Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8231
Gene name
LocationContig_523:1508..5029
Strand-
Gene length (bp)3521
Transcript length (bp)3444
Coding sequence length (bp)3444
Protein length (aa) 1148

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00439 Bromodomain Bromodomain 2.0E-18 325 401
PF07524 Bromo_TP Bromodomain associated 2.9E-09 781 833

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87152|SPT7_SCHPO Transcriptional activator spt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt7 PE=1 SV=2 212 1048 3.0E-102
sp|P35177|SPT7_YEAST Transcriptional activator SPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT7 PE=1 SV=1 161 469 6.0E-52
sp|P35177|SPT7_YEAST Transcriptional activator SPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT7 PE=1 SV=1 554 965 9.0E-37
sp|Q54UW4|Y0777_DICDI Bromodomain-containing protein DDB_G0280777 OS=Dictyostelium discoideum GN=DDB_G0280777 PE=3 SV=1 296 425 3.0E-21
sp|Q03330|GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN5 PE=1 SV=1 324 424 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87152|SPT7_SCHPO Transcriptional activator spt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt7 PE=1 SV=2 212 1048 3.0E-102
sp|P35177|SPT7_YEAST Transcriptional activator SPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT7 PE=1 SV=1 161 469 6.0E-52
sp|P35177|SPT7_YEAST Transcriptional activator SPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT7 PE=1 SV=1 554 965 9.0E-37
sp|Q54UW4|Y0777_DICDI Bromodomain-containing protein DDB_G0280777 OS=Dictyostelium discoideum GN=DDB_G0280777 PE=3 SV=1 296 425 3.0E-21
sp|Q03330|GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN5 PE=1 SV=1 324 424 2.0E-14
sp|Q6CXW4|GCN5_KLULA Histone acetyltransferase GCN5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GCN5 PE=3 SV=1 322 424 4.0E-14
sp|Q756G9|GCN5_ASHGO Histone acetyltransferase GCN5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GCN5 PE=3 SV=1 322 424 1.0E-13
sp|Q12830|BPTF_HUMAN Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens GN=BPTF PE=1 SV=3 319 397 2.0E-13
sp|Q6FTW5|GCN5_CANGA Histone acetyltransferase GCN5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GCN5 PE=3 SV=1 322 424 5.0E-13
sp|Q9BXF3|CECR2_HUMAN Cat eye syndrome critical region protein 2 OS=Homo sapiens GN=CECR2 PE=1 SV=2 322 397 3.0E-12
sp|Q9UUK2|GCN5_SCHPO Histone acetyltransferase gcn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn5 PE=1 SV=1 321 417 2.0E-11
sp|Q8WZM0|GCN5_YARLI Histone acetyltransferase GCN5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GCN5 PE=3 SV=1 322 424 3.0E-11
sp|Q9JHD2|KAT2A_MOUSE Histone acetyltransferase KAT2A OS=Mus musculus GN=Kat2a PE=1 SV=2 319 397 6.0E-11
sp|Q92830|KAT2A_HUMAN Histone acetyltransferase KAT2A OS=Homo sapiens GN=KAT2A PE=1 SV=3 319 397 7.0E-11
sp|Q92831|KAT2B_HUMAN Histone acetyltransferase KAT2B OS=Homo sapiens GN=KAT2B PE=1 SV=3 312 397 1.0E-10
sp|Q9JHD1|KAT2B_MOUSE Histone acetyltransferase KAT2B OS=Mus musculus GN=Kat2b PE=1 SV=2 312 397 1.0E-10
sp|Q9HGP4|YK82_SCHPO Bromodomain-containing protein C631.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC631.02 PE=1 SV=3 292 425 1.0E-10
sp|Q9Y7N0|BDF1_SCHPO SWR1 complex bromodomain subunit bdf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bdf1 PE=1 SV=1 328 424 2.0E-10
sp|P13709|FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster GN=fs(1)h PE=1 SV=2 317 397 3.0E-10
sp|O88379|BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus GN=Baz1a PE=1 SV=3 245 397 4.0E-10
sp|Q8UVR5|BAZ1A_XENLA Bromodomain adjacent to zinc finger domain protein 1A (Fragment) OS=Xenopus laevis GN=baz1a PE=2 SV=1 324 398 4.0E-10
sp|P35817|BDF1_YEAST Bromodomain-containing factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDF1 PE=1 SV=3 325 409 6.0E-10
sp|F1R5H6|BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio GN=brd4 PE=1 SV=1 320 398 9.0E-10
sp|Q9W0T1|NU301_DROME Nucleosome-remodeling factor subunit NURF301 OS=Drosophila melanogaster GN=E(bx) PE=1 SV=2 323 397 9.0E-10
sp|Q9HGP4|YK82_SCHPO Bromodomain-containing protein C631.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC631.02 PE=1 SV=3 339 431 2.0E-09
sp|Q9NRL2|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2 324 397 2.0E-09
sp|Q9UIF8|BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens GN=BAZ2B PE=1 SV=3 328 417 3.0E-09
sp|Q6BGW1|GCN5_DEBHA Histone acetyltransferase GCN5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GCN5 PE=3 SV=2 322 399 4.0E-09
sp|Q9H0E9|BRD8_HUMAN Bromodomain-containing protein 8 OS=Homo sapiens GN=BRD8 PE=1 SV=2 329 422 6.0E-09
sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 297 397 1.0E-08
sp|Q54DH8|TAF1_DICDI Transcription initiation factor TFIID subunit 1 OS=Dictyostelium discoideum GN=taf1 PE=3 SV=1 320 398 1.0E-08
sp|Q58F21|BRDT_HUMAN Bromodomain testis-specific protein OS=Homo sapiens GN=BRDT PE=1 SV=4 328 457 2.0E-08
sp|Q9DE13|BAZ2B_CHICK Bromodomain adjacent to zinc finger domain protein 2B OS=Gallus gallus GN=BAZ2B PE=2 SV=1 328 417 2.0E-08
sp|P51123|TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster GN=Taf1 PE=1 SV=3 317 397 2.0E-08
sp|B7ZS37|BAZ2A_XENLA Bromodomain adjacent to zinc finger domain protein 2A OS=Xenopus laevis GN=baz2a PE=2 SV=1 325 399 3.0E-08
sp|Q6E2N3|TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio GN=trim33 PE=2 SV=1 307 398 4.0E-08
sp|P21675|TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens GN=TAF1 PE=1 SV=2 325 397 4.0E-08
sp|Q9UIF9|BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens GN=BAZ2A PE=1 SV=4 325 407 5.0E-08
sp|Q91YE5|BAZ2A_MOUSE Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus GN=Baz2a PE=1 SV=2 325 407 5.0E-08
sp|D4A7T3|BRDT_RAT Bromodomain testis-specific protein OS=Rattus norvegicus GN=Brdt PE=1 SV=1 314 429 5.0E-08
sp|Q84XV2|GTE1_ARATH Transcription factor GTE1 OS=Arabidopsis thaliana GN=GTE1 PE=2 SV=1 334 442 5.0E-08
sp|Q6DFF2|BRD4B_XENLA Bromodomain-containing protein 4B OS=Xenopus laevis GN=brd4-b PE=2 SV=1 320 398 5.0E-08
sp|Q07442|BDF2_YEAST Bromodomain-containing factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDF2 PE=1 SV=1 322 401 5.0E-08
sp|Q6DFF2|BRD4B_XENLA Bromodomain-containing protein 4B OS=Xenopus laevis GN=brd4-b PE=2 SV=1 333 397 6.0E-08
sp|Q9FGW9|GTE10_ARATH Transcription factor GTE10 OS=Arabidopsis thaliana GN=GTE10 PE=1 SV=2 321 436 7.0E-08
sp|Q67W65|TAF1_ORYSJ Transcription initiation factor TFIID subunit 1 OS=Oryza sativa subsp. japonica GN=TAF1 PE=2 SV=1 320 403 8.0E-08
sp|F7DRV9|BRDT_XENTR Bromodomain testis-specific protein OS=Xenopus tropicalis GN=brdt PE=3 SV=1 323 398 8.0E-08
sp|F1R5H6|BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio GN=brd4 PE=1 SV=1 285 397 1.0E-07
sp|O95696|BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens GN=BRD1 PE=1 SV=1 267 397 1.0E-07
sp|Q8IZX4|TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens GN=TAF1L PE=1 SV=1 325 397 1.0E-07
sp|Q91Y44|BRDT_MOUSE Bromodomain testis-specific protein OS=Mus musculus GN=Brdt PE=1 SV=3 328 429 1.0E-07
sp|A2BIL7|BAZ1B_DANRE Tyrosine-protein kinase BAZ1B OS=Danio rerio GN=baz1b PE=1 SV=2 303 422 1.0E-07
sp|Q4R8Y1|BRDT_MACFA Bromodomain testis-specific protein OS=Macaca fascicularis GN=BRDT PE=2 SV=3 328 457 1.0E-07
sp|Q80UV9|TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus GN=Taf1 PE=1 SV=2 325 397 2.0E-07
sp|Q60544|TAF1_MESAU Transcription initiation factor TFIID subunit 1 OS=Mesocricetus auratus GN=TAF1 PE=2 SV=1 325 397 2.0E-07
sp|G5EGM3|TAF1_CAEEL Transcription initiation factor TFIID subunit 1 OS=Caenorhabditis elegans GN=taf-1 PE=2 SV=1 325 401 2.0E-07
sp|Q5A4W8|BDF1_CANAL Bromodomain-containing factor 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BDF1 PE=2 SV=1 328 423 2.0E-07
sp|Q9Z277|BAZ1B_MOUSE Tyrosine-protein kinase BAZ1B OS=Mus musculus GN=Baz1b PE=1 SV=2 323 464 2.0E-07
sp|Q9AR19|GCN5_ARATH Histone acetyltransferase GCN5 OS=Arabidopsis thaliana GN=HAG1 PE=1 SV=1 317 397 2.0E-07
sp|Q338B9|GCN5_ORYSJ Histone acetyltransferase GCN5 OS=Oryza sativa subsp. japonica GN=GCN5 PE=2 SV=1 305 397 2.0E-07
sp|Q58F21|BRDT_HUMAN Bromodomain testis-specific protein OS=Homo sapiens GN=BRDT PE=1 SV=4 328 398 2.0E-07
sp|Q93YS6|GTE9_ARATH Transcription factor GTE9 OS=Arabidopsis thaliana GN=GTE9 PE=1 SV=1 321 413 3.0E-07
sp|Q4R8Y1|BRDT_MACFA Bromodomain testis-specific protein OS=Macaca fascicularis GN=BRDT PE=2 SV=3 328 398 3.0E-07
sp|P13709|FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster GN=fs(1)h PE=1 SV=2 317 398 3.0E-07
sp|Q08D75|BRD4A_XENLA Bromodomain-containing protein 4A OS=Xenopus laevis GN=brd4-a PE=2 SV=1 312 397 4.0E-07
sp|Q8LRK9|TAF1_ARATH Transcription initiation factor TFIID subunit 1 OS=Arabidopsis thaliana GN=TAF1 PE=1 SV=1 321 401 5.0E-07
sp|Q8K2F0|BRD3_MOUSE Bromodomain-containing protein 3 OS=Mus musculus GN=Brd3 PE=1 SV=2 328 424 5.0E-07
sp|Q32S26|BRD2_BOVIN Bromodomain-containing protein 2 OS=Bos taurus GN=BRD2 PE=3 SV=1 328 397 6.0E-07
sp|P25440|BRD2_HUMAN Bromodomain-containing protein 2 OS=Homo sapiens GN=BRD2 PE=1 SV=2 328 397 6.0E-07
sp|Q7JJ13|BRD2_MOUSE Bromodomain-containing protein 2 OS=Mus musculus GN=Brd2 PE=1 SV=1 328 397 6.0E-07
sp|Q93ZB7|GTE11_ARATH Transcription factor GTE11 OS=Arabidopsis thaliana GN=GTE11 PE=1 SV=1 323 413 6.0E-07
sp|Q6MGA9|BRD2_RAT Bromodomain-containing protein 2 OS=Rattus norvegicus GN=Brd2 PE=1 SV=1 328 397 6.0E-07
sp|Q5TJG6|BRD2_CANLF Bromodomain-containing protein 2 OS=Canis lupus familiaris GN=BRD2 PE=3 SV=1 328 397 6.0E-07
sp|Q9H8M2|BRD9_HUMAN Bromodomain-containing protein 9 OS=Homo sapiens GN=BRD9 PE=1 SV=2 303 398 7.0E-07
sp|Q3UQU0|BRD9_MOUSE Bromodomain-containing protein 9 OS=Mus musculus GN=Brd9 PE=1 SV=1 303 398 7.0E-07
sp|P51123|TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster GN=Taf1 PE=1 SV=3 321 397 7.0E-07
sp|Q9Y7N0|BDF1_SCHPO SWR1 complex bromodomain subunit bdf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bdf1 PE=1 SV=1 328 435 1.0E-06
sp|Q56R14|TRI33_XENLA E3 ubiquitin-protein ligase TRIM33 OS=Xenopus laevis GN=trim33 PE=1 SV=1 325 400 1.0E-06
sp|O60885|BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens GN=BRD4 PE=1 SV=2 285 397 1.0E-06
sp|Q64127|TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus GN=Trim24 PE=1 SV=1 325 398 1.0E-06
sp|Q5A4W8|BDF1_CANAL Bromodomain-containing factor 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BDF1 PE=2 SV=1 333 397 2.0E-06
sp|Q15059|BRD3_HUMAN Bromodomain-containing protein 3 OS=Homo sapiens GN=BRD3 PE=1 SV=1 325 424 2.0E-06
sp|Q92793|CBP_HUMAN CREB-binding protein OS=Homo sapiens GN=CREBBP PE=1 SV=3 319 398 2.0E-06
sp|Q9ESU6|BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus GN=Brd4 PE=1 SV=2 320 397 2.0E-06
sp|Q6BER5|NU301_CAEEL Nucleosome-remodeling factor subunit NURF301-like OS=Caenorhabditis elegans GN=nurf-1 PE=1 SV=2 339 397 3.0E-06
sp|O15164|TIF1A_HUMAN Transcription intermediary factor 1-alpha OS=Homo sapiens GN=TRIM24 PE=1 SV=3 325 398 3.0E-06
sp|Q8R3B7|BRD8_MOUSE Bromodomain-containing protein 8 OS=Mus musculus GN=Brd8 PE=1 SV=2 313 475 3.0E-06
sp|Q6NVM8|BRD9_XENTR Bromodomain-containing protein 9 OS=Xenopus tropicalis GN=brd9 PE=2 SV=1 303 398 3.0E-06
sp|F7DRV9|BRDT_XENTR Bromodomain testis-specific protein OS=Xenopus tropicalis GN=brdt PE=3 SV=1 328 434 6.0E-06
sp|Q09472|EP300_HUMAN Histone acetyltransferase p300 OS=Homo sapiens GN=EP300 PE=1 SV=2 319 398 6.0E-06
sp|F1QW93|BRDT_DANRE Bromodomain testis-specific protein OS=Danio rerio GN=brdt PE=3 SV=2 328 424 8.0E-06
sp|Q9UIG0|BAZ1B_HUMAN Tyrosine-protein kinase BAZ1B OS=Homo sapiens GN=BAZ1B PE=1 SV=2 338 464 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1344 0.891 0.0264 0.0331 0.0291 0.0026 0.0429 0.0632 0.0366 0.0078

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Bromodomain transcription factor

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4081
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6849
Ophiocordyceps australis map64 (Brazil) OphauB2|4535
Ophiocordyceps camponoti-floridani Ophcf2|03145
Ophiocordyceps camponoti-rufipedis Ophun1|161
Ophiocordyceps kimflemingae Ophio5|6638
Ophiocordyceps subramaniannii Hirsu2|8231 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8231
MSYPNGQAAWPPPALHHLGSSRSLNHLDDGLARTQTPVDNAIGLMPEAPVDIDEERRRALFADLYRNTEDKVALL
FADDGSYNFEAISALSRQPPPSALLPPPTTDHDPVKEPPLKKVKRAIDEDYDDDEDDDEEGGEPMPPVHKPPHAA
GSLLSPSKSGSSPVQSVNSPGKLADKSRGLDSGSQAKPKADEGGIKKLEQARIATEEAARKSFHTIFYTLENDGT
AMLEQQRLEDSEKQLQAEMDHTGTSHPGGTQNPNQGSLSSANLGASSLTLKHLIARIDMKRDQVRASDAELRLLM
NEVRKNRSKWASEENVNQEELYEALEKVLTELKAHTEYSTPFLTRVNKRDAPDYYNFIKNPMDLGSMTKKLKSLT
YKSKTDFVTDLNLIWDNCLKYNQDMNHPLRRMANGMRKEAEKLIPLIPDLVIRSRAEVEAEERRKQNGGDDDNGD
DSDDEPIMSSRGRKATTKGTNKSRKAPSDQKEDTPVVDQKPILQVNGLLGKPGREGSEVVDGSNGFATPPIGGSI
TPGGIVNGHSGMASNADVMDIDGPSLNGMTLNQAFGAAVEQDFEDEEYKIWKQTTKKDRALVAKERHALFKDNNL
NVDAPALLRNKAGMRRFLKHQREAEALGIASYPCLGNAPSTEKDAGNKASETLADGIDEEAEKVIPDYYDSLSNI
PDIQPSLQWVEDGDGQVINQHEKFLRLVPPGSFVAPRSRLTKRMDDNIRQIQETRKLATKISVIKQMQVQSQVYT
NQFPKSHNEPFLEHDIEPHFIADDGPVMAFEACQDAMKRSVAKILYHTGFEELQPSAVDTLTGIAADYFQTIFRT
FNIYREAEKMTVQTAEGPRLRPRFTPEEVMLHTLEENGHDVASLDSYVKDDMDRLGSKLGALHERMKLHLTDLLR
PALAADAGSDGVGAFNDGSEQFMSGDFAEDLGEDFFGFRALGLDKEMGLDSFSVPFHLLHSRVRSQYQMQTQVTG
GTSSDMFDALPPADSVTKENIQDQIGLVKNFFLAKLHANSDQPLIEDEDLPVKQRKPRPRLGASGKIMSAQKRPP
KEQLAMAKKKKKMELAAAAAEAKANASGEKGGGPVNNTTPGKKKAGSLPNGTAPLNPAVHALGASMERTDSTQSQ
AATSQTDKDDNTGMMSPESIAQ*
Coding >Hirsu2|8231
ATGTCGTATCCGAACGGCCAAGCCGCCTGGCCGCCTCCTGCCTTGCACCACCTGGGCAGCAGTCGGTCCCTGAAC
CATCTTGACGATGGTCTCGCGCGCACCCAGACCCCCGTCGATAACGCCATCGGGTTGATGCCTGAGGCACCCGTC
GACATCGACGAGGAGCGTCGCCGCGCCCTCTTCGCCGACCTCTACCGCAACACGGAGGACAAGGTCGCGCTTCTG
TTCGCCGACGATGGCTCCTACAATTTCGAAGCCATCTCCGCCCTTAGCCGACAACCCCCCCCCTCGGCCCTCCTG
CCGCCCCCCACCACCGACCACGACCCCGTCAAGGAGCCGCCTCTGAAGAAGGTCAAGCGCGCAATTGACGAAGAC
TACGACGATGACGAAGACGACGACGAAGAAGGGGGCGAACCCATGCCGCCCGTACATAAGCCGCCCCATGCTGCC
GGCTCCCTGCTGTCCCCGTCCAAGTCCGGCAGCTCTCCCGTCCAGTCCGTCAACTCGCCCGGCAAGCTGGCCGAC
AAGTCCCGAGGCCTCGACTCCGGCTCGCAGGCCAAGCCCAAGGCCGACGAAGGCGGCATCAAGAAACTCGAGCAA
GCGCGCATTGCCACCGAGGAAGCCGCGCGCAAGAGCTTCCACACCATCTTCTACACGCTCGAGAATGATGGCACG
GCCATGCTGGAACAACAGCGGCTCGAGGACTCGGAAAAGCAGCTTCAGGCCGAGATGGATCATACTGGGACTTCA
CACCCCGGCGGCACGCAGAACCCCAACCAAGGGTCGCTGAGCAGCGCAAATTTGGGTGCCTCCAGCCTGACTCTC
AAACATCTCATCGCCAGAATCGACATGAAGAGAGATCAGGTGCGAGCATCGGACGCGGAGCTGCGGCTCCTCATG
AACGAAGTGCGCAAGAATCGGAGTAAATGGGCCAGCGAAGAAAACGTCAACCAGGAGGAGCTCTACGAGGCTTTG
GAGAAAGTCTTGACTGAGCTGAAGGCGCACACCGAATACTCGACGCCTTTCCTCACACGAGTCAACAAGAGAGAC
GCCCCGGACTACTATAACTTCATCAAGAACCCCATGGACCTGGGATCTATGACAAAGAAGCTCAAGTCTTTGACG
TACAAGTCCAAGACTGACTTCGTCACTGACCTGAACTTGATATGGGATAACTGCCTCAAGTATAATCAGGACATG
AATCATCCGCTGCGTCGCATGGCAAACGGAATGCGGAAAGAAGCGGAAAAACTCATCCCTCTGATACCCGATCTC
GTCATTCGCTCTCGAGCCGAGGTCGAGGCTGAGGAGCGGCGCAAGCAGAACGGTGGCGACGACGACAATGGAGAC
GATTCTGATGACGAGCCGATAATGTCCTCCCGTGGGCGGAAGGCGACGACCAAGGGCACCAATAAATCCCGGAAA
GCACCCAGCGACCAGAAGGAGGACACCCCGGTCGTGGACCAGAAGCCGATTCTCCAGGTCAACGGCCTTCTAGGA
AAGCCTGGCAGAGAGGGTTCCGAGGTGGTGGACGGGAGCAACGGGTTCGCAACTCCACCAATCGGCGGATCGATC
ACGCCTGGCGGGATAGTCAATGGCCACTCAGGCATGGCGAGTAATGCCGATGTTATGGACATTGATGGCCCCAGC
TTGAACGGCATGACTCTGAATCAGGCATTCGGGGCCGCCGTCGAGCAAGATTTCGAAGACGAGGAGTACAAGATA
TGGAAGCAGACAACGAAGAAGGACCGCGCCCTGGTGGCCAAAGAGCGGCACGCCCTCTTCAAGGACAACAATCTC
AACGTGGATGCCCCGGCACTACTCAGGAACAAGGCCGGCATGCGGCGATTTCTCAAGCATCAAAGGGAAGCCGAA
GCGCTCGGCATTGCAAGCTACCCGTGCCTGGGCAACGCGCCCAGCACGGAGAAGGACGCCGGCAACAAGGCATCG
GAGACGCTAGCGGACGGGATCGACGAGGAGGCCGAGAAGGTCATCCCGGACTACTACGACTCGCTCAGCAACATC
CCCGACATCCAGCCAAGCTTGCAGTGGGTGGAGGACGGCGACGGGCAGGTCATCAACCAGCACGAGAAGTTCCTT
CGTCTCGTGCCGCCCGGATCCTTTGTGGCACCGCGGAGCCGACTGACGAAAAGGATGGACGACAACATTCGCCAG
ATCCAAGAGACGAGGAAGCTCGCGACCAAGATTTCGGTCATCAAGCAGATGCAGGTCCAGTCGCAAGTCTACACC
AATCAGTTCCCCAAGTCCCACAACGAGCCGTTCCTCGAGCACGACATCGAGCCGCACTTCATCGCCGACGACGGG
CCGGTCATGGCGTTCGAGGCGTGTCAGGACGCGATGAAACGCTCCGTCGCCAAGATCCTCTACCACACGGGGTTC
GAGGAACTTCAGCCATCGGCCGTCGACACGCTGACTGGGATCGCGGCCGACTATTTCCAGACAATCTTCAGGACT
TTCAACATCTACCGCGAAGCCGAGAAGATGACGGTGCAGACGGCTGAAGGGCCTCGACTCCGACCTCGCTTTACC
CCCGAGGAGGTCATGCTGCACACACTGGAGGAGAACGGCCACGACGTCGCTTCCCTGGACTCCTACGTCAAGGAT
GATATGGACCGTCTCGGCTCCAAGCTAGGAGCCCTGCACGAGAGGATGAAGCTGCACCTCACCGACCTCCTGCGG
CCGGCGCTGGCAGCAGACGCCGGCTCGGACGGCGTCGGAGCCTTCAACGACGGCAGCGAGCAGTTCATGAGCGGC
GACTTTGCCGAGGACCTGGGCGAGGACTTCTTCGGCTTCCGAGCCTTGGGTCTCGACAAGGAGATGGGGCTCGAC
TCCTTCTCCGTGCCCTTCCATCTGCTGCATAGCAGAGTCAGGAGCCAGTATCAGATGCAGACGCAGGTGACGGGA
GGGACGTCATCTGACATGTTCGATGCCCTGCCACCGGCCGACTCCGTCACCAAGGAAAACATCCAGGACCAGATC
GGGCTGGTCAAGAACTTCTTCCTCGCCAAGCTGCACGCTAACAGCGACCAGCCGCTCATCGAAGACGAGGACCTT
CCGGTGAAGCAGAGGAAACCGCGTCCGCGGCTCGGCGCCAGCGGCAAAATCATGTCTGCCCAGAAGCGCCCGCCC
AAGGAGCAGCTGGCGATGGCGAAGAAGAAGAAGAAAATGGAGCTTGCGGCGGCGGCGGCCGAGGCCAAGGCCAAC
GCGTCCGGCGAAAAGGGCGGGGGACCGGTCAACAACACGACACCTGGCAAGAAGAAGGCCGGCAGCCTCCCCAAC
GGCACGGCCCCGCTGAATCCCGCCGTCCACGCACTGGGGGCCAGCATGGAGCGTACGGACAGCACGCAGAGCCAG
GCTGCCACCAGCCAGACGGACAAGGACGACAACACCGGCATGATGAGTCCGGAGAGCATTGCTCAGTAG
Transcript >Hirsu2|8231
ATGTCGTATCCGAACGGCCAAGCCGCCTGGCCGCCTCCTGCCTTGCACCACCTGGGCAGCAGTCGGTCCCTGAAC
CATCTTGACGATGGTCTCGCGCGCACCCAGACCCCCGTCGATAACGCCATCGGGTTGATGCCTGAGGCACCCGTC
GACATCGACGAGGAGCGTCGCCGCGCCCTCTTCGCCGACCTCTACCGCAACACGGAGGACAAGGTCGCGCTTCTG
TTCGCCGACGATGGCTCCTACAATTTCGAAGCCATCTCCGCCCTTAGCCGACAACCCCCCCCCTCGGCCCTCCTG
CCGCCCCCCACCACCGACCACGACCCCGTCAAGGAGCCGCCTCTGAAGAAGGTCAAGCGCGCAATTGACGAAGAC
TACGACGATGACGAAGACGACGACGAAGAAGGGGGCGAACCCATGCCGCCCGTACATAAGCCGCCCCATGCTGCC
GGCTCCCTGCTGTCCCCGTCCAAGTCCGGCAGCTCTCCCGTCCAGTCCGTCAACTCGCCCGGCAAGCTGGCCGAC
AAGTCCCGAGGCCTCGACTCCGGCTCGCAGGCCAAGCCCAAGGCCGACGAAGGCGGCATCAAGAAACTCGAGCAA
GCGCGCATTGCCACCGAGGAAGCCGCGCGCAAGAGCTTCCACACCATCTTCTACACGCTCGAGAATGATGGCACG
GCCATGCTGGAACAACAGCGGCTCGAGGACTCGGAAAAGCAGCTTCAGGCCGAGATGGATCATACTGGGACTTCA
CACCCCGGCGGCACGCAGAACCCCAACCAAGGGTCGCTGAGCAGCGCAAATTTGGGTGCCTCCAGCCTGACTCTC
AAACATCTCATCGCCAGAATCGACATGAAGAGAGATCAGGTGCGAGCATCGGACGCGGAGCTGCGGCTCCTCATG
AACGAAGTGCGCAAGAATCGGAGTAAATGGGCCAGCGAAGAAAACGTCAACCAGGAGGAGCTCTACGAGGCTTTG
GAGAAAGTCTTGACTGAGCTGAAGGCGCACACCGAATACTCGACGCCTTTCCTCACACGAGTCAACAAGAGAGAC
GCCCCGGACTACTATAACTTCATCAAGAACCCCATGGACCTGGGATCTATGACAAAGAAGCTCAAGTCTTTGACG
TACAAGTCCAAGACTGACTTCGTCACTGACCTGAACTTGATATGGGATAACTGCCTCAAGTATAATCAGGACATG
AATCATCCGCTGCGTCGCATGGCAAACGGAATGCGGAAAGAAGCGGAAAAACTCATCCCTCTGATACCCGATCTC
GTCATTCGCTCTCGAGCCGAGGTCGAGGCTGAGGAGCGGCGCAAGCAGAACGGTGGCGACGACGACAATGGAGAC
GATTCTGATGACGAGCCGATAATGTCCTCCCGTGGGCGGAAGGCGACGACCAAGGGCACCAATAAATCCCGGAAA
GCACCCAGCGACCAGAAGGAGGACACCCCGGTCGTGGACCAGAAGCCGATTCTCCAGGTCAACGGCCTTCTAGGA
AAGCCTGGCAGAGAGGGTTCCGAGGTGGTGGACGGGAGCAACGGGTTCGCAACTCCACCAATCGGCGGATCGATC
ACGCCTGGCGGGATAGTCAATGGCCACTCAGGCATGGCGAGTAATGCCGATGTTATGGACATTGATGGCCCCAGC
TTGAACGGCATGACTCTGAATCAGGCATTCGGGGCCGCCGTCGAGCAAGATTTCGAAGACGAGGAGTACAAGATA
TGGAAGCAGACAACGAAGAAGGACCGCGCCCTGGTGGCCAAAGAGCGGCACGCCCTCTTCAAGGACAACAATCTC
AACGTGGATGCCCCGGCACTACTCAGGAACAAGGCCGGCATGCGGCGATTTCTCAAGCATCAAAGGGAAGCCGAA
GCGCTCGGCATTGCAAGCTACCCGTGCCTGGGCAACGCGCCCAGCACGGAGAAGGACGCCGGCAACAAGGCATCG
GAGACGCTAGCGGACGGGATCGACGAGGAGGCCGAGAAGGTCATCCCGGACTACTACGACTCGCTCAGCAACATC
CCCGACATCCAGCCAAGCTTGCAGTGGGTGGAGGACGGCGACGGGCAGGTCATCAACCAGCACGAGAAGTTCCTT
CGTCTCGTGCCGCCCGGATCCTTTGTGGCACCGCGGAGCCGACTGACGAAAAGGATGGACGACAACATTCGCCAG
ATCCAAGAGACGAGGAAGCTCGCGACCAAGATTTCGGTCATCAAGCAGATGCAGGTCCAGTCGCAAGTCTACACC
AATCAGTTCCCCAAGTCCCACAACGAGCCGTTCCTCGAGCACGACATCGAGCCGCACTTCATCGCCGACGACGGG
CCGGTCATGGCGTTCGAGGCGTGTCAGGACGCGATGAAACGCTCCGTCGCCAAGATCCTCTACCACACGGGGTTC
GAGGAACTTCAGCCATCGGCCGTCGACACGCTGACTGGGATCGCGGCCGACTATTTCCAGACAATCTTCAGGACT
TTCAACATCTACCGCGAAGCCGAGAAGATGACGGTGCAGACGGCTGAAGGGCCTCGACTCCGACCTCGCTTTACC
CCCGAGGAGGTCATGCTGCACACACTGGAGGAGAACGGCCACGACGTCGCTTCCCTGGACTCCTACGTCAAGGAT
GATATGGACCGTCTCGGCTCCAAGCTAGGAGCCCTGCACGAGAGGATGAAGCTGCACCTCACCGACCTCCTGCGG
CCGGCGCTGGCAGCAGACGCCGGCTCGGACGGCGTCGGAGCCTTCAACGACGGCAGCGAGCAGTTCATGAGCGGC
GACTTTGCCGAGGACCTGGGCGAGGACTTCTTCGGCTTCCGAGCCTTGGGTCTCGACAAGGAGATGGGGCTCGAC
TCCTTCTCCGTGCCCTTCCATCTGCTGCATAGCAGAGTCAGGAGCCAGTATCAGATGCAGACGCAGGTGACGGGA
GGGACGTCATCTGACATGTTCGATGCCCTGCCACCGGCCGACTCCGTCACCAAGGAAAACATCCAGGACCAGATC
GGGCTGGTCAAGAACTTCTTCCTCGCCAAGCTGCACGCTAACAGCGACCAGCCGCTCATCGAAGACGAGGACCTT
CCGGTGAAGCAGAGGAAACCGCGTCCGCGGCTCGGCGCCAGCGGCAAAATCATGTCTGCCCAGAAGCGCCCGCCC
AAGGAGCAGCTGGCGATGGCGAAGAAGAAGAAGAAAATGGAGCTTGCGGCGGCGGCGGCCGAGGCCAAGGCCAAC
GCGTCCGGCGAAAAGGGCGGGGGACCGGTCAACAACACGACACCTGGCAAGAAGAAGGCCGGCAGCCTCCCCAAC
GGCACGGCCCCGCTGAATCCCGCCGTCCACGCACTGGGGGCCAGCATGGAGCGTACGGACAGCACGCAGAGCCAG
GCTGCCACCAGCCAGACGGACAAGGACGACAACACCGGCATGATGAGTCCGGAGAGCATTGCTCAGTAG
Gene >Hirsu2|8231
ATGTCGTATCCGAACGGCCAAGCCGCCTGGCCGCCTCCTGCCTTGCACCACCTGGGCAGCAGTCGGTCCCTGAAC
CATCTTGACGATGGTCTCGCGCGCACCCAGACCCCCGTCGATAACGCCATCGGGTTGATGCCTGAGGCACCCGTC
GACATCGACGAGGAGCGTCGCCGCGCCCTCTTCGCCGACCTCTACCGCAACACGGAGGACAAGGTCGCGCTTCTG
TTCGCCGACGATGGCTCCTACAATTTCGAAGCCATCTCCGCCCTTAGCCGACAACCCCCCCCCTCGGCCCTCCTG
CCGCCCCCCACCACCGACCACGACCCCGTCAAGGAGCCGCCTCTGAAGAAGGTCAAGCGCGCAATTGACGAAGAC
TACGACGATGACGAAGACGACGACGAAGAAGGGGGCGAACCCATGCCGCCCGTACATAAGCCGCCCCATGCTGCC
GGCTCCCTGCTGTCCCCGTCCAAGTCCGGCAGCTCTCCCGTCCAGTCCGTCAACTCGCCCGGCAAGCTGGCCGAC
AAGTCCCGAGGCCTCGACTCCGGCTCGCAGGCCAAGCCCAAGGCCGACGAAGGCGGCATCAAGAAACTCGAGCAA
GCGCGCATTGCCACCGAGGAAGCCGCGCGCAAGAGCTTCCACACCATCTTCTACACGCTCGAGAATGATGGCACG
GCCATGCTGGAACAACAGCGGCTCGAGGACTCGGAAAAGCAGCTTCAGGCCGAGATGGATCATACTGGGACTTCA
CACCCCGGCGGCACGCAGAACCCCAACCAAGGGTCGCTGAGCAGCGCAAATTTGGGTGCCTCCAGCCTGACTCTC
AAACATCTCATCGCCAGAATCGACATGAAGAGAGATCAGGTGCGAGCATCGGACGCGGAGCTGCGGCTCCTCATG
AACGAAGTGCGCAAGAATCGGAGTAAATGGGCCAGCGAAGAAAACGTCAACCAGGAGGAGCTCTACGAGGCTTTG
GAGAAAGTCTTGACTGAGCTGAAGGCGCACACCGAATACTCGACGCCTTTCCTCACACGAGTCAACAAGAGAGAC
GCCCCGGACTACTATAACTGTAAGTTCTAGCCCGCAGCCAAAGGATACAACGTATTCTCTTTCAAATATTTTTCG
CTAACCGCACCTGACCTGCAGTCATCAAGAACCCCATGGACCTGGGATCTATGACAAAGAAGCTCAAGTCTTTGA
CGTACAAGTCCAAGACTGACTTCGTCACTGACCTGAACTTGATATGGGATAACTGCCTCAAGTATAATCAGGACA
TGAATCATCCGCTGCGTCGCATGGCAAACGGAATGCGGAAAGAAGCGGAAAAACTCATCCCTCTGATACCCGATC
TCGTCATTCGCTCTCGAGCCGAGGTCGAGGCTGAGGAGCGGCGCAAGCAGAACGGTGGCGACGACGACAATGGAG
ACGATTCTGATGACGAGCCGATAATGTCCTCCCGTGGGCGGAAGGCGACGACCAAGGGCACCAATAAATCCCGGA
AAGCACCCAGCGACCAGAAGGAGGACACCCCGGTCGTGGACCAGAAGCCGATTCTCCAGGTCAACGGCCTTCTAG
GAAAGCCTGGCAGAGAGGGTTCCGAGGTGGTGGACGGGAGCAACGGGTTCGCAACTCCACCAATCGGCGGATCGA
TCACGCCTGGCGGGATAGTCAATGGCCACTCAGGCATGGCGAGTAATGCCGATGTTATGGACATTGATGGCCCCA
GCTTGAACGGCATGACTCTGAATCAGGCATTCGGGGCCGCCGTCGAGCAAGATTTCGAAGACGAGGAGTACAAGA
TATGGAAGCAGACAACGAAGAAGGACCGCGCCCTGGTGGCCAAAGAGCGGCACGCCCTCTTCAAGGACAACAATC
TCAACGTGGATGCCCCGGCACTACTCAGGAACAAGGCCGGCATGCGGCGATTTCTCAAGCATCAAAGGGAAGCCG
AAGCGCTCGGCATTGCAAGCTACCCGTGCCTGGGCAACGCGCCCAGCACGGAGAAGGACGCCGGCAACAAGGCAT
CGGAGACGCTAGCGGACGGGATCGACGAGGAGGCCGAGAAGGTCATCCCGGACTACTACGACTCGCTCAGCAACA
TCCCCGACATCCAGCCAAGCTTGCAGTGGGTGGAGGACGGCGACGGGCAGGTCATCAACCAGCACGAGAAGTTCC
TTCGTCTCGTGCCGCCCGGATCCTTTGTGGCACCGCGGAGCCGACTGACGAAAAGGATGGACGACAACATTCGCC
AGATCCAAGAGACGAGGAAGCTCGCGACCAAGATTTCGGTCATCAAGCAGATGCAGGTCCAGTCGCAAGTCTACA
CCAATCAGTTCCCCAAGTCCCACAACGAGCCGTTCCTCGAGCACGACATCGAGCCGCACTTCATCGCCGACGACG
GGCCGGTCATGGCGTTCGAGGCGTGTCAGGACGCGATGAAACGCTCCGTCGCCAAGATCCTCTACCACACGGGGT
TCGAGGAACTTCAGCCATCGGCCGTCGACACGCTGACTGGGATCGCGGCCGACTATTTCCAGACAATCTTCAGGA
CTTTCAACATCTACCGCGAAGCCGAGAAGATGACGGTGCAGACGGCTGAAGGGCCTCGACTCCGACCTCGCTTTA
CCCCCGAGGAGGTCATGCTGCACACACTGGAGGAGAACGGCCACGACGTCGCTTCCCTGGACTCCTACGTCAAGG
ATGATATGGACCGTCTCGGCTCCAAGCTAGGAGCCCTGCACGAGAGGATGAAGCTGCACCTCACCGACCTCCTGC
GGCCGGCGCTGGCAGCAGACGCCGGCTCGGACGGCGTCGGAGCCTTCAACGACGGCAGCGAGCAGTTCATGAGCG
GCGACTTTGCCGAGGACCTGGGCGAGGACTTCTTCGGCTTCCGAGCCTTGGGTCTCGACAAGGAGATGGGGCTCG
ACTCCTTCTCCGTGCCCTTCCATCTGCTGCATAGCAGAGTCAGGAGCCAGTATCAGATGCAGACGCAGGTGACGG
GAGGGACGTCATCTGACATGTTCGATGCCCTGCCACCGGCCGACTCCGTCACCAAGGAAAACATCCAGGACCAGA
TCGGGCTGGTCAAGAACTTCTTCCTCGCCAAGCTGCACGCTAACAGCGACCAGCCGCTCATCGAAGACGAGGACC
TTCCGGTGAAGCAGAGGAAACCGCGTCCGCGGCTCGGCGCCAGCGGCAAAATCATGTCTGCCCAGAAGCGCCCGC
CCAAGGAGCAGCTGGCGATGGCGAAGAAGAAGAAGAAAATGGAGCTTGCGGCGGCGGCGGCCGAGGCCAAGGCCA
ACGCGTCCGGCGAAAAGGGCGGGGGACCGGTCAACAACACGACACCTGGCAAGAAGAAGGCCGGCAGCCTCCCCA
ACGGCACGGCCCCGCTGAATCCCGCCGTCCACGCACTGGGGGCCAGCATGGAGCGTACGGACAGCACGCAGAGCC
AGGCTGCCACCAGCCAGACGGACAAGGACGACAACACCGGCATGATGAGTCCGGAGAGCATTGCTCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail