Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8238
Gene name
LocationContig_524:4468..6156
Strand+
Gene length (bp)1688
Transcript length (bp)1551
Coding sequence length (bp)1551
Protein length (aa) 517

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 4.3E-53 59 316
PF07714 Pkinase_Tyr Protein tyrosine kinase 3.0E-31 57 319

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08092|RAN1_SCHPO Negative regulator of sexual conjugation and meiosis OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ran1 PE=1 SV=2 45 327 1.0E-88
sp|Q03785|VHS1_YEAST Serine/threonine-protein kinase VHS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHS1 PE=1 SV=1 59 387 2.0E-48
sp|Q12505|SKS1_YEAST Serine/threonine-protein kinase SKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKS1 PE=1 SV=1 49 327 4.0E-45
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 52 316 7.0E-35
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 50 355 1.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08092|RAN1_SCHPO Negative regulator of sexual conjugation and meiosis OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ran1 PE=1 SV=2 45 327 1.0E-88
sp|Q03785|VHS1_YEAST Serine/threonine-protein kinase VHS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHS1 PE=1 SV=1 59 387 2.0E-48
sp|Q12505|SKS1_YEAST Serine/threonine-protein kinase SKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKS1 PE=1 SV=1 49 327 4.0E-45
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 52 316 7.0E-35
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 50 355 1.0E-34
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 53 316 3.0E-34
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 52 352 4.0E-34
sp|Q5KQF5|CIPKM_ORYSJ CBL-interacting protein kinase 22 OS=Oryza sativa subsp. japonica GN=CIPK22 PE=2 SV=1 51 316 7.0E-34
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 52 317 7.0E-34
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 50 400 9.0E-34
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 52 316 1.0E-33
sp|P38691|KSP1_YEAST Serine/threonine-protein kinase KSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KSP1 PE=1 SV=1 48 285 5.0E-33
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 58 317 1.0E-32
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 50 316 1.0E-32
sp|O14328|KSP1_SCHPO Serine/threonine-protein kinase ksp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksp1 PE=1 SV=1 63 328 1.0E-32
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 55 316 1.0E-32
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 43 341 2.0E-32
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 63 316 6.0E-32
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 55 316 7.0E-32
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 43 333 8.0E-32
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 55 316 8.0E-32
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 55 316 9.0E-32
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 63 316 1.0E-31
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 58 317 2.0E-31
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 50 315 2.0E-31
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 59 318 3.0E-31
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 42 316 3.0E-31
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 50 312 3.0E-31
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 47 317 5.0E-31
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 55 316 5.0E-31
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 53 316 6.0E-31
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 42 316 7.0E-31
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 47 317 8.0E-31
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 47 316 9.0E-31
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 53 318 1.0E-30
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 42 338 2.0E-30
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 52 317 2.0E-30
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 48 316 2.0E-30
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 53 317 3.0E-30
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 52 270 5.0E-30
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 55 332 5.0E-30
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 51 316 5.0E-30
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 57 261 5.0E-30
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 45 265 6.0E-30
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 51 316 6.0E-30
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 57 261 7.0E-30
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 52 335 7.0E-30
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 51 316 8.0E-30
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 55 318 8.0E-30
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 47 326 9.0E-30
sp|P07334|CDR1_SCHPO Mitosis inducer protein kinase cdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr1 PE=1 SV=3 55 339 1.0E-29
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 61 312 1.0E-29
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 61 312 1.0E-29
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 53 316 2.0E-29
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 61 312 2.0E-29
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 52 316 2.0E-29
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 46 316 2.0E-29
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 53 318 2.0E-29
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 53 318 2.0E-29
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 50 316 2.0E-29
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 52 318 2.0E-29
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 63 315 2.0E-29
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 53 318 2.0E-29
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 55 267 3.0E-29
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 47 312 4.0E-29
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 53 316 4.0E-29
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 52 354 5.0E-29
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 55 267 5.0E-29
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 47 340 5.0E-29
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 53 265 6.0E-29
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 43 317 8.0E-29
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 49 316 8.0E-29
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 63 317 9.0E-29
sp|A6ZU08|TOS3_YEAS7 Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain YJM789) GN=TOS3 PE=3 SV=1 10 269 1.0E-28
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 55 360 1.0E-28
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 47 316 1.0E-28
sp|P43637|TOS3_YEAST Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOS3 PE=1 SV=1 10 269 1.0E-28
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 53 265 1.0E-28
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 62 334 2.0E-28
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 55 272 2.0E-28
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 36 326 3.0E-28
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 53 261 3.0E-28
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 55 316 3.0E-28
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 39 265 3.0E-28
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 55 316 4.0E-28
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 52 312 4.0E-28
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 50 312 4.0E-28
sp|Q8AYC9|CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus GN=CHEK1 PE=1 SV=1 59 355 5.0E-28
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 53 327 5.0E-28
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 59 265 5.0E-28
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 24 316 6.0E-28
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 55 361 6.0E-28
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 24 316 6.0E-28
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 63 317 7.0E-28
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 59 316 8.0E-28
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 56 265 1.0E-27
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 63 272 1.0E-27
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 63 317 1.0E-27
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 63 317 1.0E-27
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 55 330 1.0E-27
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 55 310 2.0E-27
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 63 271 2.0E-27
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 47 316 2.0E-27
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 55 316 2.0E-27
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 53 316 2.0E-27
sp|Q55FJ6|Y8078_DICDI Probable serine/threonine-protein kinase DDB_G0268078 OS=Dictyostelium discoideum GN=DDB_G0268078 PE=3 SV=1 56 258 2.0E-27
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 63 316 2.0E-27
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 55 316 3.0E-27
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 55 316 3.0E-27
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 55 316 3.0E-27
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 55 265 3.0E-27
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 55 311 3.0E-27
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 45 265 3.0E-27
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 53 265 4.0E-27
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 50 265 4.0E-27
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 50 265 4.0E-27
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 55 265 4.0E-27
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 50 265 4.0E-27
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 55 316 5.0E-27
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 50 265 6.0E-27
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 14 316 6.0E-27
sp|Q9S9V0|CDPKV_ARATH Calcium-dependent protein kinase 31 OS=Arabidopsis thaliana GN=CPK31 PE=2 SV=2 59 265 6.0E-27
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 45 316 8.0E-27
sp|Q9LZW4|CIPKE_ARATH CBL-interacting serine/threonine-protein kinase 14 OS=Arabidopsis thaliana GN=CIPK14 PE=1 SV=1 41 266 8.0E-27
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 55 313 8.0E-27
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 59 316 9.0E-27
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 49 316 9.0E-27
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 58 329 1.0E-26
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 45 316 1.0E-26
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 52 261 1.0E-26
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 19 265 1.0E-26
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 59 316 2.0E-26
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 63 313 2.0E-26
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 55 452 2.0E-26
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 55 316 2.0E-26
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 55 318 2.0E-26
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 58 316 3.0E-26
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 50 265 3.0E-26
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 37 312 3.0E-26
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 50 265 3.0E-26
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 53 312 3.0E-26
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 50 265 3.0E-26
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 59 312 3.0E-26
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 50 265 4.0E-26
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 50 265 4.0E-26
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 59 318 4.0E-26
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 58 332 4.0E-26
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 59 316 4.0E-26
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 55 347 4.0E-26
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 13 279 4.0E-26
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 55 272 4.0E-26
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 49 336 5.0E-26
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 50 316 5.0E-26
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 59 384 5.0E-26
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 59 338 6.0E-26
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 58 329 6.0E-26
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 61 324 7.0E-26
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 55 272 7.0E-26
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 55 272 7.0E-26
sp|A2KF29|SMKTR_MOUSE Sperm motility kinase Tcr mutant form OS=Mus musculus GN=Smoktcr PE=2 SV=1 58 316 7.0E-26
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 58 329 7.0E-26
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 59 318 7.0E-26
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 63 316 7.0E-26
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 59 318 8.0E-26
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 55 316 1.0E-25
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 63 313 1.0E-25
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 58 329 1.0E-25
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 58 329 1.0E-25
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 58 329 1.0E-25
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 63 310 1.0E-25
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 55 341 1.0E-25
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 57 316 1.0E-25
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 57 315 1.0E-25
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 58 329 1.0E-25
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 55 265 1.0E-25
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 58 261 1.0E-25
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 47 349 1.0E-25
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 55 265 1.0E-25
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 55 316 1.0E-25
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 55 316 1.0E-25
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 57 395 1.0E-25
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 55 334 1.0E-25
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 53 261 2.0E-25
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 59 331 2.0E-25
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 55 267 2.0E-25
sp|Q0D4J7|SAPK2_ORYSJ Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica GN=SAPK2 PE=1 SV=1 56 318 2.0E-25
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 58 329 2.0E-25
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 53 261 2.0E-25
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 55 265 2.0E-25
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 59 261 2.0E-25
sp|A2YNT8|SAPK2_ORYSI Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica GN=SAPK2 PE=2 SV=2 56 318 2.0E-25
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 63 265 2.0E-25
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 58 316 2.0E-25
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 63 265 2.0E-25
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 63 346 2.0E-25
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 58 318 3.0E-25
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 63 316 3.0E-25
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 55 316 3.0E-25
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 59 312 3.0E-25
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 55 316 3.0E-25
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 63 340 4.0E-25
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 58 329 4.0E-25
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 58 315 4.0E-25
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 58 315 4.0E-25
sp|P53684|CDPKB_ORYSJ Calcium-dependent protein kinase isoform 11 OS=Oryza sativa subsp. japonica GN=CPK11 PE=2 SV=2 63 337 4.0E-25
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 63 332 4.0E-25
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 58 315 4.0E-25
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 58 315 4.0E-25
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 7 312 4.0E-25
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 59 336 5.0E-25
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 59 317 5.0E-25
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 55 272 5.0E-25
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 59 261 5.0E-25
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 62 334 5.0E-25
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 57 339 5.0E-25
sp|Q5AHG6|SCH9_CANAL Serine/threonine-protein kinase SCH9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCH9 PE=3 SV=1 57 388 5.0E-25
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 53 265 5.0E-25
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 32 265 5.0E-25
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 53 265 5.0E-25
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 55 316 5.0E-25
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 56 261 6.0E-25
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 59 331 6.0E-25
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 10 316 6.0E-25
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 58 316 6.0E-25
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 34 336 6.0E-25
sp|A0JLX3|SMK4A_MOUSE Sperm motility kinase 4A OS=Mus musculus GN=Smok4a PE=2 SV=2 58 316 6.0E-25
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 44 265 7.0E-25
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 58 312 7.0E-25
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 49 336 8.0E-25
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 58 312 9.0E-25
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 58 312 1.0E-24
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 53 261 1.0E-24
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 63 312 1.0E-24
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 49 334 1.0E-24
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 57 388 1.0E-24
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 58 329 1.0E-24
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 49 331 2.0E-24
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 58 329 2.0E-24
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 59 339 2.0E-24
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 58 329 2.0E-24
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 58 329 2.0E-24
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 58 315 2.0E-24
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 46 312 2.0E-24
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 59 265 2.0E-24
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 59 265 2.0E-24
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 56 266 2.0E-24
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 44 367 2.0E-24
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 63 334 3.0E-24
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 59 338 3.0E-24
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 59 424 3.0E-24
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 45 265 3.0E-24
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 63 333 3.0E-24
sp|Q75LR7|SAPK1_ORYSJ Serine/threonine-protein kinase SAPK1 OS=Oryza sativa subsp. japonica GN=SAPK1 PE=1 SV=1 63 318 3.0E-24
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 55 265 3.0E-24
sp|Q9M9E9|SRK2C_ARATH Serine/threonine-protein kinase SRK2C OS=Arabidopsis thaliana GN=SRK2C PE=1 SV=1 56 354 3.0E-24
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 57 289 3.0E-24
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 59 312 3.0E-24
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 59 265 3.0E-24
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 59 265 3.0E-24
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 59 265 3.0E-24
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 63 313 4.0E-24
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 61 341 4.0E-24
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 59 338 4.0E-24
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 28 341 5.0E-24
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 55 265 5.0E-24
sp|Q8W4I7|CDPKD_ARATH Calcium-dependent protein kinase 13 OS=Arabidopsis thaliana GN=CPK13 PE=1 SV=2 13 336 5.0E-24
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 63 333 5.0E-24
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 56 266 5.0E-24
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 62 316 6.0E-24
sp|O94547|SRK1_SCHPO Serine/threonine-protein kinase srk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srk1 PE=1 SV=1 59 348 6.0E-24
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 4 312 6.0E-24
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 59 336 6.0E-24
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 55 265 6.0E-24
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 57 284 6.0E-24
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 51 313 7.0E-24
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 58 329 7.0E-24
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 63 261 7.0E-24
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 57 313 9.0E-24
sp|Q9LYQ8|CIPK2_ARATH CBL-interacting serine/threonine-protein kinase 2 OS=Arabidopsis thaliana GN=CIPK2 PE=1 SV=1 52 317 1.0E-23
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 59 338 1.0E-23
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 29 310 1.0E-23
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 56 266 1.0E-23
sp|Q62070|PIM2_MOUSE Serine/threonine-protein kinase pim-2 OS=Mus musculus GN=Pim2 PE=1 SV=1 53 267 1.0E-23
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 56 311 1.0E-23
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 56 315 1.0E-23
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 63 265 2.0E-23
sp|P11309|PIM1_HUMAN Serine/threonine-protein kinase pim-1 OS=Homo sapiens GN=PIM1 PE=1 SV=3 53 267 2.0E-23
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 62 339 2.0E-23
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 49 316 2.0E-23
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 51 291 2.0E-23
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 59 261 2.0E-23
sp|P53682|CDPK1_ORYSJ Calcium-dependent protein kinase isoform 1 OS=Oryza sativa subsp. japonica GN=SPK PE=2 SV=2 63 339 2.0E-23
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 43 341 2.0E-23
sp|O61661|CHK1_DROME Serine/threonine-protein kinase grp OS=Drosophila melanogaster GN=grp PE=1 SV=2 59 315 2.0E-23
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 61 316 2.0E-23
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 7 281 2.0E-23
sp|Q9SJ61|CDPKP_ARATH Calcium-dependent protein kinase 25 OS=Arabidopsis thaliana GN=CPK25 PE=2 SV=1 58 357 2.0E-23
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 49 265 2.0E-23
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 9 312 2.0E-23
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 37 318 2.0E-23
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 63 272 3.0E-23
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 49 316 3.0E-23
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 62 316 3.0E-23
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 59 261 3.0E-23
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 53 265 3.0E-23
sp|O14019|HAL4_SCHPO Serine/threonine-protein kinase hal4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hal4 PE=1 SV=1 61 316 3.0E-23
sp|Q02066|AAIP_WHEAT Abscisic acid-inducible protein kinase (Fragment) OS=Triticum aestivum PE=2 SV=1 64 318 4.0E-23
sp|Q09136|AAPK1_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragments) OS=Sus scrofa GN=PRKAA1 PE=1 SV=2 106 265 4.0E-23
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 59 265 4.0E-23
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 59 261 4.0E-23
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 7 312 4.0E-23
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 63 316 5.0E-23
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 63 313 5.0E-23
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 59 265 5.0E-23
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 57 397 5.0E-23
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 29 310 5.0E-23
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 63 332 6.0E-23
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 29 310 6.0E-23
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 59 339 6.0E-23
sp|Q23023|UNC51_CAEEL Serine/threonine-protein kinase unc-51 OS=Caenorhabditis elegans GN=unc-51 PE=1 SV=1 61 265 6.0E-23
sp|O54992|MAPK5_MOUSE MAP kinase-activated protein kinase 5 OS=Mus musculus GN=Mapkapk5 PE=1 SV=1 54 313 7.0E-23
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 37 318 7.0E-23
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 56 318 9.0E-23
sp|Q95LJ0|PIM1_FELCA Serine/threonine-protein kinase pim-1 OS=Felis catus GN=PIM1 PE=2 SV=1 53 267 9.0E-23
sp|P26794|PIM1_RAT Serine/threonine-protein kinase pim-1 OS=Rattus norvegicus GN=Pim1 PE=1 SV=1 53 267 9.0E-23
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 54 376 1.0E-22
sp|Q9N0P9|PIM1_BOVIN Serine/threonine-protein kinase pim-1 OS=Bos taurus GN=PIM1 PE=2 SV=1 53 267 1.0E-22
sp|Q9ZSA3|CDPKM_ARATH Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana GN=CPK22 PE=3 SV=2 63 266 1.0E-22
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 49 316 1.0E-22
sp|Q9M101|CDPKN_ARATH Calcium-dependent protein kinase 23 OS=Arabidopsis thaliana GN=CPK23 PE=1 SV=1 70 316 1.0E-22
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 63 338 1.0E-22
sp|Q3SZW1|TSSK1_BOVIN Testis-specific serine/threonine-protein kinase 1 OS=Bos taurus GN=TSSK1B PE=2 SV=1 63 325 1.0E-22
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 44 311 1.0E-22
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 63 316 1.0E-22
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 58 316 2.0E-22
sp|P49138|MAPK2_MOUSE MAP kinase-activated protein kinase 2 OS=Mus musculus GN=Mapkapk2 PE=1 SV=2 60 261 2.0E-22
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 57 311 2.0E-22
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 38 316 2.0E-22
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 39 336 2.0E-22
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 63 313 2.0E-22
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 52 316 2.0E-22
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 50 281 2.0E-22
sp|P87050|CDR2_SCHPO Mitosis inducer protein kinase cdr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr2 PE=1 SV=1 55 265 2.0E-22
sp|Q75V57|SAPK9_ORYSJ Serine/threonine-protein kinase SAPK9 OS=Oryza sativa subsp. japonica GN=SAPK9 PE=2 SV=1 56 318 2.0E-22
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 61 265 3.0E-22
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 63 336 3.0E-22
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 59 312 3.0E-22
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 53 282 3.0E-22
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 59 316 3.0E-22
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 47 282 3.0E-22
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 63 313 3.0E-22
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 58 265 3.0E-22
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 58 344 3.0E-22
sp|B7XHR6|KIN1_ENTBH Probable serine/threonine-protein kinase KIN1 homolog OS=Enterocytozoon bieneusi (strain H348) GN=KIN1 PE=3 SV=1 55 318 3.0E-22
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 59 282 3.0E-22
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 51 269 3.0E-22
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 46 281 4.0E-22
sp|P0C5D6|SAPK3_ORYSJ Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1 53 318 4.0E-22
sp|A2ZAB5|SAPK3_ORYSI Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. indica GN=SAPK3 PE=1 SV=2 53 318 4.0E-22
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 53 282 4.0E-22
sp|Q9M9V8|CDPKA_ARATH Calcium-dependent protein kinase 10 OS=Arabidopsis thaliana GN=CPK10 PE=1 SV=1 63 336 4.0E-22
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 3 265 4.0E-22
sp|Q8SW31|KIN1_ENCCU Probable serine/threonine-protein kinase KIN1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=KIN1 PE=3 SV=1 55 316 4.0E-22
sp|Q8TD08|MK15_HUMAN Mitogen-activated protein kinase 15 OS=Homo sapiens GN=MAPK15 PE=1 SV=1 59 262 4.0E-22
sp|Q9D411|TSSK4_MOUSE Testis-specific serine/threonine-protein kinase 4 OS=Mus musculus GN=Tssk4 PE=2 SV=1 52 317 4.0E-22
sp|Q8IW41|MAPK5_HUMAN MAP kinase-activated protein kinase 5 OS=Homo sapiens GN=MAPKAPK5 PE=1 SV=2 54 313 5.0E-22
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 53 282 5.0E-22
sp|Q7Y0B9|SAPK8_ORYSJ Serine/threonine-protein kinase SAPK8 OS=Oryza sativa subsp. japonica GN=SAPK8 PE=2 SV=1 56 318 5.0E-22
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 55 294 5.0E-22
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 49 265 5.0E-22
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 13 265 6.0E-22
sp|Q66HE7|CDKL1_RAT Cyclin-dependent kinase-like 1 OS=Rattus norvegicus GN=Cdkl1 PE=2 SV=1 63 275 6.0E-22
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 59 316 6.0E-22
sp|Q00532|CDKL1_HUMAN Cyclin-dependent kinase-like 1 OS=Homo sapiens GN=CDKL1 PE=1 SV=5 63 275 6.0E-22
sp|P49139|MAPK2_RABIT MAP kinase-activated protein kinase 2 (Fragment) OS=Oryctolagus cuniculus GN=MAPKAPK2 PE=1 SV=2 60 261 6.0E-22
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 35 266 6.0E-22
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 57 274 7.0E-22
sp|P49137|MAPK2_HUMAN MAP kinase-activated protein kinase 2 OS=Homo sapiens GN=MAPKAPK2 PE=1 SV=1 60 261 7.0E-22
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 42 280 7.0E-22
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 61 316 7.0E-22
sp|P06803|PIM1_MOUSE Serine/threonine-protein kinase pim-1 OS=Mus musculus GN=Pim1 PE=1 SV=2 53 266 7.0E-22
sp|Q61241|TSSK1_MOUSE Testis-specific serine/threonine-protein kinase 1 OS=Mus musculus GN=Tssk1b PE=1 SV=2 63 316 7.0E-22
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 61 262 7.0E-22
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 61 265 8.0E-22
sp|P25333|HAL4_YEAST Serine/threonine-protein kinase HAL4/SAT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAT4 PE=1 SV=1 61 316 8.0E-22
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 63 275 8.0E-22
sp|Q9C9M7|CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana GN=CDKD-2 PE=1 SV=1 61 337 8.0E-22
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 59 316 9.0E-22
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 58 265 9.0E-22
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 56 318 1.0E-21
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 57 316 1.0E-21
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 58 358 1.0E-21
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 57 316 1.0E-21
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 63 312 1.0E-21
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 56 266 1.0E-21
sp|Q86V86|PIM3_HUMAN Serine/threonine-protein kinase pim-3 OS=Homo sapiens GN=PIM3 PE=1 SV=3 53 267 1.0E-21
sp|O70444|PIM3_RAT Serine/threonine-protein kinase pim-3 OS=Rattus norvegicus GN=Pim3 PE=1 SV=3 58 267 1.0E-21
sp|P0C198|CHK1_USTMA Serine/threonine-protein kinase CHK1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHK1 PE=3 SV=1 58 317 1.0E-21
sp|P58750|PIM3_MOUSE Serine/threonine-protein kinase pim-3 OS=Mus musculus GN=Pim3 PE=1 SV=1 58 267 1.0E-21
sp|Q940H6|SRK2E_ARATH Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1 56 318 1.0E-21
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 56 265 1.0E-21
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 52 266 1.0E-21
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 61 265 1.0E-21
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 58 313 2.0E-21
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 58 313 2.0E-21
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 59 316 2.0E-21
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 41 265 2.0E-21
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 52 266 2.0E-21
sp|Q8CEQ0|CDKL1_MOUSE Cyclin-dependent kinase-like 1 OS=Mus musculus GN=Cdkl1 PE=2 SV=1 63 275 2.0E-21
sp|Q9SMQ4|SRK2F_ARATH Serine/threonine-protein kinase SRK2F OS=Arabidopsis thaliana GN=SRK2F PE=1 SV=1 63 316 2.0E-21
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 58 316 2.0E-21
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 61 267 2.0E-21
sp|O08605|MKNK1_MOUSE MAP kinase-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Mknk1 PE=1 SV=2 58 265 2.0E-21
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 58 261 2.0E-21
sp|Q8C1R0|TSSK5_MOUSE Testis-specific serine/threonine-protein kinase 5 OS=Mus musculus GN=Tssk5 PE=2 SV=2 52 267 2.0E-21
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 56 266 2.0E-21
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 63 316 2.0E-21
sp|Q66JF3|MKNK1_XENTR MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus tropicalis GN=mknk1 PE=2 SV=1 61 261 2.0E-21
sp|P00518|PHKG1_RABIT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus GN=PHKG1 PE=1 SV=2 61 265 2.0E-21
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 56 319 2.0E-21
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 61 265 2.0E-21
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 61 265 3.0E-21
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 61 409 3.0E-21
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 48 288 3.0E-21
sp|Q6AXJ9|CDKL1_DANRE Cyclin-dependent kinase-like 1 OS=Danio rerio GN=cdkl1 PE=2 SV=1 63 275 3.0E-21
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 58 329 3.0E-21
sp|P13286|PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus GN=Phkg1 PE=2 SV=2 61 265 3.0E-21
sp|Q95QC4|DCLK_CAEEL Serine/threonine-protein kinase zyg-8 OS=Caenorhabditis elegans GN=zyg-8 PE=1 SV=1 40 316 3.0E-21
sp|Q9YGW0|MKNK1_XENLA MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus laevis GN=mknk1 PE=2 SV=2 61 265 3.0E-21
sp|P50526|SSP1_SCHPO Serine/threonine-protein kinase ssp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp1 PE=1 SV=1 50 317 3.0E-21
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 56 311 3.0E-21
sp|P34208|CHK1_SCHPO Serine/threonine-protein kinase chk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chk1 PE=1 SV=2 63 280 3.0E-21
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 61 266 3.0E-21
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 56 311 3.0E-21
sp|Q39192|SRK2D_ARATH Serine/threonine-protein kinase SRK2D OS=Arabidopsis thaliana GN=SRK2D PE=1 SV=1 63 318 4.0E-21
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 58 313 4.0E-21
sp|Q9D2E1|TSSK3_MOUSE Testis-specific serine/threonine-protein kinase 3 OS=Mus musculus GN=Tssk3 PE=2 SV=1 52 305 4.0E-21
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 63 318 4.0E-21
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 35 266 4.0E-21
sp|Q9UU87|PPK34_SCHPO Serine/threonine-protein kinase ppk34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk34 PE=3 SV=2 42 316 5.0E-21
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 58 329 5.0E-21
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 59 316 5.0E-21
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 57 265 5.0E-21
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 61 267 5.0E-21
sp|Q11090|YWY3_CAEEL Putative serine/threonine-protein kinase C01C4.3 OS=Caenorhabditis elegans GN=C01C4.3 PE=3 SV=3 13 269 5.0E-21
sp|Q3Y416|KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans GN=ckk-1 PE=1 SV=2 58 317 6.0E-21
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 55 330 6.0E-21
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 63 312 6.0E-21
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 63 312 6.0E-21
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 52 266 7.0E-21
sp|O54863|TSSK2_MOUSE Testis-specific serine/threonine-protein kinase 2 OS=Mus musculus GN=Tssk2 PE=1 SV=2 63 318 7.0E-21
sp|Q9N3Z3|CHK1_CAEEL Serine/threonine-protein kinase chk-1 OS=Caenorhabditis elegans GN=chk-1 PE=2 SV=2 54 278 7.0E-21
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 56 262 7.0E-21
sp|Q6P431|MKNK2_XENLA MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus laevis GN=mknk2 PE=2 SV=1 61 265 7.0E-21
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 51 281 7.0E-21
sp|Q3SYZ2|MAPK3_BOVIN MAP kinase-activated protein kinase 3 OS=Bos taurus GN=MAPKAPK3 PE=2 SV=1 61 261 7.0E-21
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 58 313 7.0E-21
sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 61 278 8.0E-21
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 55 265 8.0E-21
sp|P07934|PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus GN=Phkg1 PE=1 SV=3 61 265 8.0E-21
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 56 354 8.0E-21
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 58 316 8.0E-21
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 56 311 8.0E-21
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 56 265 8.0E-21
sp|P23573|CDK2_DROME Cyclin-dependent kinase 2 OS=Drosophila melanogaster GN=Cdk2 PE=1 SV=1 56 278 8.0E-21
sp|Q66I46|MKNK2_XENTR MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus tropicalis GN=mknk2 PE=2 SV=1 61 265 8.0E-21
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 61 318 9.0E-21
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 43 316 9.0E-21
sp|P49136|MAPK2_CRILO MAP kinase-activated protein kinase 2 (Fragment) OS=Cricetulus longicaudatus GN=MAPKAPK2 PE=2 SV=1 66 261 9.0E-21
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 58 313 9.0E-21
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 63 276 1.0E-20
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 58 312 1.0E-20
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 58 312 1.0E-20
sp|O54784|DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus GN=Dapk3 PE=1 SV=1 58 315 1.0E-20
sp|P38147|CHK1_YEAST Serine/threonine-protein kinase CHK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHK1 PE=1 SV=1 59 317 1.0E-20
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 63 272 1.0E-20
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 56 278 1.0E-20
sp|P48734|CDK1_BOVIN Cyclin-dependent kinase 1 OS=Bos taurus GN=CDK1 PE=2 SV=2 61 278 1.0E-20
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 58 329 1.0E-20
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 56 312 1.0E-20
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 63 318 1.0E-20
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 63 266 1.0E-20
sp|O88764|DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus GN=Dapk3 PE=1 SV=1 58 315 1.0E-20
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 57 291 1.0E-20
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 48 272 1.0E-20
sp|Q6ZI44|SAPK6_ORYSJ Serine/threonine-protein kinase SAPK6 OS=Oryza sativa subsp. japonica GN=SAPK6 PE=2 SV=1 56 318 1.0E-20
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 56 311 2.0E-20
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 58 313 2.0E-20
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 51 265 2.0E-20
sp|O64812|SRK2J_ARATH Serine/threonine-protein kinase SRK2J OS=Arabidopsis thaliana GN=SRK2J PE=1 SV=1 56 318 2.0E-20
sp|Q4G050|MKNK1_RAT MAP kinase-interacting serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mknk1 PE=2 SV=1 58 265 2.0E-20
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 59 317 2.0E-20
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 59 312 2.0E-20
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 59 317 2.0E-20
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 59 315 2.0E-20
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 51 265 2.0E-20
sp|Q9P1W9|PIM2_HUMAN Serine/threonine-protein kinase pim-2 OS=Homo sapiens GN=PIM2 PE=1 SV=1 53 267 2.0E-20
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 63 316 2.0E-20
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 63 265 2.0E-20
sp|Q7XQP4|SAPK7_ORYSJ Serine/threonine-protein kinase SAPK7 OS=Oryza sativa subsp. japonica GN=SAPK7 PE=2 SV=2 56 318 2.0E-20
sp|P39951|CDK1_RAT Cyclin-dependent kinase 1 OS=Rattus norvegicus GN=Cdk1 PE=1 SV=1 61 278 2.0E-20
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 56 311 3.0E-20
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 11 312 1.0E-19
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 58 330 3.0E-19
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 58 323 1.0E-18
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 59 289 3.0E-15
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 58 312 1.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8238
MQHHGPFGYPTPPASPAYDDVKASLHQQPAFAARPFHARCVPLAPEERLGRMLEGKLQLTEILGTGAYGVVYAAV
DVKTGVRYAVKCLSKFGPDGAPLERRQAVYQQREIRLHYQASAHPNVVSMLKIVDDPDCIYVILEYCPEGDLFLN
ITELGQYVGKDALSRKVFLQILDAVEYCHKLGIYHRDLKPENILVTDNGETVKLADFGLATSDDHSEDYGCGSTF
YMSPECLDPSTKKPYYMCAPNDVWSLGVILVNLTCGRNPWKQASFQDSTYRAYARSRDFLKTILPLSDELNDILA
CIFHPCPEHRITLPELRSRILACPRFTVSPAAPTPPATPPHTTTASPPEYVSHEDAIVDDIEYESPLSPASTASD
DGSLTSSASTIDDLDDDFMREPPTQDYTPLTYEPDGFRDAHPALFHGQDYVAQQYTGPVPAAAHAPMVVQLPPPP
PQVVPCPPAHVPIQAPVPVQAPCHQPRSFFPLWEVVKYVQQVPMGGHHPAAFHQQVQFLPSYQGCY*
Coding >Hirsu2|8238
ATGCAGCACCATGGCCCCTTTGGATACCCCACGCCGCCCGCCTCGCCCGCCTATGACGATGTCAAGGCCAGCCTC
CACCAGCAGCCGGCCTTCGCCGCCCGGCCCTTCCACGCCCGCTGCGTCCCGCTAGCCCCCGAGGAGCGCCTGGGC
CGCATGCTCGAGGGTAAGCTCCAGCTGACGGAGATCTTGGGCACCGGCGCCTACGGCGTCGTCTACGCCGCCGTC
GATGTCAAGACGGGCGTTCGCTACGCCGTCAAGTGCCTGAGCAAGTTTGGCCCGGACGGCGCGCCGCTGGAGCGC
CGCCAGGCCGTCTACCAGCAGCGCGAGATCCGCCTGCACTACCAGGCCTCGGCCCATCCCAACGTCGTCTCCATG
CTCAAGATCGTCGACGACCCGGACTGCATCTACGTCATCCTCGAGTACTGCCCGGAGGGCGACCTGTTCCTCAAC
ATCACCGAGCTGGGCCAGTACGTCGGCAAGGACGCTCTGTCGCGCAAGGTCTTCCTGCAGATCCTTGACGCCGTC
GAGTACTGCCACAAGCTTGGCATCTACCACCGGGACCTCAAGCCCGAGAACATCCTGGTCACCGACAACGGCGAG
ACGGTCAAGCTTGCCGACTTTGGCCTGGCCACGTCCGATGACCACTCCGAGGACTACGGCTGCGGCTCGACCTTT
TACATGAGTCCAGAGTGCCTGGACCCCTCCACCAAGAAGCCGTACTACATGTGCGCCCCCAACGACGTCTGGTCG
CTGGGCGTCATCCTCGTCAACCTGACGTGCGGACGCAACCCGTGGAAGCAGGCCTCCTTCCAGGACTCGACCTAC
CGCGCCTACGCCCGCTCGCGAGATTTCCTCAAGACGATTCTTCCCCTGTCGGACGAGCTCAACGACATCCTCGCC
TGCATCTTCCACCCCTGCCCGGAGCACCGCATCACGCTCCCGGAGCTCCGCAGCCGGATCTTGGCCTGCCCCCGC
TTCACCGTCTCGCCCGCCGCGCCGACGCCGCCCGCGACCCCCCCGCACACGACCACCGCCTCCCCCCCCGAATAC
GTTAGCCACGAGGACGCCATCGTCGACGACATCGAGTACGAGTCGCCGCTTTCGCCGGCCTCGACCGCCTCGGAC
GACGGCTCTCTCACCTCGAGCGCCTCCACCATCGACGACCTGGACGACGACTTCATGCGCGAGCCGCCGACGCAG
GACTACACGCCTCTCACGTACGAGCCCGACGGCTTCCGCGACGCCCACCCCGCCCTCTTCCACGGCCAGGACTAC
GTGGCCCAGCAGTACACGGGGCCCGTCCCGGCCGCCGCGCACGCGCCCATGGTCGTCCAGCTCCCGCCGCCGCCG
CCGCAGGTCGTGCCGTGCCCGCCCGCGCACGTACCCATTCAGGCTCCGGTCCCCGTCCAGGCTCCCTGTCACCAG
CCCCGATCATTCTTCCCCCTGTGGGAGGTGGTCAAATACGTTCAGCAGGTCCCTATGGGCGGCCATCACCCGGCC
GCCTTCCACCAGCAGGTGCAGTTTCTGCCCTCCTACCAAGGCTGCTATTAG
Transcript >Hirsu2|8238
ATGCAGCACCATGGCCCCTTTGGATACCCCACGCCGCCCGCCTCGCCCGCCTATGACGATGTCAAGGCCAGCCTC
CACCAGCAGCCGGCCTTCGCCGCCCGGCCCTTCCACGCCCGCTGCGTCCCGCTAGCCCCCGAGGAGCGCCTGGGC
CGCATGCTCGAGGGTAAGCTCCAGCTGACGGAGATCTTGGGCACCGGCGCCTACGGCGTCGTCTACGCCGCCGTC
GATGTCAAGACGGGCGTTCGCTACGCCGTCAAGTGCCTGAGCAAGTTTGGCCCGGACGGCGCGCCGCTGGAGCGC
CGCCAGGCCGTCTACCAGCAGCGCGAGATCCGCCTGCACTACCAGGCCTCGGCCCATCCCAACGTCGTCTCCATG
CTCAAGATCGTCGACGACCCGGACTGCATCTACGTCATCCTCGAGTACTGCCCGGAGGGCGACCTGTTCCTCAAC
ATCACCGAGCTGGGCCAGTACGTCGGCAAGGACGCTCTGTCGCGCAAGGTCTTCCTGCAGATCCTTGACGCCGTC
GAGTACTGCCACAAGCTTGGCATCTACCACCGGGACCTCAAGCCCGAGAACATCCTGGTCACCGACAACGGCGAG
ACGGTCAAGCTTGCCGACTTTGGCCTGGCCACGTCCGATGACCACTCCGAGGACTACGGCTGCGGCTCGACCTTT
TACATGAGTCCAGAGTGCCTGGACCCCTCCACCAAGAAGCCGTACTACATGTGCGCCCCCAACGACGTCTGGTCG
CTGGGCGTCATCCTCGTCAACCTGACGTGCGGACGCAACCCGTGGAAGCAGGCCTCCTTCCAGGACTCGACCTAC
CGCGCCTACGCCCGCTCGCGAGATTTCCTCAAGACGATTCTTCCCCTGTCGGACGAGCTCAACGACATCCTCGCC
TGCATCTTCCACCCCTGCCCGGAGCACCGCATCACGCTCCCGGAGCTCCGCAGCCGGATCTTGGCCTGCCCCCGC
TTCACCGTCTCGCCCGCCGCGCCGACGCCGCCCGCGACCCCCCCGCACACGACCACCGCCTCCCCCCCCGAATAC
GTTAGCCACGAGGACGCCATCGTCGACGACATCGAGTACGAGTCGCCGCTTTCGCCGGCCTCGACCGCCTCGGAC
GACGGCTCTCTCACCTCGAGCGCCTCCACCATCGACGACCTGGACGACGACTTCATGCGCGAGCCGCCGACGCAG
GACTACACGCCTCTCACGTACGAGCCCGACGGCTTCCGCGACGCCCACCCCGCCCTCTTCCACGGCCAGGACTAC
GTGGCCCAGCAGTACACGGGGCCCGTCCCGGCCGCCGCGCACGCGCCCATGGTCGTCCAGCTCCCGCCGCCGCCG
CCGCAGGTCGTGCCGTGCCCGCCCGCGCACGTACCCATTCAGGCTCCGGTCCCCGTCCAGGCTCCCTGTCACCAG
CCCCGATCATTCTTCCCCCTGTGGGAGGTGGTCAAATACGTTCAGCAGGTCCCTATGGGCGGCCATCACCCGGCC
GCCTTCCACCAGCAGGTGCAGTTTCTGCCCTCCTACCAAGGCTGCTATTAG
Gene >Hirsu2|8238
ATGCAGCACCATGGCCCCTTTGGATACCCCACGCCGCCCGCCTCGCCCGCCTATGACGATGTCAAGGCCAGCCTC
CACCAGCAGCCGGCCTTCGCCGCCCGGCCCTTCCACGCCCGCTGCGTCCCGCTAGCCCCCGAGGAGCGCCTGGGC
CGCATGCTCGAGGGTAAGCTCCAGCTGACGGAGATCTTGGGCACCGGCGCCTACGGCGTCGTCTACGCCGCCGTC
GATGTCAAGACGGGCGTTCGCTACGCCGTCAAGTGCCTGAGCAAGTTTGGCCCGGACGGCGCGCCGCTGGAGCGC
CGCCAGGCCGTCTACCAGCAGCGCGAGATCCGCCTGCACTACCAGGCCTCGGCCCATCCCAACGTCGTCTCCATG
CTCAAGATCGTCGACGACCCGGACTGCATCTACGTCATCCTCGAGTACTGCCCGGAGGGCGACCTGTTCCTCAAC
ATCACCGAGCTGGGCCAGTACGTCGGCAAGGACGCTCTGTCGCGCAAGGTCTTCCTGCAGATCCTTGACGCCGTC
GAGTACTGCCACAAGCTTGGCATCTACCACCGGGACCTCAAGCCCGAGAACATCCTGGTCACCGACAACGGCGAG
ACGGTCAAGCTTGCCGACTTTGGCCTGGCCACGTCCGATGACCACTCCGAGGACTACGGCTGCGGCTCGACCTTT
TACATGAGTCCAGGTACATACCCACCCACCACCGTCTTTCCCTGCAACGGCCATGGCTGTGCCTGGATAATACCC
CTTACGTCCCCCATGATCCCTTGTCTCTGCCCTCGGCAACCGTCCACTGACCATGTCGTCTTCTGCTTCCTACAG
AGTGCCTGGACCCCTCCACCAAGAAGCCGTACTACATGTGCGCCCCCAACGACGTCTGGTCGCTGGGCGTCATCC
TCGTCAACCTGACGTGCGGACGCAACCCGTGGAAGCAGGCCTCCTTCCAGGACTCGACCTACCGCGCCTACGCCC
GCTCGCGAGATTTCCTCAAGACGATTCTTCCCCTGTCGGACGAGCTCAACGACATCCTCGCCTGCATCTTCCACC
CCTGCCCGGAGCACCGCATCACGCTCCCGGAGCTCCGCAGCCGGATCTTGGCCTGCCCCCGCTTCACCGTCTCGC
CCGCCGCGCCGACGCCGCCCGCGACCCCCCCGCACACGACCACCGCCTCCCCCCCCGAATACGTTAGCCACGAGG
ACGCCATCGTCGACGACATCGAGTACGAGTCGCCGCTTTCGCCGGCCTCGACCGCCTCGGACGACGGCTCTCTCA
CCTCGAGCGCCTCCACCATCGACGACCTGGACGACGACTTCATGCGCGAGCCGCCGACGCAGGACTACACGCCTC
TCACGTACGAGCCCGACGGCTTCCGCGACGCCCACCCCGCCCTCTTCCACGGCCAGGACTACGTGGCCCAGCAGT
ACACGGGGCCCGTCCCGGCCGCCGCGCACGCGCCCATGGTCGTCCAGCTCCCGCCGCCGCCGCCGCAGGTCGTGC
CGTGCCCGCCCGCGCACGTACCCATTCAGGCTCCGGTCCCCGTCCAGGCTCCCTGTCACCAGCCCCGATCATTCT
TCCCCCTGTGGGAGGTGGTCAAATACGTTCAGCAGGTCCCTATGGGCGGCCATCACCCGGCCGCCTTCCACCAGC
AGGTGCAGTTTCTGCCCTCCTACCAAGGCTGCTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail