Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lolD PE=3 SV=1 525 725 3.0E-10
sp|Q7W8T0|LOLD_BORPA Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lolD PE=3 SV=1 525 725 3.0E-10
sp|Q7WK40|LOLD_BORBR Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lolD PE=3 SV=1 525 725 3.0E-10
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 508 709 3.0E-10
sp|Q3K9F9|LOLD_PSEPF Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas fluorescens (strain Pf0-1) GN=lolD PE=3 SV=2 505 725 3.0E-10
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 503 725 3.0E-10
sp|O34677|GLNQ_BACSU Glutamine transport ATP-binding protein GlnQ OS=Bacillus subtilis (strain 168) GN=glnQ PE=2 SV=1 521 725 3.0E-10
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 494 732 3.0E-10
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 505 725 3.0E-10
sp|Q9HZL7|LOLD_PSEAE Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lolD PE=3 SV=1 501 725 3.0E-10
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 490 725 3.0E-10
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 509 726 4.0E-10
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 509 726 4.0E-10
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 521 725 4.0E-10
sp|Q1CI46|LOLD_YERPN Lipoprotein-releasing system ATP-binding protein LolD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lolD PE=3 SV=1 525 737 4.0E-10
sp|Q8ZFR4|LOLD_YERPE Lipoprotein-releasing system ATP-binding protein LolD OS=Yersinia pestis GN=lolD PE=3 SV=1 525 737 4.0E-10
sp|Q1C6Q8|LOLD_YERPA Lipoprotein-releasing system ATP-binding protein LolD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lolD PE=3 SV=1 525 737 4.0E-10
sp|O06980|YVCR_BACSU Uncharacterized ABC transporter ATP-binding protein YvcR OS=Bacillus subtilis (strain 168) GN=yvcR PE=3 SV=1 533 734 4.0E-10
sp|Q080S4|LOLD_SHEFN Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella frigidimarina (strain NCIMB 400) GN=lolD PE=3 SV=1 525 725 4.0E-10
sp|Q58967|Y1572_METJA Putative ABC transporter ATP-binding protein MJ1572 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1572 PE=3 SV=1 506 734 4.0E-10
sp|Q82G23|PSTB_STRAW Phosphate import ATP-binding protein PstB OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pstB PE=3 SV=1 521 710 4.0E-10
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 517 741 4.0E-10
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 518 683 4.0E-10
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 518 683 4.0E-10
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 518 683 4.0E-10
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 518 683 4.0E-10
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 521 725 4.0E-10
sp|P23703|NODI_RHILO Nod factor export ATP-binding protein I OS=Rhizobium loti (strain MAFF303099) GN=nodI PE=3 SV=2 521 725 4.0E-10
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 151 383 4.0E-10
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 509 726 5.0E-10
sp|Q58418|PSTB_METJA Phosphate import ATP-binding protein PstB OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pstB PE=3 SV=1 521 750 5.0E-10
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 506 707 5.0E-10
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 525 725 5.0E-10
sp|Q6G5J0|UGPC_BARHE sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ugpC PE=3 SV=1 524 726 5.0E-10
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 6 423 5.0E-10
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 6 347 5.0E-10
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 503 732 6.0E-10
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 533 731 6.0E-10
sp|P07821|FHUC_ECOLI Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Escherichia coli (strain K12) GN=fhuC PE=1 SV=3 502 760 6.0E-10
sp|P72335|NODI_RHIS3 Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain N33) GN=nodI PE=3 SV=1 516 727 6.0E-10
sp|A0L0V9|MACB_SHESA Macrolide export ATP-binding/permease protein MacB OS=Shewanella sp. (strain ANA-3) GN=macB PE=3 SV=1 520 725 6.0E-10
sp|Q73R11|Y282_TREDE Putative ABC transporter ATP-binding protein TDE_0282 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_0282 PE=3 SV=1 521 729 6.0E-10
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 521 725 6.0E-10
sp|Q63MM6|MACB_BURPS Macrolide export ATP-binding/permease protein MacB OS=Burkholderia pseudomallei (strain K96243) GN=macB PE=3 SV=1 515 725 6.0E-10
sp|Q3JGG7|MACB_BURP1 Macrolide export ATP-binding/permease protein MacB OS=Burkholderia pseudomallei (strain 1710b) GN=macB PE=3 SV=1 515 725 6.0E-10
sp|Q669P3|LOLD_YERPS Lipoprotein-releasing system ATP-binding protein LolD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lolD PE=3 SV=1 525 737 6.0E-10
sp|P39456|TCYC_BACSU L-cystine import ATP-binding protein TcyC OS=Bacillus subtilis (strain 168) GN=tcyC PE=1 SV=4 521 707 7.0E-10
sp|Q312H8|LOLD_DESAG Lipoprotein-releasing system ATP-binding protein LolD OS=Desulfovibrio alaskensis (strain G20) GN=lolD PE=3 SV=1 502 725 7.0E-10
sp|Q88XV2|ECFA1_LACPL Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ecfA1 PE=3 SV=1 504 756 7.0E-10
sp|P47311|Y065_MYCGE Putative ABC transporter ATP-binding protein MG065 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG065 PE=3 SV=1 497 680 7.0E-10
sp|Q9KZW2|PSTB_STRCO Phosphate import ATP-binding protein PstB OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pstB PE=3 SV=1 521 710 7.0E-10
sp|Q88KY4|LOLD_PSEPK Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas putida (strain KT2440) GN=lolD PE=3 SV=2 503 725 7.0E-10
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 496 726 7.0E-10
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 6 357 7.0E-10
sp|Q4ZV73|LOLD_PSEU2 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lolD PE=3 SV=2 503 725 8.0E-10
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 533 725 8.0E-10
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 521 706 8.0E-10
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 6 353 1.0E-09
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 6 437 1.0E-09
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 533 813 1.0E-09
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 509 731 1.0E-09
sp|Q2RZ08|HMUV_SALRD Hemin import ATP-binding protein HmuV OS=Salinibacter ruber (strain DSM 13855 / M31) GN=hmuV PE=3 SV=1 521 726 1.0E-09
sp|Q16BJ3|TAUB_ROSDO Taurine import ATP-binding protein TauB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tauB PE=3 SV=1 507 737 1.0E-09
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 533 728 1.0E-09
sp|Q9K0N7|MACB_NEIMB Macrolide export ATP-binding/permease protein MacB OS=Neisseria meningitidis serogroup B (strain MC58) GN=macB PE=3 SV=1 505 725 1.0E-09
sp|P55476|NODI_RHISN Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain NGR234) GN=nodI PE=3 SV=1 521 729 1.0E-09
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 526 725 1.0E-09
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 524 729 1.0E-09
sp|Q0BMC9|METN_FRATO Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=metN PE=3 SV=1 510 729 1.0E-09
sp|Q2A3Z2|METN_FRATH Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain LVS) GN=metN PE=3 SV=1 510 729 1.0E-09
sp|Q85A69|CYSA_ANTFO Sulfate/thiosulfate import ATP-binding protein CysA OS=Anthoceros formosae GN=cysA PE=2 SV=1 512 725 1.0E-09
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 526 725 1.0E-09
sp|P50332|NODI_RHIGA Nod factor export ATP-binding protein I OS=Rhizobium galegae GN=nodI PE=3 SV=1 522 732 1.0E-09
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 526 725 1.0E-09
sp|Q5F6V6|MACB_NEIG1 Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=macB PE=3 SV=1 505 725 1.0E-09
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 493 725 1.0E-09
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 495 757 1.0E-09
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 517 726 1.0E-09
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 493 725 1.0E-09
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 533 725 1.0E-09
sp|Q9EUS2|PSTB_STRGR Phosphate import ATP-binding protein PstB OS=Streptomyces griseus GN=pstB PE=3 SV=1 521 727 1.0E-09
sp|Q6LPK2|LOLD_PHOPR Lipoprotein-releasing system ATP-binding protein LolD OS=Photobacterium profundum GN=lolD PE=3 SV=2 522 725 1.0E-09
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 526 725 1.0E-09
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 6 390 1.0E-09
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 6 435 2.0E-09
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 510 725 2.0E-09
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 472 680 2.0E-09
sp|Q0HJG0|LOLD_SHESM Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella sp. (strain MR-4) GN=lolD PE=3 SV=2 525 725 2.0E-09
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 526 732 2.0E-09
sp|Q6KHL1|ECFA1_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1 503 725 2.0E-09
sp|Q5HVF4|PSTB_CAMJR Phosphate import ATP-binding protein PstB OS=Campylobacter jejuni (strain RM1221) GN=pstB PE=3 SV=1 521 733 2.0E-09
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 533 731 2.0E-09
sp|Q8FVT0|Y3745_BRUSU Putative ATP-binding protein BRA0745/BS1330_II0738 OS=Brucella suis biovar 1 (strain 1330) GN=BRA0745 PE=3 SV=1 521 725 2.0E-09
sp|Q5LX21|UGPC_RUEPO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ugpC PE=3 SV=1 521 732 2.0E-09
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 510 725 2.0E-09
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 526 725 2.0E-09
sp|Q98KI3|MODC_RHILO Molybdenum import ATP-binding protein ModC OS=Rhizobium loti (strain MAFF303099) GN=modC PE=3 SV=1 536 725 2.0E-09
sp|Q9X1Z1|ECFA1_THEMA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ecfA1 PE=1 SV=1 525 707 2.0E-09
sp|Q2YKZ7|Y2993_BRUA2 Putative ATP-binding protein BAB2_0493 OS=Brucella abortus (strain 2308) GN=BAB2_0493 PE=3 SV=1 521 725 2.0E-09
sp|Q578M5|Y2787_BRUAB Putative ATP-binding protein BruAb2_0487 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_0487 PE=3 SV=1 521 725 2.0E-09
sp|Q2L219|LOLD_BORA1 Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella avium (strain 197N) GN=lolD PE=3 SV=1 525 725 2.0E-09
sp|Q01937|LACK_RHIRD Lactose transport ATP-binding protein LacK OS=Rhizobium radiobacter GN=lacK PE=3 SV=1 516 726 2.0E-09
sp|Q6G194|UGPC_BARQU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella quintana (strain Toulouse) GN=ugpC PE=3 SV=1 524 726 2.0E-09
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 507 709 2.0E-09
sp|Q9CK97|METN_PASMU Methionine import ATP-binding protein MetN OS=Pasteurella multocida (strain Pm70) GN=metN PE=3 SV=1 520 707 2.0E-09
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 510 725 2.0E-09
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 521 726 2.0E-09
sp|Q0I2Z4|FBPC_HAES1 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1 503 725 2.0E-09
sp|Q1M7W6|NODI_RHIL3 Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nodI PE=3 SV=2 521 727 2.0E-09
sp|Q3B276|LOLD2_CHLL7 Lipoprotein-releasing system ATP-binding protein LolD 2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lolD2 PE=3 SV=1 533 706 2.0E-09
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 533 725 2.0E-09
sp|Q6N9W0|METN1_RHOPA Methionine import ATP-binding protein MetN 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metN1 PE=3 SV=1 514 732 2.0E-09
sp|Q87J32|HMUV_VIBPA Hemin import ATP-binding protein HmuV OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hmuV PE=3 SV=2 503 725 2.0E-09
sp|Q7MU65|LOLD_PORGI Lipoprotein-releasing system ATP-binding protein LolD OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lolD PE=3 SV=1 516 725 2.0E-09
sp|Q8U949|RBSA2_AGRFC Ribose import ATP-binding protein RbsA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rbsA2 PE=3 SV=1 533 748 2.0E-09
sp|Q8EIL8|MACB_SHEON Macrolide export ATP-binding/permease protein MacB OS=Shewanella oneidensis (strain MR-1) GN=macB PE=3 SV=1 520 725 2.0E-09
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 6 360 2.0E-09
sp|Q5MK06|MACB_NEIGO Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae GN=macB PE=1 SV=1 505 725 3.0E-09
sp|Q8U3E0|Y528_PYRFU Putative ABC transporter ATP-binding protein PF0528 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0528 PE=3 SV=1 521 725 3.0E-09
sp|Q83LR7|MACB_SHIFL Macrolide export ATP-binding/permease protein MacB OS=Shigella flexneri GN=macB PE=3 SV=1 519 729 3.0E-09
sp|Q4FMG5|TAUB_PELUB Taurine import ATP-binding protein TauB OS=Pelagibacter ubique (strain HTCC1062) GN=tauB PE=3 SV=1 510 738 3.0E-09
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 511 729 3.0E-09
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 511 729 3.0E-09
sp|Q1QE80|POTA_PSYCK Spermidine/putrescine import ATP-binding protein PotA OS=Psychrobacter cryohalolentis (strain K5) GN=potA PE=3 SV=1 525 725 3.0E-09
sp|Q47L96|PSTB_THEFY Phosphate import ATP-binding protein PstB OS=Thermobifida fusca (strain YX) GN=pstB PE=3 SV=1 521 750 3.0E-09
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 522 750 3.0E-09
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 526 725 3.0E-09
sp|Q8Y7R4|Y1207_LISMO Putative ABC transporter ATP-binding protein lmo1207 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo1207 PE=3 SV=1 526 706 3.0E-09
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 514 725 3.0E-09
sp|Q6D734|FBPC1_PECAS Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1 521 725 3.0E-09
sp|Q03PF2|POTA_LACBA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=potA PE=3 SV=1 514 725 3.0E-09
sp|P08720|NODI_RHILV Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae GN=nodI PE=3 SV=1 521 727 3.0E-09
sp|Q832R5|Y2153_ENTFA Putative ABC transporter ATP-binding protein EF_2153 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=EF_2153 PE=3 SV=1 498 706 3.0E-09
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 528 726 3.0E-09
sp|Q9PHQ1|PSTB_CAMJE Phosphate import ATP-binding protein PstB OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pstB PE=3 SV=1 521 733 3.0E-09
sp|P10091|CYSA_MARPO Sulfate/thiosulfate import ATP-binding protein CysA OS=Marchantia polymorpha GN=cysA PE=3 SV=1 512 725 3.0E-09
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 521 682 3.0E-09
sp|Q7VR29|LOLD_BLOFL Lipoprotein-releasing system ATP-binding protein LolD OS=Blochmannia floridanus GN=lolD PE=3 SV=1 507 694 3.0E-09
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 521 726 3.0E-09
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 6 419 4.0E-09
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 513 725 4.0E-09
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 533 710 4.0E-09
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 506 725 4.0E-09
sp|P44531|FBPC1_HAEIN Fe(3+) ions import ATP-binding protein FbpC 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fbpC1 PE=3 SV=1 503 725 4.0E-09
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 516 725 4.0E-09
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 525 706 4.0E-09
sp|Q13X01|LOLD_BURXL Lipoprotein-releasing system ATP-binding protein LolD OS=Burkholderia xenovorans (strain LB400) GN=lolD PE=3 SV=1 525 725 4.0E-09
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 521 725 4.0E-09
sp|Q8UB29|UGPC3_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC3 PE=3 SV=1 526 725 4.0E-09
sp|Q5NFU5|METN_FRATT Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=metN PE=3 SV=2 510 729 4.0E-09
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 533 733 4.0E-09
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 526 725 4.0E-09
sp|Q13LC4|PHNC_BURXL Phosphonates import ATP-binding protein PhnC OS=Burkholderia xenovorans (strain LB400) GN=phnC PE=3 SV=1 517 732 4.0E-09
sp|Q14H97|METN_FRAT1 Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=metN PE=3 SV=2 510 729 4.0E-09
sp|Q884I3|LOLD_PSESM Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=lolD PE=3 SV=1 503 729 4.0E-09
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 526 725 4.0E-09
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 533 725 4.0E-09
sp|Q7NUJ3|MACB_CHRVO Macrolide export ATP-binding/permease protein MacB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=macB PE=3 SV=1 519 725 5.0E-09
sp|Q2K4V4|UGPC2_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1 516 732 5.0E-09
sp|Q7ANN4|PRSD_RHIME Type I secretion system ATP-binding protein PrsD OS=Rhizobium meliloti (strain 1021) GN=prsD PE=1 SV=2 519 732 5.0E-09
sp|Q6LQ00|Y2240_PHOPR Putative ABC transporter ATP-binding protein PBPRA2240 OS=Photobacterium profundum GN=PBPRA2240 PE=3 SV=1 506 706 5.0E-09
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 533 725 5.0E-09
sp|Q9CM80|FBPC_PASMU Fe(3+) ions import ATP-binding protein FbpC OS=Pasteurella multocida (strain Pm70) GN=fbpC PE=3 SV=1 503 725 5.0E-09
sp|Q0B6I6|METN2_BURCM Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1 477 705 5.0E-09
sp|Q1MQ44|POTA_LAWIP Spermidine/putrescine import ATP-binding protein PotA OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=potA PE=3 SV=1 505 725 5.0E-09
sp|Q73XU8|CYSA_MYCPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysA PE=3 SV=1 521 725 5.0E-09
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 526 725 5.0E-09
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 509 726 5.0E-09
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 526 725 5.0E-09
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 506 735 5.0E-09
sp|Q9RYZ3|PSTB_DEIRA Phosphate import ATP-binding protein PstB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pstB PE=3 SV=1 521 707 5.0E-09
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 509 756 5.0E-09
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 526 748 6.0E-09
sp|Q2J534|PSTB_FRASC Phosphate import ATP-binding protein PstB OS=Frankia sp. (strain CcI3) GN=pstB PE=3 SV=1 528 710 6.0E-09
sp|Q6MPX9|MACB_BDEBA Macrolide export ATP-binding/permease protein MacB OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=macB PE=3 SV=1 533 725 6.0E-09
sp|Q3ATY5|LOLD1_CHLCH Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Chlorobium chlorochromatii (strain CaD3) GN=lolD1 PE=3 SV=1 533 706 6.0E-09
sp|Q329G7|RBSA_SHIDS Ribose import ATP-binding protein RbsA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rbsA PE=3 SV=1 501 748 6.0E-09
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 526 725 6.0E-09
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 525 725 6.0E-09
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 506 735 6.0E-09
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 509 731 6.0E-09
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 506 758 7.0E-09
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 526 732 7.0E-09
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 526 732 7.0E-09
sp|Q720M2|Y1216_LISMF Putative ABC transporter ATP-binding protein LMOf2365_1216 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=LMOf2365_1216 PE=3 SV=1 526 706 7.0E-09
sp|Q48KI4|LOLD_PSE14 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=lolD PE=3 SV=1 503 725 7.0E-09
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 498 709 7.0E-09
sp|Q1RK34|LOLD_RICBR Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia bellii (strain RML369-C) GN=lolD PE=3 SV=1 503 726 7.0E-09
sp|Q8R9L8|Y1589_CALS4 Putative ABC transporter ATP-binding protein TTE1589 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1589 PE=3 SV=1 526 734 7.0E-09
sp|Q55463|CMPD_SYNY3 Bicarbonate transport ATP-binding protein CmpD OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cmpD PE=2 SV=1 502 725 7.0E-09
sp|Q47C66|LOLD_DECAR Lipoprotein-releasing system ATP-binding protein LolD OS=Dechloromonas aromatica (strain RCB) GN=lolD PE=3 SV=1 503 725 7.0E-09
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 506 707 7.0E-09
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 509 731 7.0E-09
sp|Q2KVS6|MACB_BORA1 Macrolide export ATP-binding/permease protein MacB OS=Bordetella avium (strain 197N) GN=macB PE=3 SV=2 525 715 8.0E-09
sp|Q5MZ54|CMPC_SYNP6 Bicarbonate transport ATP-binding protein CmpC OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cmpC PE=3 SV=1 521 737 8.0E-09
sp|Q55107|CMPC_SYNE7 Bicarbonate transport ATP-binding protein CmpC OS=Synechococcus elongatus (strain PCC 7942) GN=cmpC PE=1 SV=1 521 737 8.0E-09
sp|Q28K97|TAUB_JANSC Taurine import ATP-binding protein TauB OS=Jannaschia sp. (strain CCS1) GN=tauB PE=3 SV=1 510 737 8.0E-09
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 155 361 9.0E-09
sp|Q70YG7|HMUV_VIBA7 Hemin import ATP-binding protein HmuV OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=hmuV PE=1 SV=2 504 745 9.0E-09
sp|Q8X5Q4|RBSA2_ECO57 Ribose import ATP-binding protein RbsA 2 OS=Escherichia coli O157:H7 GN=rbsA2 PE=3 SV=3 501 748 9.0E-09
sp|Q8RD07|Y246_CALS4 Putative ABC transporter ATP-binding protein TTE0246 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE0246 PE=3 SV=1 506 722 9.0E-09
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 525 725 9.0E-09
sp|Q8YCB1|UGPC_BRUME sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ugpC PE=3 SV=1 512 725 9.0E-09
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 495 725 9.0E-09
sp|Q668Q3|FBPC_YERPS Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fbpC PE=3 SV=1 524 732 1.0E-08
sp|Q8TTN2|Y394_METAC Putative ABC transporter ATP-binding protein MA_0394 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_0394 PE=3 SV=1 501 707 1.0E-08
sp|Q1CJS9|FBPC_YERPN Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fbpC PE=3 SV=1 524 732 1.0E-08
sp|Q8ZCM2|FBPC_YERPE Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis GN=fbpC PE=3 SV=1 524 732 1.0E-08
sp|Q1C607|FBPC_YERPA Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fbpC PE=3 SV=1 524 732 1.0E-08
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 496 725 1.0E-08
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 526 726 1.0E-08
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 493 709 1.0E-08
sp|Q3IM36|PSTB3_NATPD Phosphate import ATP-binding protein PstB 3 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pstB3 PE=3 SV=1 521 733 1.0E-08
sp|Q8NQH4|PHNC_CORGL Phosphonates import ATP-binding protein PhnC OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=phnC PE=3 SV=1 515 756 1.0E-08
sp|P0A9U0|YBBA_SHIFL Uncharacterized ABC transporter ATP-binding protein YbbA OS=Shigella flexneri GN=ybbA PE=3 SV=1 511 725 1.0E-08
sp|P0A9T8|YBBA_ECOLI Uncharacterized ABC transporter ATP-binding protein YbbA OS=Escherichia coli (strain K12) GN=ybbA PE=3 SV=1 511 725 1.0E-08
sp|P0A9T9|YBBA_ECO57 Uncharacterized ABC transporter ATP-binding protein YbbA OS=Escherichia coli O157:H7 GN=ybbA PE=3 SV=1 511 725 1.0E-08
sp|Q2RWI9|MODC_RHORT Molybdenum import ATP-binding protein ModC OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=modC PE=3 SV=1 538 725 1.0E-08
sp|Q58429|Y1023_METJA Uncharacterized ABC transporter ATP-binding protein MJ1023 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1023 PE=3 SV=1 521 734 1.0E-08
sp|Q722B1|POTA_LISMF Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serotype 4b (strain F2365) GN=potA PE=3 SV=2 525 725 1.0E-08
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 6 420 2.0E-08
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 6 453 2.0E-08
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 524 725 2.0E-08
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 522 709 2.0E-08
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 6 418 3.0E-08
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 6 418 3.0E-08
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 6 353 4.0E-08
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 524 706 4.0E-08
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 522 709 5.0E-08
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 521 726 7.0E-08
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 533 732 7.0E-08
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 6 419 8.0E-08
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 509 709 9.0E-08
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 533 732 1.0E-07
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 167 427 2.0E-07
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 167 427 2.0E-07
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 6 367 2.0E-07
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 6 357 2.0E-07
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 533 732 3.0E-07
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 6 433 3.0E-07
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 523 732 3.0E-07
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 89 431 4.0E-07
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 533 732 4.0E-07
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 528 725 5.0E-07
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 533 709 6.0E-07
sp|Q8R9L8|Y1589_CALS4 Putative ABC transporter ATP-binding protein TTE1589 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1589 PE=3 SV=1 510 725 6.0E-07
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 175 358 7.0E-07
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 169 359 1.0E-06
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 143 356 1.0E-06
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 533 709 1.0E-06
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 522 709 1.0E-06
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 533 736 1.0E-06
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 522 709 2.0E-06
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 5 361 2.0E-06
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 533 709 2.0E-06
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 528 725 2.0E-06
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 525 683 3.0E-06
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 526 725 4.0E-06
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 533 725 6.0E-06
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 528 759 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0042626 ATPase activity, coupled to transmembrane movement of substances Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0016887 ATPase activity Yes
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0051234 establishment of localization No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0022804 active transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0042623 ATPase activity, coupled No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0022857 transmembrane transporter activity No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0006810 transport No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 190 212 22
2 233 255 22
3 265 287 22
4 334 353 19
5 411 433 22
6 848 866 18
7 876 898 22
8 918 940 22
9 955 972 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8243
MTDVLGLASIVTLYQAGNAIYDLFDKVLVLDGGREMYYGPMREARPFMEALGFICEPGANVADFLTGVTVPTERR
VRPEMQHSFPRDGGSIRAAYEQSSIHERMRAEYGYPSSDEARTKTDLFRQGVAMDKDKRLPAKSPLTVGFGSQVW
ACVLRQYQIIWGDKATFSIKQASTIIQALIAGSLFYNAPGTSAGLFLKSGALFFALLFNTLLSMSEVTDSFTGRP
VLLKHKAFAFFHPAAFCIAQIAADIPVILAQVSVFSVILYFMVGLTTTAGSFFTFWVVVVATTMCMTALFRAIGA
SFSTFDGASKLSGFVVSATFMYAGYMIRKPQMHPWFVWIFWINPLAYAFDSLMSNEFHNKVIPCVGNNLIPSGPG
YSDADPGACAGVGGAVAGQKFVSGDDYLASLSYSHAHVWRNFGIVWAWWVLFVAITVWMTSRWHAPSEDGPSLVI
PRENARRVGRRPDEEEGRAGRKAATAAATADGQGSAGSGSDTDGTGQVSLVRNTSVFTWKNLSYTVKTPAGERLL
LDDVQGWVEPGKLTALMGASGAGKTTLLDVLARRKTDGTIRGSVMVDGRPLPVSFQRSAGYCEQLDVHEPYATVR
EALEFSALLRQSRDTPRSEKLAYVDAILDLLELHDLADTLIGEVGAGLSVEQRKRVTIGVELVSKPSILIFLDEP
TSGLDGQSAFHTVRFLRKLAAVGQAVLVTIHQPSAQLFAQFDRLLLLARGGKTVYFGDIGADGAETVRGYFGRYG
APCPAEANPAEHMIDVVSGRLSSHGGGQDWNAVWLASPEQAEVSARLERIVAEAAAKPPGTVDDGHEFAAPLWQQ
MRLVTRRMNVALYRNTDYVNNKLLLHVFSALFNGFSFWMVGDSVGDLQLKLFTIFQFIFVAPGVLAQLQPLFIRR
RDVFETREKKSKTYSWVAFVTGLIVSELPYLCLCAVLYFACWYYTVGFPASSRRAGATLFVMLAYEFLYTGIGQS
SPSGATGSTTSTPSTT*
Coding >Hirsu2|8243
ATGACGGACGTCCTGGGTCTTGCCTCCATCGTCACCCTGTACCAGGCCGGCAACGCCATCTACGACCTATTCGAC
AAGGTCCTGGTCCTCGACGGGGGCAGGGAGATGTACTACGGGCCGATGCGGGAGGCGAGGCCCTTCATGGAGGCC
TTGGGATTCATTTGCGAGCCGGGCGCCAACGTGGCCGACTTCCTGACGGGCGTCACGGTGCCCACCGAGCGCAGG
GTCCGGCCCGAGATGCAGCACAGCTTCCCGCGCGACGGCGGCTCCATCCGCGCCGCCTACGAGCAGTCCTCCATC
CACGAGCGCATGAGGGCAGAGTACGGCTACCCGTCCAGCGACGAGGCCAGGACCAAGACGGACCTCTTCCGCCAG
GGCGTCGCCATGGACAAGGACAAGAGGCTGCCGGCCAAGAGCCCCCTGACGGTTGGCTTCGGCAGCCAGGTCTGG
GCCTGCGTCCTCCGCCAGTACCAGATCATCTGGGGCGACAAGGCCACCTTCTCCATCAAGCAAGCCTCCACCATC
ATCCAGGCCCTCATCGCCGGCTCGCTCTTCTACAACGCCCCCGGCACCTCGGCGGGGCTGTTCCTCAAGTCGGGC
GCCCTGTTCTTCGCCCTCCTCTTCAACACCCTGCTCTCCATGTCCGAGGTGACCGACTCCTTCACCGGTCGACCC
GTGCTGCTCAAGCACAAAGCCTTTGCCTTCTTCCACCCGGCCGCCTTTTGCATTGCCCAGATCGCCGCCGACATA
CCCGTCATCCTCGCCCAGGTCTCCGTCTTTTCCGTCATCTTGTACTTCATGGTCGGCCTGACCACGACGGCGGGC
AGCTTCTTTACCTTCTGGGTCGTCGTCGTAGCCACGACCATGTGCATGACGGCCCTCTTCCGCGCGATTGGCGCT
TCCTTCAGCACCTTCGACGGCGCCTCCAAGCTCTCGGGCTTCGTCGTCTCCGCCACCTTCATGTACGCCGGCTAC
ATGATCCGCAAGCCGCAGATGCACCCCTGGTTCGTCTGGATATTCTGGATCAACCCGCTGGCCTACGCATTCGAC
AGCCTGATGTCCAACGAGTTCCACAACAAGGTCATCCCCTGCGTCGGCAACAACCTGATCCCCAGCGGACCCGGA
TACTCGGACGCGGATCCGGGCGCCTGTGCCGGCGTGGGCGGCGCCGTCGCGGGACAGAAATTCGTCTCGGGCGAC
GACTACCTGGCGTCGCTCTCGTACAGCCACGCGCACGTGTGGAGGAACTTTGGCATCGTCTGGGCCTGGTGGGTG
CTCTTCGTCGCCATCACCGTGTGGATGACGTCGCGCTGGCACGCCCCGTCCGAGGACGGGCCCAGCCTGGTGATC
CCCCGCGAGAACGCCCGCCGGGTGGGCCGGCGGCCGGACGAAGAGGAGGGCCGGGCCGGGCGCAAGGCGGCGACC
GCGGCGGCGACGGCGGACGGGCAGGGCTCGGCGGGGTCCGGCAGCGACACGGACGGGACGGGGCAGGTCAGCCTG
GTGCGCAACACGTCCGTCTTCACGTGGAAGAACCTGTCGTACACGGTCAAGACGCCGGCGGGCGAGCGGCTGCTG
CTCGACGACGTCCAGGGCTGGGTCGAGCCGGGCAAGCTGACGGCGCTGATGGGGGCGTCCGGGGCGGGCAAGACG
ACGCTGCTGGACGTGCTGGCGCGGCGCAAGACGGACGGGACGATCCGCGGGTCCGTCATGGTGGACGGGCGGCCG
CTGCCCGTCTCCTTCCAGCGCTCGGCCGGCTACTGCGAGCAGCTGGACGTGCACGAGCCGTACGCGACGGTGCGC
GAGGCGCTCGAGTTCTCGGCGCTGCTGCGGCAGAGCCGCGACACGCCGCGGTCGGAGAAGCTGGCGTACGTCGAC
GCCATCCTGGACCTGCTAGAGCTGCACGACCTGGCCGATACGCTCATCGGCGAGGTGGGCGCCGGGCTGAGCGTG
GAGCAGCGCAAGCGCGTCACCATCGGCGTCGAGCTCGTGTCTAAGCCCAGTATCCTCATCTTCCTCGACGAGCCG
ACGTCCGGGCTGGACGGGCAGTCGGCCTTCCACACGGTGCGCTTCCTGCGCAAGCTGGCGGCCGTGGGCCAGGCC
GTGCTCGTGACCATCCACCAGCCGTCGGCCCAGCTCTTCGCCCAGTTCGACCGGCTGCTGCTGCTGGCGCGGGGC
GGCAAGACGGTCTACTTCGGCGACATCGGCGCGGACGGGGCGGAGACGGTGCGCGGCTACTTCGGGCGGTACGGG
GCGCCGTGCCCGGCCGAGGCCAACCCGGCCGAGCACATGATCGACGTGGTGTCGGGCCGGCTGTCGTCGCACGGC
GGCGGGCAGGACTGGAACGCGGTGTGGCTGGCGTCGCCGGAGCAGGCCGAGGTGAGCGCGCGGCTGGAGCGGATC
GTGGCCGAGGCAGCGGCCAAGCCGCCGGGCACCGTCGACGACGGGCACGAGTTCGCGGCGCCGCTGTGGCAGCAG
ATGCGGCTGGTGACGCGGCGGATGAACGTGGCGCTGTACCGCAACACCGACTACGTCAACAACAAGCTGCTGCTG
CACGTCTTCTCCGCCCTCTTCAACGGCTTCTCCTTCTGGATGGTGGGCGACTCGGTCGGCGACCTGCAGCTCAAG
CTCTTCACCATCTTCCAGTTCATCTTCGTGGCGCCGGGCGTGCTGGCCCAGCTGCAGCCGCTCTTCATCCGGCGG
CGCGACGTGTTCGAGACGCGCGAGAAGAAGTCCAAGACGTACTCGTGGGTCGCCTTCGTGACGGGGCTGATCGTG
TCGGAGCTGCCGTACCTGTGCCTCTGCGCCGTGCTCTACTTCGCCTGCTGGTACTACACGGTCGGCTTCCCGGCC
AGCTCGCGGCGGGCGGGCGCGACGCTCTTCGTCATGCTGGCCTACGAGTTCCTCTACACCGGCATCGGCCAATCC
AGCCCTTCTGGCGCTACTGGATCTACTACCTCGACCCCTTCAACTACCTGA
Transcript >Hirsu2|8243
ATGACGGACGTCCTGGGTCTTGCCTCCATCGTCACCCTGTACCAGGCCGGCAACGCCATCTACGACCTATTCGAC
AAGGTCCTGGTCCTCGACGGGGGCAGGGAGATGTACTACGGGCCGATGCGGGAGGCGAGGCCCTTCATGGAGGCC
TTGGGATTCATTTGCGAGCCGGGCGCCAACGTGGCCGACTTCCTGACGGGCGTCACGGTGCCCACCGAGCGCAGG
GTCCGGCCCGAGATGCAGCACAGCTTCCCGCGCGACGGCGGCTCCATCCGCGCCGCCTACGAGCAGTCCTCCATC
CACGAGCGCATGAGGGCAGAGTACGGCTACCCGTCCAGCGACGAGGCCAGGACCAAGACGGACCTCTTCCGCCAG
GGCGTCGCCATGGACAAGGACAAGAGGCTGCCGGCCAAGAGCCCCCTGACGGTTGGCTTCGGCAGCCAGGTCTGG
GCCTGCGTCCTCCGCCAGTACCAGATCATCTGGGGCGACAAGGCCACCTTCTCCATCAAGCAAGCCTCCACCATC
ATCCAGGCCCTCATCGCCGGCTCGCTCTTCTACAACGCCCCCGGCACCTCGGCGGGGCTGTTCCTCAAGTCGGGC
GCCCTGTTCTTCGCCCTCCTCTTCAACACCCTGCTCTCCATGTCCGAGGTGACCGACTCCTTCACCGGTCGACCC
GTGCTGCTCAAGCACAAAGCCTTTGCCTTCTTCCACCCGGCCGCCTTTTGCATTGCCCAGATCGCCGCCGACATA
CCCGTCATCCTCGCCCAGGTCTCCGTCTTTTCCGTCATCTTGTACTTCATGGTCGGCCTGACCACGACGGCGGGC
AGCTTCTTTACCTTCTGGGTCGTCGTCGTAGCCACGACCATGTGCATGACGGCCCTCTTCCGCGCGATTGGCGCT
TCCTTCAGCACCTTCGACGGCGCCTCCAAGCTCTCGGGCTTCGTCGTCTCCGCCACCTTCATGTACGCCGGCTAC
ATGATCCGCAAGCCGCAGATGCACCCCTGGTTCGTCTGGATATTCTGGATCAACCCGCTGGCCTACGCATTCGAC
AGCCTGATGTCCAACGAGTTCCACAACAAGGTCATCCCCTGCGTCGGCAACAACCTGATCCCCAGCGGACCCGGA
TACTCGGACGCGGATCCGGGCGCCTGTGCCGGCGTGGGCGGCGCCGTCGCGGGACAGAAATTCGTCTCGGGCGAC
GACTACCTGGCGTCGCTCTCGTACAGCCACGCGCACGTGTGGAGGAACTTTGGCATCGTCTGGGCCTGGTGGGTG
CTCTTCGTCGCCATCACCGTGTGGATGACGTCGCGCTGGCACGCCCCGTCCGAGGACGGGCCCAGCCTGGTGATC
CCCCGCGAGAACGCCCGCCGGGTGGGCCGGCGGCCGGACGAAGAGGAGGGCCGGGCCGGGCGCAAGGCGGCGACC
GCGGCGGCGACGGCGGACGGGCAGGGCTCGGCGGGGTCCGGCAGCGACACGGACGGGACGGGGCAGGTCAGCCTG
GTGCGCAACACGTCCGTCTTCACGTGGAAGAACCTGTCGTACACGGTCAAGACGCCGGCGGGCGAGCGGCTGCTG
CTCGACGACGTCCAGGGCTGGGTCGAGCCGGGCAAGCTGACGGCGCTGATGGGGGCGTCCGGGGCGGGCAAGACG
ACGCTGCTGGACGTGCTGGCGCGGCGCAAGACGGACGGGACGATCCGCGGGTCCGTCATGGTGGACGGGCGGCCG
CTGCCCGTCTCCTTCCAGCGCTCGGCCGGCTACTGCGAGCAGCTGGACGTGCACGAGCCGTACGCGACGGTGCGC
GAGGCGCTCGAGTTCTCGGCGCTGCTGCGGCAGAGCCGCGACACGCCGCGGTCGGAGAAGCTGGCGTACGTCGAC
GCCATCCTGGACCTGCTAGAGCTGCACGACCTGGCCGATACGCTCATCGGCGAGGTGGGCGCCGGGCTGAGCGTG
GAGCAGCGCAAGCGCGTCACCATCGGCGTCGAGCTCGTGTCTAAGCCCAGTATCCTCATCTTCCTCGACGAGCCG
ACGTCCGGGCTGGACGGGCAGTCGGCCTTCCACACGGTGCGCTTCCTGCGCAAGCTGGCGGCCGTGGGCCAGGCC
GTGCTCGTGACCATCCACCAGCCGTCGGCCCAGCTCTTCGCCCAGTTCGACCGGCTGCTGCTGCTGGCGCGGGGC
GGCAAGACGGTCTACTTCGGCGACATCGGCGCGGACGGGGCGGAGACGGTGCGCGGCTACTTCGGGCGGTACGGG
GCGCCGTGCCCGGCCGAGGCCAACCCGGCCGAGCACATGATCGACGTGGTGTCGGGCCGGCTGTCGTCGCACGGC
GGCGGGCAGGACTGGAACGCGGTGTGGCTGGCGTCGCCGGAGCAGGCCGAGGTGAGCGCGCGGCTGGAGCGGATC
GTGGCCGAGGCAGCGGCCAAGCCGCCGGGCACCGTCGACGACGGGCACGAGTTCGCGGCGCCGCTGTGGCAGCAG
ATGCGGCTGGTGACGCGGCGGATGAACGTGGCGCTGTACCGCAACACCGACTACGTCAACAACAAGCTGCTGCTG
CACGTCTTCTCCGCCCTCTTCAACGGCTTCTCCTTCTGGATGGTGGGCGACTCGGTCGGCGACCTGCAGCTCAAG
CTCTTCACCATCTTCCAGTTCATCTTCGTGGCGCCGGGCGTGCTGGCCCAGCTGCAGCCGCTCTTCATCCGGCGG
CGCGACGTGTTCGAGACGCGCGAGAAGAAGTCCAAGACGTACTCGTGGGTCGCCTTCGTGACGGGGCTGATCGTG
TCGGAGCTGCCGTACCTGTGCCTCTGCGCCGTGCTCTACTTCGCCTGCTGGTACTACACGGTCGGCTTCCCGGCC
AGCTCGCGGCGGGCGGGCGCGACGCTCTTCGTCATGCTGGCCTACGAGTTCCTCTACACCGGCATCGGCCAATCC
AGCCCTTCTGGCGCTACTGGATCTACTACCTCGACCCCTTCAACTACCTGA
Gene >Hirsu2|8243
ATGACGGACGTCCTGGGTCTTGCCTCCATCGTCACCCTGTACCAGGCCGGCAACGCCATCTACGACCTATTCGAC
AAGGTCCTGGTCCTCGACGGGGGCAGGGAGATGTACTACGGGCCGATGCGGGAGGCGAGGCCCTTCATGGAGGCC
TTGGGATTCATTTGCGAGCCGGGCGCCAACGTGGCCGACTTCCTGACGGGCGTCACGGTGCCCACCGAGCGCAGG
GTCCGGCCCGAGATGCAGCACAGCTTCCCGCGCGACGGCGGCTCCATCCGCGCCGCCTACGAGCAGTCCTCCATC
CACGAGCGCATGAGGGCAGAGTACGGCTACCCGTCCAGCGACGAGGCCAGGACCAAGACGGACCTCTTCCGCCAG
GGCGTCGCCATGGACAAGGACAAGAGGCTGCCGGCCAAGAGCCCCCTGACGGTTGGCTTCGGCAGCCAGGTCTGG
GCCTGCGTCCTCCGCCAGTACCAGATCATCTGGGGCGACAAGGCCACCTTCTCCATCAAGCAAGCCTCCACCATC
ATCCAGGCCCTCATCGCCGGCTCGCTCTTCTACAACGCCCCCGGCACCTCGGCGGGGCTGTTCCTCAAGTCGGGC
GCCCTGTTCTTCGCCCTCCTCTTCAACACCCTGCTCTCCATGTCCGAGGTGACCGACTCCTTCACCGGTCGACCC
GTGCTGCTCAAGCACAAAGCCTTTGCCTTCTTCCACCCGGCCGCCTTTTGCATTGCCCAGATCGCCGCCGACATA
CCCGTCATCCTCGCCCAGGTCTCCGTCTTTTCCGTCATCTTGTACTTCATGGTCGGCCTGACCACGACGGCGGGC
AGCTTCTTTACCTTCTGGGTCGTCGTCGTAGCCACGACCATGGTGAGTGCCGGCCTCCCGTTCTCCCTGCGAACA
GCCCGCATGCCCGGACTCCCTCTACCCACGGCTCCTCGCTTCTCCCTCCTCGCCCTCCACCCTGCATGCACTCGG
ACGCAGTATTGACGGGCTCCATCGGGAAACGTAGTGCATGACGGCCCTCTTCCGCGCGATTGGCGCTTCCTTCAG
CACCTTCGACGGCGCCTCCAAGCTCTCGGGCTTCGTCGTCTCCGCCACCTTCATGTACGCCGGCTACATGATCCG
CAAGCCGCAGATGCACCCCTGGTTCGTCTGGATATTCTGGATCAACCCGCTGGCCTACGCATTCGACAGCCTGAT
GTCCAACGAGTTCCACAACAAGGTCATCCCCTGCGTCGGCAACAACCTGATCCCCAGCGGACCCGGATACTCGGA
CGCGGATCCGGGCGCCTGTGCCGGCGTGGGCGGCGCCGTCGCGGGACAGAAATTCGTCTCGGGCGACGACTACCT
GGCGTCGCTCTCGTACAGCCACGCGCACGTGTGGAGGAACTTTGGCATCGTCTGGGCCTGGTGGGTGCTCTTCGT
CGCCATCACCGTGTGGATGACGTCGCGCTGGCACGCCCCGTCCGAGGACGGGCCCAGCCTGGTGATCCCCCGCGA
GAACGCCCGCCGGGTGGGCCGGCGGCCGGACGAAGAGGAGGGCCGGGCCGGGCGCAAGGCGGCGACCGCGGCGGC
GACGGCGGACGGGCAGGGCTCGGCGGGGTCCGGCAGCGACACGGACGGGACGGGGCAGGTCAGCCTGGTGCGCAA
CACGTCCGTCTTCACGTGGAAGAACCTGTCGTACACGGTCAAGACGCCGGCGGGCGAGCGGCTGCTGCTCGACGA
CGTCCAGGGCTGGGTCGAGCCGGGCAAGCTGACGGCGCTGATGGGGGCGTCCGGGGCGGGCAAGACGACGCTGCT
GGACGTGCTGGCGCGGCGCAAGACGGACGGGACGATCCGCGGGTCCGTCATGGTGGACGGGCGGCCGCTGCCCGT
CTCCTTCCAGCGCTCGGCCGGCTACTGCGAGCAGCTGGACGTGCACGAGCCGTACGCGACGGTGCGCGAGGCGCT
CGAGTTCTCGGCGCTGCTGCGGCAGAGCCGCGACACGCCGCGGTCGGAGAAGCTGGCGTACGTCGACGCCATCCT
GGACCTGCTAGAGCTGCACGACCTGGCCGATACGCTCATCGGCGAGGTGGGCGCCGGGCTGAGCGTGGAGCAGCG
CAAGCGCGTCACCATCGGCGTCGAGCTCGTGTCTAAGCCCAGTATCCTCATCTTCCTCGACGAGCCGACGTCCGG
GCTGGACGGGCAGTCGGCCTTCCACACGGTGCGCTTCCTGCGCAAGCTGGCGGCCGTGGGCCAGGCCGTGCTCGT
GACCATCCACCAGCCGTCGGCCCAGCTCTTCGCCCAGTTCGACCGGCTGCTGCTGCTGGCGCGGGGCGGCAAGAC
GGTCTACTTCGGCGACATCGGCGCGGACGGGGCGGAGACGGTGCGCGGCTACTTCGGGCGGTACGGGGCGCCGTG
CCCGGCCGAGGCCAACCCGGCCGAGCACATGATCGACGTGGTGTCGGGCCGGCTGTCGTCGCACGGCGGCGGGCA
GGACTGGAACGCGGTGTGGCTGGCGTCGCCGGAGCAGGCCGAGGTGAGCGCGCGGCTGGAGCGGATCGTGGCCGA
GGCAGCGGCCAAGCCGCCGGGCACCGTCGACGACGGGCACGAGTTCGCGGCGCCGCTGTGGCAGCAGATGCGGCT
GGTGACGCGGCGGATGAACGTGGCGCTGTACCGCAACACCGACTACGTCAACAACAAGCTGCTGCTGCACGTCTT
CTCCGCCCTCTTCAACGGCTTCTCCTTCTGGATGGTGGGCGACTCGGTCGGCGACCTGCAGCTCAAGCTCTTCAC
CATCTTCCAGTTCATCTTCGTGGCGCCGGGCGTGCTGGCCCAGCTGCAGCCGCTCTTCATCCGGCGGCGCGACGT
GTTCGAGACGCGCGAGAAGAAGTCCAAGACGTACTCGTGGGTCGCCTTCGTGACGGGGCTGATCGTGTCGGAGCT
GCCGTACCTGTGCCTCTGCGCCGTGCTCTACTTCGCCTGCTGGTACTACACGGTCGGCTTCCCGGCCAGCTCGCG
GCGGGCGGGCGCGACGCTCTTCGTCATGCTGGCCTACGAGTTCCTCTACACCGGCATCGGCCAGTTCATCGCCGC
CTACGCGCCCAACGACGTCTTCGCCGCCCTCGTCAACCCGCTGCTCATCGGCATCATGGCCTCCTTCTGCGGCGT
GCTCGTGCCGTACGGACAGATCCAGCCCTTCTGGCGCTACTGGATCTACTACCTCGACCCCTTCAACTACCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail