Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8232
Gene name
LocationContig_523:6644..7325
Strand+
Gene length (bp)681
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13689|YDYA_SCHPO Uncharacterized protein C11E3.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11E3.10 PE=4 SV=2 3 132 8.0E-24

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 36 53 17
3 60 79 19
4 94 111 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8232
MRVRLPFAGFFLLLLFLAAYAGLTTFRAGQYVNDKVLHVLTFFLLTAVFYWIVDTNRRRTVNMTLVVCTLILGVG
SEFVQSFLPNDRDFDMYDIVANLVGSLAALGLCSWYHRRMLERRRKRKSYHPVPGEDGTDVELGQDHETGIVEGP
SQPRTLEEEVDNWDENAADDWDGDVGVAPSSPQAAKAKIPESHDIGDTKKRSD*
Coding >Hirsu2|8232
ATGCGCGTTCGCCTGCCGTTCGCCGGCTTCTTCCTACTGCTCCTGTTCCTCGCCGCCTATGCCGGGCTCACGACC
TTCCGTGCGGGCCAGTATGTCAACGACAAGGTCCTGCACGTCCTGACTTTTTTCCTCCTCACCGCCGTCTTCTAC
TGGATCGTCGATACGAACCGCCGGCGCACCGTCAACATGACACTCGTCGTCTGTACCCTCATCTTGGGTGTGGGC
TCCGAATTCGTCCAAAGCTTCCTTCCAAACGATCGCGACTTCGACATGTACGATATTGTGGCCAACCTTGTGGGA
AGCCTTGCAGCTCTGGGTCTCTGTTCCTGGTACCATCGGCGCATGCTCGAGCGGCGAAGGAAGCGCAAGTCGTAC
CACCCGGTTCCGGGGGAAGACGGCACAGACGTTGAGCTCGGCCAAGACCACGAGACGGGAATAGTCGAGGGTCCA
TCTCAGCCGAGGACGTTGGAGGAGGAGGTGGACAACTGGGACGAGAACGCGGCTGACGATTGGGATGGCGATGTT
GGCGTCGCTCCATCCTCACCTCAAGCCGCCAAGGCCAAGATCCCAGAGAGCCATGATATCGGGGACACCAAGAAA
CGGTCAGACTGA
Transcript >Hirsu2|8232
ATGCGCGTTCGCCTGCCGTTCGCCGGCTTCTTCCTACTGCTCCTGTTCCTCGCCGCCTATGCCGGGCTCACGACC
TTCCGTGCGGGCCAGTATGTCAACGACAAGGTCCTGCACGTCCTGACTTTTTTCCTCCTCACCGCCGTCTTCTAC
TGGATCGTCGATACGAACCGCCGGCGCACCGTCAACATGACACTCGTCGTCTGTACCCTCATCTTGGGTGTGGGC
TCCGAATTCGTCCAAAGCTTCCTTCCAAACGATCGCGACTTCGACATGTACGATATTGTGGCCAACCTTGTGGGA
AGCCTTGCAGCTCTGGGTCTCTGTTCCTGGTACCATCGGCGCATGCTCGAGCGGCGAAGGAAGCGCAAGTCGTAC
CACCCGGTTCCGGGGGAAGACGGCACAGACGTTGAGCTCGGCCAAGACCACGAGACGGGAATAGTCGAGGGTCCA
TCTCAGCCGAGGACGTTGGAGGAGGAGGTGGACAACTGGGACGAGAACGCGGCTGACGATTGGGATGGCGATGTT
GGCGTCGCTCCATCCTCACCTCAAGCCGCCAAGGCCAAGATCCCAGAGAGCCATGATATCGGGGACACCAAGAAA
CGGTCAGACTGA
Gene >Hirsu2|8232
ATGCGCGTTCGCCTGCCGTTCGCCGGTGAGTTCCGCAATCATGGCCGCGTGTTGGGAACTGATAATTGGCCTTGC
TGATCGCTTCCGCTACCAGGCTTCTTCCTACTGCTCCTGTTCCTCGCCGCCTATGCCGGGCTCACGACCTTCCGT
GCGGGCCAGTATGTCAACGACAAGGTCCTGCACGTCCTGACTTTTTTCCTCCTCACCGCCGTCTTCTACTGGATC
GTCGATACGAACCGCCGGCGCACCGTCAACATGACACTCGTCGTCTGTACCCTCATCTTGGGTGTGGGCTCCGAA
TTCGTCCAAAGCTTCCTTCCAAACGATCGCGACTTCGACATGTACGATATTGTGGCCAACCTTGTGGGAAGCCTT
GCAGCTCTGGGTCTCTGTTCCTGGTACCATCGGCGCATGCTCGAGCGGCGAAGGAAGCGCAAGTCGTACCACCCG
GTTCCGGGGGAAGACGGCACAGACGTTGAGCTCGGCCAAGACCACGAGACGGGAATAGTCGAGGGTCCATCTCAG
CCGAGGACGTTGGAGGAGGAGGTGGACAACTGGGACGAGAACGCGGCTGACGATTGGGATGGCGATGTTGGCGTC
GCTCCATCCTCACCTCAAGCCGCCAAGGCCAAGATCCCAGAGAGCCATGATATCGGGGACACCAAGAAACGGTCA
GACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail