Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8227
Gene name
LocationContig_522:439..4068
Strand-
Gene length (bp)3629
Transcript length (bp)3342
Coding sequence length (bp)3342
Protein length (aa) 1114

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02463 SMC_N RecF/RecN/SMC N terminal domain 1.5E-26 70 1065
PF13476 AAA_23 AAA domain 8.2E-14 72 289

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13710|SMC5_SCHPO Structural maintenance of chromosomes protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc5 PE=1 SV=3 64 1090 1.0E-161
sp|Q8CG46|SMC5_MOUSE Structural maintenance of chromosomes protein 5 OS=Mus musculus GN=Smc5 PE=1 SV=1 19 1089 3.0E-133
sp|Q8IY18|SMC5_HUMAN Structural maintenance of chromosomes protein 5 OS=Homo sapiens GN=SMC5 PE=1 SV=2 24 1089 5.0E-133
sp|Q5ZJY5|SMC5_CHICK Structural maintenance of chromosomes protein 5 OS=Gallus gallus GN=SMC5 PE=2 SV=1 44 1089 7.0E-123
sp|Q08204|SMC5_YEAST Structural maintenance of chromosomes protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC5 PE=1 SV=1 61 1090 2.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13710|SMC5_SCHPO Structural maintenance of chromosomes protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc5 PE=1 SV=3 64 1090 1.0E-161
sp|Q8CG46|SMC5_MOUSE Structural maintenance of chromosomes protein 5 OS=Mus musculus GN=Smc5 PE=1 SV=1 19 1089 3.0E-133
sp|Q8IY18|SMC5_HUMAN Structural maintenance of chromosomes protein 5 OS=Homo sapiens GN=SMC5 PE=1 SV=2 24 1089 5.0E-133
sp|Q5ZJY5|SMC5_CHICK Structural maintenance of chromosomes protein 5 OS=Gallus gallus GN=SMC5 PE=2 SV=1 44 1089 7.0E-123
sp|Q08204|SMC5_YEAST Structural maintenance of chromosomes protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC5 PE=1 SV=1 61 1090 2.0E-122
sp|Q802R9|SMC5_TAKRU Structural maintenance of chromosomes protein 5 OS=Takifugu rubripes GN=smc5 PE=2 SV=1 32 1089 1.0E-120
sp|Q805A1|SMC5_XENLA Structural maintenance of chromosomes protein 5 OS=Xenopus laevis GN=smc5 PE=2 SV=1 68 1089 1.0E-113
sp|Q9LFS8|SMC5_ARATH Structural maintenance of chromosomes protein 5 OS=Arabidopsis thaliana GN=SMC5 PE=2 SV=1 63 1089 1.0E-106
sp|Q9FII7|SMC6B_ARATH Structural maintenance of chromosomes protein 6B OS=Arabidopsis thaliana GN=SMC6B PE=2 SV=1 68 290 8.0E-15
sp|Q6P9I7|SMC6_XENLA Structural maintenance of chromosomes protein 6 OS=Xenopus laevis GN=smc6 PE=2 SV=1 1 207 6.0E-14
sp|Q12749|SMC6_YEAST Structural maintenance of chromosomes protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC6 PE=1 SV=1 40 351 1.0E-12
sp|Q9FLR5|SMC6A_ARATH Structural maintenance of chromosomes protein 6A OS=Arabidopsis thaliana GN=SMC6A PE=2 SV=1 68 207 1.0E-11
sp|Q96SB8|SMC6_HUMAN Structural maintenance of chromosomes protein 6 OS=Homo sapiens GN=SMC6 PE=1 SV=2 21 324 5.0E-11
sp|Q924W5|SMC6_MOUSE Structural maintenance of chromosomes protein 6 OS=Mus musculus GN=Smc6 PE=1 SV=1 21 207 6.0E-11
sp|Q9SN90|SMC22_ARATH Structural maintenance of chromosomes protein 2-2 OS=Arabidopsis thaliana GN=SMC2-2 PE=2 SV=1 70 234 1.0E-10
sp|P53692|SMC6_SCHPO Structural maintenance of chromosomes protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc6 PE=1 SV=1 64 207 2.0E-10
sp|Q6P9I7|SMC6_XENLA Structural maintenance of chromosomes protein 6 OS=Xenopus laevis GN=smc6 PE=2 SV=1 777 1081 3.0E-09
sp|Q96SB8|SMC6_HUMAN Structural maintenance of chromosomes protein 6 OS=Homo sapiens GN=SMC6 PE=1 SV=2 1004 1087 8.0E-09
sp|Q924W5|SMC6_MOUSE Structural maintenance of chromosomes protein 6 OS=Mus musculus GN=Smc6 PE=1 SV=1 1004 1081 8.0E-09
sp|Q9C5Y4|SMC21_ARATH Structural maintenance of chromosomes protein 2-1 OS=Arabidopsis thaliana GN=SMC2-1 PE=2 SV=2 70 274 2.0E-08
sp|P38989|SMC2_YEAST Structural maintenance of chromosomes protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC2 PE=1 SV=1 90 335 4.0E-08
sp|Q802R8|SMC6_TAKRU Structural maintenance of chromosomes protein 6 OS=Takifugu rubripes GN=smc6 PE=2 SV=1 68 447 4.0E-08
sp|Q9FLR5|SMC6A_ARATH Structural maintenance of chromosomes protein 6A OS=Arabidopsis thaliana GN=SMC6A PE=2 SV=1 875 1079 5.0E-08
sp|O58687|RAD50_PYRHO DNA double-strand break repair Rad50 ATPase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rad50 PE=3 SV=1 70 142 7.0E-08
sp|Q54PK4|SMC2_DICDI Structural maintenance of chromosomes protein 2 OS=Dictyostelium discoideum GN=smc2 PE=3 SV=1 73 256 1.0E-07
sp|Q8IED2|SMC2_PLAF7 Structural maintenance of chromosomes protein 2 OS=Plasmodium falciparum (isolate 3D7) GN=MAL13P1.96 PE=3 SV=1 90 404 5.0E-07
sp|P41003|SMC2_SCHPO Structural maintenance of chromosomes protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut14 PE=1 SV=2 92 216 2.0E-06
sp|Q09591|MIX1_CAEEL Mitotic chromosome and X-chromosome-associated protein mix-1 OS=Caenorhabditis elegans GN=mix-1 PE=1 SV=2 70 233 2.0E-06
sp|D4GUK1|RAD50_HALVD DNA double-strand break repair Rad50 ATPase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=rad50 PE=1 SV=1 70 212 3.0E-06
sp|Q9FII7|SMC6B_ARATH Structural maintenance of chromosomes protein 6B OS=Arabidopsis thaliana GN=SMC6B PE=2 SV=1 875 1066 4.0E-06
sp|Q90988|SMC2_CHICK Structural maintenance of chromosomes protein 2 OS=Gallus gallus GN=SMC2 PE=2 SV=1 90 356 5.0E-06
sp|Q69GZ5|SMC_METVO Chromosome partition protein Smc OS=Methanococcus voltae GN=smc PE=3 SV=1 938 1065 5.0E-06
sp|Q81ZL2|SMC_COXBU Chromosome partition protein Smc OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=smc PE=3 SV=1 800 1041 9.0E-06
sp|Q74M31|RECF_LACJO DNA replication and repair protein RecF OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=recF PE=3 SV=1 70 333 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8227
MARSSSRRRRRSELDDADSNENAPPSPGSDTPSKRRRLDFDSDEGGSGRAEKTNGAVQPAEMDDFHPGAIVRVKV
ENFVTYEKAEFFPGPHLNMVIGPNGTGKSSLVCAICLGLGYSPKHLGRAGSVKEFVKHGKDTATIEIELQKRPQD
RSNHVVRVQIRREQNSQKWWLNGKETTQKAVQALMQSLKIQVDNLCQFLPQDRVVEFAACTPVDLLHETLRAAAP
EEMLQWQKQLQDLHRDKKELAQTVQTDAETLRTLETRQQGLQADVDRIREREEIQERVKNLQSALLLAKYQEART
KYSEARDRKKDAERVFRRLEEESGPSLEAIDQKKEYSRQIDSAMPAMEKGLKDAEQAAIQMSDDVAAAAELVKEM
DDKLEAEHKGFEAKKKELATSRSKITSFQADLKNRPSEFNAAEWNQKIRAEEHKLRDLEAEQRNVSMELATLRDK
GKAVVQQRRKIESDIEALDTQQGQQLNFMRKYFPEPAIGWDWVQEHQSEFEKEVFGPPIISCSIKDERYSDKVQS
LLQNDDFLCFTAQTSSDYKKLTDQLYRVMSLSVVIRTCSHSLESFRPPVDRAEISALGFDGYAVDFLDGPAPVLA
MLCAEKRIHQAGVSLRDHNDAEYERLMANGRINQWAAGKHSYMIRRRREYGPQAMTTVSKNIRPGRFWTSQPVDA
QEKVELNRQLLERRDEIAAMKEENTRLKDKFSNIEGEKSDSQRRIDDLKTEKNALQKEYQKWQSLPEKIESEERN
KATHEQALRDARKRMLDIYYEWDKAALKRVDLAIEHQKLVEKIGSAHQALLEAKIRQIEARSDIQGLKERSASLM
QRLEQKRREVQDATDDASRAKEEGRRLSDEVKDMLVRDGDKRELLTQLSDGKTPQELEMDMSAEEAKLELIHAAN
PNVIREFERRAQEMDRLKRKMEGFTAKLEDLDSRLGSLMGRWEPRLDELVSRINDAFAYNFEQISCAGEIRVHKD
DDFDLWALDIMVKFRENETLQQLTAHRQSGGERAVSTIFYLMALQSMAQSPFRVVDEINQGMDPRNERMVHERMV
EIACREHTSQYFLITPKLLTGLRYDAKMRVLCIASGEHMPRDGAKLDLASCLARQRRLMAAAR*
Coding >Hirsu2|8227
ATGGCGCGCTCGTCGTCTCGCCGTCGAAGGCGCTCCGAGTTGGACGATGCCGATAGCAACGAAAATGCGCCGCCC
TCGCCGGGCTCCGATACCCCCTCCAAGCGACGGCGCCTAGACTTTGATTCAGATGAAGGCGGCTCAGGCCGGGCG
GAGAAGACCAACGGGGCCGTCCAACCAGCCGAGATGGACGACTTCCACCCCGGCGCCATCGTGCGCGTCAAGGTC
GAGAACTTCGTCACCTACGAAAAGGCCGAATTTTTTCCCGGCCCGCATCTGAACATGGTCATCGGCCCCAACGGC
ACTGGCAAAAGCTCGCTCGTCTGCGCCATTTGCCTCGGTCTCGGCTACAGCCCCAAGCATCTCGGCCGGGCCGGG
TCGGTCAAGGAGTTCGTCAAGCACGGCAAGGACACGGCCACCATCGAGATCGAGCTTCAAAAGAGGCCACAAGAC
CGATCCAACCACGTGGTGCGGGTCCAGATCCGTCGCGAGCAGAACAGCCAGAAATGGTGGTTGAACGGCAAGGAA
ACCACCCAAAAGGCCGTCCAGGCCCTGATGCAGTCGCTCAAGATCCAGGTGGACAACCTCTGCCAGTTCCTGCCC
CAGGACAGGGTCGTCGAGTTCGCCGCCTGCACCCCCGTCGACCTCCTTCACGAGACGCTGCGGGCCGCCGCCCCG
GAGGAGATGCTGCAGTGGCAGAAGCAGCTGCAAGACCTGCACAGGGACAAGAAGGAGCTGGCCCAGACAGTCCAA
ACCGACGCCGAGACGTTGAGGACTCTCGAAACCCGCCAGCAGGGTCTCCAGGCGGACGTGGATAGGATCCGGGAA
CGCGAGGAGATCCAGGAACGAGTGAAAAATCTCCAATCGGCTTTGCTTCTCGCCAAGTACCAAGAAGCTCGAACC
AAATACTCCGAGGCCCGGGACCGCAAGAAGGACGCCGAAAGGGTCTTCCGACGGCTCGAGGAGGAATCCGGACCC
TCGCTGGAAGCCATCGATCAAAAGAAGGAGTATTCGCGCCAAATCGACTCCGCTATGCCGGCCATGGAGAAGGGG
TTGAAAGACGCGGAACAAGCCGCGATTCAAATGTCGGACGATGTCGCGGCGGCGGCGGAACTTGTCAAAGAAATG
GACGACAAGCTGGAGGCCGAACACAAGGGCTTCGAAGCAAAGAAGAAGGAGCTGGCGACGTCGAGGTCCAAGATT
ACCTCGTTCCAGGCCGACCTGAAGAACCGACCCTCGGAGTTTAATGCTGCCGAGTGGAACCAGAAGATTCGGGCA
GAAGAGCACAAACTACGGGATCTGGAGGCGGAGCAGCGCAATGTCTCCATGGAACTAGCTACGCTCCGTGACAAG
GGCAAAGCGGTCGTCCAACAGAGACGCAAGATCGAAAGCGACATCGAGGCCCTCGACACCCAGCAGGGCCAGCAG
CTCAACTTCATGAGAAAGTATTTCCCCGAGCCCGCCATTGGCTGGGATTGGGTGCAAGAACACCAGAGCGAATTC
GAGAAGGAAGTCTTTGGGCCGCCCATCATCAGCTGCTCCATTAAGGATGAGCGCTACTCGGACAAAGTCCAGTCA
CTTCTGCAGAACGACGACTTTCTCTGCTTTACCGCACAGACGAGCAGCGACTACAAGAAACTGACGGACCAGCTG
TACCGAGTGATGAGCCTGTCCGTCGTCATCAGAACATGTTCTCACTCCCTCGAGTCATTCCGACCGCCGGTCGAT
AGAGCGGAAATATCCGCGCTCGGCTTTGACGGCTACGCCGTGGATTTCTTGGATGGCCCTGCTCCGGTCCTTGCC
ATGCTCTGCGCCGAGAAACGAATCCACCAAGCTGGCGTCTCCCTCAGGGACCACAACGATGCCGAGTACGAGCGA
CTGATGGCCAACGGCAGAATCAATCAGTGGGCAGCCGGCAAGCACTCCTATATGATTCGCCGCCGCAGAGAATAC
GGCCCGCAGGCGATGACGACGGTCAGCAAAAACATCCGGCCGGGCAGGTTCTGGACGTCGCAGCCGGTCGATGCT
CAGGAGAAGGTCGAGCTGAACCGCCAATTGCTGGAGAGGAGAGACGAAATAGCGGCCATGAAGGAAGAGAACACG
AGGCTGAAGGACAAGTTCTCCAACATCGAGGGAGAGAAATCGGACAGTCAGCGGCGAATTGACGATCTAAAAACC
GAAAAGAACGCTCTGCAGAAGGAGTATCAAAAATGGCAGTCTCTTCCGGAGAAGATAGAATCCGAGGAACGCAAC
AAGGCGACGCACGAACAAGCGCTTCGAGACGCGAGAAAGCGCATGCTAGACATCTACTACGAGTGGGACAAGGCG
GCCCTGAAGCGCGTGGATCTCGCGATCGAGCACCAGAAGCTGGTGGAGAAGATAGGGAGCGCACACCAGGCGCTC
CTGGAGGCCAAGATCCGGCAGATTGAGGCGCGCTCCGACATCCAGGGGCTCAAGGAGCGCAGCGCCAGTCTGATG
CAACGGCTCGAGCAGAAGAGGCGGGAGGTGCAGGACGCAACGGACGACGCCAGCCGGGCCAAGGAGGAGGGCCGG
CGACTGTCGGACGAGGTCAAGGACATGCTCGTCCGGGACGGGGACAAGAGGGAGCTGCTCACACAACTGTCGGAC
GGGAAGACGCCGCAGGAGCTGGAGATGGACATGTCGGCCGAGGAGGCCAAGCTGGAGCTCATACACGCCGCCAAC
CCGAACGTGATCCGCGAGTTCGAGCGGCGCGCGCAGGAGATGGACCGGCTCAAGCGCAAGATGGAGGGCTTCACC
GCGAAGCTCGAGGACCTCGACAGCCGGCTCGGCTCGCTCATGGGCCGGTGGGAGCCGCGGCTGGACGAGCTGGTG
TCGCGCATCAACGACGCGTTCGCGTACAACTTTGAGCAGATCAGCTGCGCGGGCGAGATCCGCGTCCACAAGGAC
GACGACTTTGACCTGTGGGCGCTGGACATTATGGTGAAGTTCCGCGAGAACGAGACGCTGCAGCAGCTGACGGCG
CACCGGCAATCGGGCGGCGAGCGGGCCGTGTCGACCATCTTCTACCTGATGGCGCTGCAGTCGATGGCGCAGTCG
CCCTTCCGCGTCGTCGACGAGATCAACCAGGGCATGGACCCGCGCAACGAGCGCATGGTGCACGAGCGCATGGTG
GAGATCGCCTGCCGCGAGCACACGAGCCAGTACTTCCTCATCACGCCCAAGCTGCTGACGGGCCTGCGCTACGAC
GCCAAGATGCGCGTGCTGTGCATCGCCAGCGGCGAGCACATGCCGCGCGACGGCGCCAAGCTCGACCTGGCCAGC
TGCCTGGCCCGCCAGCGCCGCCTGATGGCCGCCGCCCGCTGA
Transcript >Hirsu2|8227
ATGGCGCGCTCGTCGTCTCGCCGTCGAAGGCGCTCCGAGTTGGACGATGCCGATAGCAACGAAAATGCGCCGCCC
TCGCCGGGCTCCGATACCCCCTCCAAGCGACGGCGCCTAGACTTTGATTCAGATGAAGGCGGCTCAGGCCGGGCG
GAGAAGACCAACGGGGCCGTCCAACCAGCCGAGATGGACGACTTCCACCCCGGCGCCATCGTGCGCGTCAAGGTC
GAGAACTTCGTCACCTACGAAAAGGCCGAATTTTTTCCCGGCCCGCATCTGAACATGGTCATCGGCCCCAACGGC
ACTGGCAAAAGCTCGCTCGTCTGCGCCATTTGCCTCGGTCTCGGCTACAGCCCCAAGCATCTCGGCCGGGCCGGG
TCGGTCAAGGAGTTCGTCAAGCACGGCAAGGACACGGCCACCATCGAGATCGAGCTTCAAAAGAGGCCACAAGAC
CGATCCAACCACGTGGTGCGGGTCCAGATCCGTCGCGAGCAGAACAGCCAGAAATGGTGGTTGAACGGCAAGGAA
ACCACCCAAAAGGCCGTCCAGGCCCTGATGCAGTCGCTCAAGATCCAGGTGGACAACCTCTGCCAGTTCCTGCCC
CAGGACAGGGTCGTCGAGTTCGCCGCCTGCACCCCCGTCGACCTCCTTCACGAGACGCTGCGGGCCGCCGCCCCG
GAGGAGATGCTGCAGTGGCAGAAGCAGCTGCAAGACCTGCACAGGGACAAGAAGGAGCTGGCCCAGACAGTCCAA
ACCGACGCCGAGACGTTGAGGACTCTCGAAACCCGCCAGCAGGGTCTCCAGGCGGACGTGGATAGGATCCGGGAA
CGCGAGGAGATCCAGGAACGAGTGAAAAATCTCCAATCGGCTTTGCTTCTCGCCAAGTACCAAGAAGCTCGAACC
AAATACTCCGAGGCCCGGGACCGCAAGAAGGACGCCGAAAGGGTCTTCCGACGGCTCGAGGAGGAATCCGGACCC
TCGCTGGAAGCCATCGATCAAAAGAAGGAGTATTCGCGCCAAATCGACTCCGCTATGCCGGCCATGGAGAAGGGG
TTGAAAGACGCGGAACAAGCCGCGATTCAAATGTCGGACGATGTCGCGGCGGCGGCGGAACTTGTCAAAGAAATG
GACGACAAGCTGGAGGCCGAACACAAGGGCTTCGAAGCAAAGAAGAAGGAGCTGGCGACGTCGAGGTCCAAGATT
ACCTCGTTCCAGGCCGACCTGAAGAACCGACCCTCGGAGTTTAATGCTGCCGAGTGGAACCAGAAGATTCGGGCA
GAAGAGCACAAACTACGGGATCTGGAGGCGGAGCAGCGCAATGTCTCCATGGAACTAGCTACGCTCCGTGACAAG
GGCAAAGCGGTCGTCCAACAGAGACGCAAGATCGAAAGCGACATCGAGGCCCTCGACACCCAGCAGGGCCAGCAG
CTCAACTTCATGAGAAAGTATTTCCCCGAGCCCGCCATTGGCTGGGATTGGGTGCAAGAACACCAGAGCGAATTC
GAGAAGGAAGTCTTTGGGCCGCCCATCATCAGCTGCTCCATTAAGGATGAGCGCTACTCGGACAAAGTCCAGTCA
CTTCTGCAGAACGACGACTTTCTCTGCTTTACCGCACAGACGAGCAGCGACTACAAGAAACTGACGGACCAGCTG
TACCGAGTGATGAGCCTGTCCGTCGTCATCAGAACATGTTCTCACTCCCTCGAGTCATTCCGACCGCCGGTCGAT
AGAGCGGAAATATCCGCGCTCGGCTTTGACGGCTACGCCGTGGATTTCTTGGATGGCCCTGCTCCGGTCCTTGCC
ATGCTCTGCGCCGAGAAACGAATCCACCAAGCTGGCGTCTCCCTCAGGGACCACAACGATGCCGAGTACGAGCGA
CTGATGGCCAACGGCAGAATCAATCAGTGGGCAGCCGGCAAGCACTCCTATATGATTCGCCGCCGCAGAGAATAC
GGCCCGCAGGCGATGACGACGGTCAGCAAAAACATCCGGCCGGGCAGGTTCTGGACGTCGCAGCCGGTCGATGCT
CAGGAGAAGGTCGAGCTGAACCGCCAATTGCTGGAGAGGAGAGACGAAATAGCGGCCATGAAGGAAGAGAACACG
AGGCTGAAGGACAAGTTCTCCAACATCGAGGGAGAGAAATCGGACAGTCAGCGGCGAATTGACGATCTAAAAACC
GAAAAGAACGCTCTGCAGAAGGAGTATCAAAAATGGCAGTCTCTTCCGGAGAAGATAGAATCCGAGGAACGCAAC
AAGGCGACGCACGAACAAGCGCTTCGAGACGCGAGAAAGCGCATGCTAGACATCTACTACGAGTGGGACAAGGCG
GCCCTGAAGCGCGTGGATCTCGCGATCGAGCACCAGAAGCTGGTGGAGAAGATAGGGAGCGCACACCAGGCGCTC
CTGGAGGCCAAGATCCGGCAGATTGAGGCGCGCTCCGACATCCAGGGGCTCAAGGAGCGCAGCGCCAGTCTGATG
CAACGGCTCGAGCAGAAGAGGCGGGAGGTGCAGGACGCAACGGACGACGCCAGCCGGGCCAAGGAGGAGGGCCGG
CGACTGTCGGACGAGGTCAAGGACATGCTCGTCCGGGACGGGGACAAGAGGGAGCTGCTCACACAACTGTCGGAC
GGGAAGACGCCGCAGGAGCTGGAGATGGACATGTCGGCCGAGGAGGCCAAGCTGGAGCTCATACACGCCGCCAAC
CCGAACGTGATCCGCGAGTTCGAGCGGCGCGCGCAGGAGATGGACCGGCTCAAGCGCAAGATGGAGGGCTTCACC
GCGAAGCTCGAGGACCTCGACAGCCGGCTCGGCTCGCTCATGGGCCGGTGGGAGCCGCGGCTGGACGAGCTGGTG
TCGCGCATCAACGACGCGTTCGCGTACAACTTTGAGCAGATCAGCTGCGCGGGCGAGATCCGCGTCCACAAGGAC
GACGACTTTGACCTGTGGGCGCTGGACATTATGGTGAAGTTCCGCGAGAACGAGACGCTGCAGCAGCTGACGGCG
CACCGGCAATCGGGCGGCGAGCGGGCCGTGTCGACCATCTTCTACCTGATGGCGCTGCAGTCGATGGCGCAGTCG
CCCTTCCGCGTCGTCGACGAGATCAACCAGGGCATGGACCCGCGCAACGAGCGCATGGTGCACGAGCGCATGGTG
GAGATCGCCTGCCGCGAGCACACGAGCCAGTACTTCCTCATCACGCCCAAGCTGCTGACGGGCCTGCGCTACGAC
GCCAAGATGCGCGTGCTGTGCATCGCCAGCGGCGAGCACATGCCGCGCGACGGCGCCAAGCTCGACCTGGCCAGC
TGCCTGGCCCGCCAGCGCCGCCTGATGGCCGCCGCCCGCTGA
Gene >Hirsu2|8227
ATGGCGCGCTCGTCGTCTCGCCGTCGAAGGCGCTCCGAGTTGGACGATGCCGATAGCAACGAAAATGCGCCGCCC
TCGCCGGGCTCCGATACCCCCTCCAAGCGACGGCGCCTAGACTTTGATTCAGATGAAGGCGGCTCAGGCCGGGCG
GAGAAGACCAACGGGGCCGTCCAACCAGCCGAGATGGACGACTTCCACCCCGGCGCCATCGTGCGCGTCAAGGTC
GAGAACTTCGTCACCTACGAAAAGGCCGAATTTTTTCCCGGCCCGCATCTGAACATGGTCATCGGCCCCAACGGC
ACTGGCAAAAGCTCGCTCGTCTGCGCCATTTGCCTCGGTCTCGGCTACAGCCCCAAGCATCTCGGCCGGGCCGGG
TCGGTCAAGGAGTTCGTCAAGCACGGCAAGGACACGGCCACCATCGAGATCGAGCTTCAAAAGAGGCCACAAGAC
CGATCCAACCACGTGGTGCGGGTCCAGATCCGTCGCGAGCAGAACAGCCAGAAATGGTGGTTGAACGGCAAGGAA
ACCACCCAAAAGGCCGTCCAGGCCCTGATGCAGTCGCTCAAGATCCAGGTGGACAACCTCTGCCAGTTCCTGCCC
CAGGACAGGGTCGTCGAGTTCGCCGCCTGCACCCCCGTCGACCTCCTTCACGAGACGCTGCGGGCCGCCGCCCCG
GAGGAGATGCTGCAGTGGCAGAAGCAGCTGCAAGACCTGCACAGGGACAAGAAGGAGCTGGCCCAGACAGTCCAA
ACCGACGCCGAGACGTTGAGGACTCTCGAAACCCGCCAGCAGGGTCTCCAGGCGGACGTGGATAGGATCCGGGAA
CGCGAGGAGATCCAGGAACGAGTGAAAAATCTCCAATCGGCTTTGCTTCTCGCCAAGTACCAAGAAGCTCGAACC
AAATACTCCGAGGCCCGGGACCGCAAGAAGGACGCCGAAAGGGTCTTCCGACGGCTCGAGGAGGAATCCGGACCC
TCGCTGGAAGCCATCGATCAAAAGAAGGAGTATTCGCGCCAAATCGACTCCGCTATGCCGGCCATGGAGAAGGGG
TTGAAAGACGCGGAACAAGCCGCGATTCAAATGTCGGACGATGTCGCGGCGGCGGCGGAACTTGTCAAAGAAATG
GACGACAAGCTGGAGGCCGAACACAAGGGCTTCGAAGCAAAGAAGAAGGAGCTGGCGACGTCGAGGTCCAAGATT
ACCTCGTTCCAGGCCGACCTGAAGAACCGACCCTCGGAGTTTAATGCTGCCGAGTGGAACCAGAAGATTGTGAGT
TTGGCATCCCTCCAACAGACGCGCGCACACACACACACAGTCAAATTGACGCGATCATGACGCTGACGGGCCAAT
GAACCAACAGCGGGCAGAAGAGCACAAACTACGGGATCTGGAGGCGGAGCAGCGCAATGTCTCCATGGAACTAGC
TACGCTCCGTGACAAGGGCAAAGCGGTCGTCCAACAGAGACGCAAGATCGAAAGCGACATCGAGGCCCTCGACAC
CCAGCAGGGCCAGCAGCTCAACTTCATGAGAAAGTATTTCCCCGAGCCCGCCATTGGCTGGGATTGGGTGCAAGA
ACACCAGAGCGAATTCGAGAAGGAAGTCTTTGGGCCGCCCATCATCAGCTGCTCCATTAAGGATGAGCGCTACTC
GGACAAAGTCCAGTCACTTCTGCAGAACGACGACTTTCTCTGCTTTACCGCACAGACGAGCAGCGACTACAAGAA
ACTGACGGACCAGCTGTACCGAGTGATGAGCCTGTCCGTCGTCATCAGAACATGTTCTCACTCCCTCGAGTCATT
CCGACCGCCGGTCGATAGAGCGGAAATATCCGCGCTCGGCTTTGACGGCTACGCCGTGGATTTCTTGGATGGCCC
TGCTCCGGTCCTTGCCATGCTCTGCGCCGAGAAACGAATCCACCAAGCTGGCGTCTCCCTCAGGGACCACAACGA
TGCCGAGTACGAGCGACTGATGGCCAACGGCAGAATCAATCAGTGGGCAGCCGGCAAGCACTCCTATATGATTCG
CCGCCGCAGAGAATACGGCCCGCAGGCGATGACGACGGTCAGCAAAAACATCCGGCCGGGCAGGTTCTGGACGTC
GCAGCCGGTCGATGCTCAGGAGAAGGTCGAGCTGAACCGCCAATTGCTGGAGAGGAGAGACGAAATAGCGGCCAT
GAAGGAAGAGAACACGAGGCTGAAGGACAAGTTCTCCAACATCGAGGGAGAGAAATCGGACAGTCAGCGGCGAAT
TGTAAGGACATGACGCTTCACACCCAGCAGAGGAAAGGAGGGGAGGCAAAGAGACCGGTAGCTTGCTGACACAGC
CACAGGACGATCTAAAAACCGAAAAGAACGCTCTGCAGAAGGAGTATCAAAAATGGCAGTCTCTTCCGGAGAAGA
TAGGTAGGCGATTTGCCCGCCTCGTGCCGTCGTGGACCTGAGCTGAAAGCTGGATAGAATCCGAGGAACGCAACA
AGGCGACGCACGAACAAGCGCTTCGAGACGCGAGAAAGCGCATGCTAGACATCTACTACGAGTGGGACAAGGCGG
CCCTGAAGCGCGTGGATCTCGCGATCGAGCACCAGAAGCTGGTGGAGAAGATAGGGAGCGCACACCAGGCGCTCC
TGGAGGCCAAGATCCGGCAGATTGAGGCGCGCTCCGACATCCAGGGGCTCAAGGAGCGCAGCGCCAGTCTGATGC
AACGGCTCGAGCAGAAGAGGCGGGAGGTGCAGGACGCAACGGACGACGCCAGCCGGGCCAAGGAGGAGGGCCGGC
GACTGTCGGACGAGGTCAAGGACATGCTCGTCCGGGACGGGGACAAGAGGGAGCTGCTCACACAACTGTCGGACG
GGAAGACGCCGCAGGAGCTGGAGATGGACATGTCGGCCGAGGAGGCCAAGCTGGAGCTCATACACGCCGCCAACC
CGAACGTGATCCGCGAGTTCGAGCGGCGCGCGCAGGAGATGGACCGGCTCAAGCGCAAGATGGAGGGCTTCACCG
CGAAGCTCGAGGACCTCGACAGCCGGCTCGGCTCGCTCATGGGCCGGTGGGAGCCGCGGCTGGACGAGCTGGTGT
CGCGCATCAACGACGCGTTCGCGTACAACTTTGAGCAGATCAGCTGCGCGGGCGAGATCCGCGTCCACAAGGACG
ACGACTTTGACCTGTGGGCGCTGGACATTATGGTGAAGTTCCGGTGAGTCCCCCCCCCTCCCCCTTCCGCTCTCG
CAGCCAGCTAACCCGACGCGCGCCCGACCAGCGAGAACGAGACGCTGCAGCAGCTGACGGCGCACCGGCAATCGG
GCGGCGAGCGGGCCGTGTCGACCATCTTCTACCTGATGGCGCTGCAGTCGATGGCGCAGTCGCCCTTCCGCGTCG
TCGACGAGATCAACCAGGGCATGGACCCGCGCAACGAGCGCATGGTGCACGAGCGCATGGTGGAGATCGCCTGCC
GCGAGCACACGAGCCAGTACTTCCTCATCACGCCCAAGCTGCTGACGGGCCTGCGCTACGACGCCAAGATGCGCG
TGCTGTGCATCGCCAGCGGCGAGCACATGCCGCGCGACGGCGCCAAGCTCGACCTGGCCAGCTGCCTGGCCCGCC
AGCGCCGCCTGATGGCCGCCGCCCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail