Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8220
Gene name
LocationContig_520:13187..14473
Strand+
Gene length (bp)1286
Transcript length (bp)1230
Coding sequence length (bp)1230
Protein length (aa) 410

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07281 INSIG Insulin-induced protein (INSIG) 5.5E-85 156 394

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53898|NSG2_YEAST Protein NSG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSG2 PE=1 SV=1 57 311 2.0E-08
sp|B0CMA4|INSI2_CALJA Insulin-induced gene 2 protein OS=Callithrix jacchus GN=INSIG2 PE=3 SV=1 146 312 4.0E-07
sp|Q5R687|INSI2_PONAB Insulin-induced gene 2 protein OS=Pongo abelii GN=INSIG2 PE=2 SV=2 146 312 2.0E-06
sp|Q9Y5U4|INSI2_HUMAN Insulin-induced gene 2 protein OS=Homo sapiens GN=INSIG2 PE=1 SV=2 146 312 2.0E-06
sp|A9RA88|INSI2_PAPAN Insulin-induced gene 2 protein OS=Papio anubis GN=INSIG2 PE=3 SV=1 146 314 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53898|NSG2_YEAST Protein NSG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSG2 PE=1 SV=1 57 311 2.0E-08
sp|B0CMA4|INSI2_CALJA Insulin-induced gene 2 protein OS=Callithrix jacchus GN=INSIG2 PE=3 SV=1 146 312 4.0E-07
sp|Q5R687|INSI2_PONAB Insulin-induced gene 2 protein OS=Pongo abelii GN=INSIG2 PE=2 SV=2 146 312 2.0E-06
sp|Q9Y5U4|INSI2_HUMAN Insulin-induced gene 2 protein OS=Homo sapiens GN=INSIG2 PE=1 SV=2 146 312 2.0E-06
sp|A9RA88|INSI2_PAPAN Insulin-induced gene 2 protein OS=Papio anubis GN=INSIG2 PE=3 SV=1 146 314 2.0E-06
sp|Q6PQZ3|INSI2_PIG Insulin-induced gene 2 protein OS=Sus scrofa GN=INSIG2 PE=2 SV=2 146 314 2.0E-06
sp|Q91WG1|INSI2_MOUSE Insulin-induced gene 2 protein OS=Mus musculus GN=Insig2 PE=1 SV=1 248 312 3.0E-06
sp|Q80UA9|INSI2_RAT Insulin-induced gene 2 protein OS=Rattus norvegicus GN=Insig2 PE=2 SV=1 248 312 3.0E-06
sp|Q66J27|INSI2_XENLA Insulin-induced gene 2 protein OS=Xenopus laevis GN=insig2 PE=2 SV=1 248 314 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 154 173 19
2 194 216 22
3 269 291 22
4 298 317 19
5 373 395 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8220
MADDGPPLVRPVPRRPFSINLMSVTPPDDELSEPIDCAFTSPKPDARFLDAGLAPTEPASPSRPPSVMNLTSPTL
LGIYSQAASGPRDRSFADRDDLVDTPWGTGAQTPIKRPGLDDATYELMRDRSHPLRRPSSYRPVDTACPPSTAST
LLSLSFRAAVLFLLGIGYGVLVTRIHDEQQYFADLTEGIIKPGANWKYLAFWGASGVVLGSLLPWVDKVWEDSFG
GDSAIAGADDDGAGDGSLGPGTDWALVMRAIGAFVGIIFAIRKLAWASTLQVSATLALVNPLLWWLIDRSKPGFL
LSAGVGLAGSALLLGVNPDMMPAPSRLSPQSSASAPTAAAAAGNASASSSGAEGVTPPVLAGLASQETVETGIWM
LSVLFCSCVCFGNIGRRLAWSKKAGVRGRWGGVR*
Coding >Hirsu2|8220
ATGGCCGACGATGGACCTCCCCTCGTGCGCCCTGTCCCCCGGCGGCCCTTCAGCATCAACCTCATGAGCGTCACG
CCCCCAGACGACGAGCTGTCAGAACCAATCGATTGCGCCTTCACCTCCCCAAAGCCAGACGCCCGTTTCCTAGAC
GCCGGCCTTGCCCCGACCGAGCCGGCCTCGCCAAGCCGGCCCCCGTCCGTCATGAACCTAACCTCGCCCACTCTC
CTGGGTATCTACTCCCAGGCTGCCTCCGGCCCACGCGACCGCTCCTTTGCCGACCGCGACGACCTCGTCGACACC
CCCTGGGGCACCGGCGCCCAGACGCCCATCAAGCGGCCCGGCCTCGACGACGCCACCTACGAGCTGATGCGTGAC
CGCTCCCACCCTTTGCGCCGCCCATCCTCCTATCGGCCCGTCGACACCGCCTGCCCGCCCTCGACCGCCTCCACC
CTCCTCTCCCTGTCCTTCCGCGCCGCCGTGCTCTTCCTCCTCGGCATCGGCTACGGCGTCCTCGTCACCCGCATC
CACGACGAGCAGCAGTACTTTGCCGACCTGACCGAGGGCATCATCAAGCCCGGTGCCAACTGGAAGTATCTTGCC
TTCTGGGGTGCCTCCGGCGTCGTGCTCGGATCCCTGCTCCCCTGGGTCGACAAGGTGTGGGAGGATAGCTTCGGC
GGCGACTCGGCCATTGCCGGGGCCGACGACGACGGGGCCGGCGACGGCAGCCTCGGGCCCGGTACCGACTGGGCC
CTTGTCATGCGCGCCATTGGAGCCTTTGTCGGCATCATCTTCGCCATTCGCAAGCTTGCCTGGGCTTCGACATTG
CAGGTGTCGGCGACGCTCGCCCTCGTCAACCCGCTGCTGTGGTGGCTCATCGACCGGAGCAAGCCGGGCTTCCTC
CTGTCGGCCGGCGTCGGCCTGGCCGGCTCAGCCCTCTTGCTCGGCGTCAACCCCGACATGATGCCAGCGCCGTCC
AGGCTGTCGCCGCAGTCGTCCGCTTCCGCCCCCACAGCCGCCGCCGCGGCCGGCAACGCGTCGGCGTCATCGTCG
GGGGCGGAGGGGGTGACCCCGCCGGTGTTGGCGGGCCTGGCAAGTCAGGAGACGGTCGAGACGGGCATCTGGATG
CTGAGCGTGCTGTTCTGCAGCTGTGTGTGCTTCGGCAACATCGGTAGACGGCTGGCCTGGAGCAAAAAGGCGGGC
GTCAGGGGGCGCTGGGGAGGCGTGCGCTGA
Transcript >Hirsu2|8220
ATGGCCGACGATGGACCTCCCCTCGTGCGCCCTGTCCCCCGGCGGCCCTTCAGCATCAACCTCATGAGCGTCACG
CCCCCAGACGACGAGCTGTCAGAACCAATCGATTGCGCCTTCACCTCCCCAAAGCCAGACGCCCGTTTCCTAGAC
GCCGGCCTTGCCCCGACCGAGCCGGCCTCGCCAAGCCGGCCCCCGTCCGTCATGAACCTAACCTCGCCCACTCTC
CTGGGTATCTACTCCCAGGCTGCCTCCGGCCCACGCGACCGCTCCTTTGCCGACCGCGACGACCTCGTCGACACC
CCCTGGGGCACCGGCGCCCAGACGCCCATCAAGCGGCCCGGCCTCGACGACGCCACCTACGAGCTGATGCGTGAC
CGCTCCCACCCTTTGCGCCGCCCATCCTCCTATCGGCCCGTCGACACCGCCTGCCCGCCCTCGACCGCCTCCACC
CTCCTCTCCCTGTCCTTCCGCGCCGCCGTGCTCTTCCTCCTCGGCATCGGCTACGGCGTCCTCGTCACCCGCATC
CACGACGAGCAGCAGTACTTTGCCGACCTGACCGAGGGCATCATCAAGCCCGGTGCCAACTGGAAGTATCTTGCC
TTCTGGGGTGCCTCCGGCGTCGTGCTCGGATCCCTGCTCCCCTGGGTCGACAAGGTGTGGGAGGATAGCTTCGGC
GGCGACTCGGCCATTGCCGGGGCCGACGACGACGGGGCCGGCGACGGCAGCCTCGGGCCCGGTACCGACTGGGCC
CTTGTCATGCGCGCCATTGGAGCCTTTGTCGGCATCATCTTCGCCATTCGCAAGCTTGCCTGGGCTTCGACATTG
CAGGTGTCGGCGACGCTCGCCCTCGTCAACCCGCTGCTGTGGTGGCTCATCGACCGGAGCAAGCCGGGCTTCCTC
CTGTCGGCCGGCGTCGGCCTGGCCGGCTCAGCCCTCTTGCTCGGCGTCAACCCCGACATGATGCCAGCGCCGTCC
AGGCTGTCGCCGCAGTCGTCCGCTTCCGCCCCCACAGCCGCCGCCGCGGCCGGCAACGCGTCGGCGTCATCGTCG
GGGGCGGAGGGGGTGACCCCGCCGGTGTTGGCGGGCCTGGCAAGTCAGGAGACGGTCGAGACGGGCATCTGGATG
CTGAGCGTGCTGTTCTGCAGCTGTGTGTGCTTCGGCAACATCGGTAGACGGCTGGCCTGGAGCAAAAAGGCGGGC
GTCAGGGGGCGCTGGGGAGGCGTGCGCTGA
Gene >Hirsu2|8220
ATGGCCGACGATGGACCTCCCCTCGTGCGCCCTGTCCCCCGGCGGCCCTTCAGCATCAACCTCATGAGCGTCACG
CCCCCAGACGACGAGCTGTCAGAACCAATCGATTGCGCCTTCACCTCCCCAAAGCCAGACGCCCGTTTCCTAGAC
GCCGGCCTTGCCCCGACCGAGCCGGCCTCGCCAAGCCGGCCCCCGTCCGTCATGAACCTAACCTCGCCCACTCTC
CTGGGTATCTACTCCCAGGCTGCCTCCGGCCCACGCGACCGCTCCTTTGCCGACCGCGACGACCTCGTCGACACC
CCCTGGGGCACCGGCGCCCAGACGCCCATCAAGCGGCCCGGCCTCGACGACGCCACCTACGAGCTGATGCGTGAC
CGCTCCCACCCTTTGCGCCGCCCATCCTCCTATCGGCCCGTCGACACCGCCTGCCCGCCCTCGACCGCCTCCACC
CTCCTCTCCCTGTCCTTCCGCGCCGCCGTGCTCTTCCTCCTCGGCATCGGCTACGGCGTCCTCGTCACCCGCATC
CACGACGAGCAGCAGTACTTTGCCGACCTGACCGAGGGCATCATCAAGCCCGGTGCCAACTGGAAGTATCTTGCC
TTCTGGGGTGCCTCCGGCGTCGTGCTCGGATCCCTGCTCCCCTGGGTCGACAAGGTGTGGGAGGATAGCTTCGGC
GGCGACTCGGCCATTGCCGGGGCCGACGACGACGGGGCCGGCGACGGCAGCCTCGGGCCCGGTACCGACTGGGCC
CTTGTCATGCGCGCCATTGGAGCCTTTGTCGGCATCATCTTCGCCATTGTGAGTGACGCTGTCCCGTGCAAGCTC
CCCTGACTGACTTGTGTCCCGTCGCACAGCGCAAGCTTGCCTGGGCTTCGACATTGCAGGTGTCGGCGACGCTCG
CCCTCGTCAACCCGCTGCTGTGGTGGCTCATCGACCGGAGCAAGCCGGGCTTCCTCCTGTCGGCCGGCGTCGGCC
TGGCCGGCTCAGCCCTCTTGCTCGGCGTCAACCCCGACATGATGCCAGCGCCGTCCAGGCTGTCGCCGCAGTCGT
CCGCTTCCGCCCCCACAGCCGCCGCCGCGGCCGGCAACGCGTCGGCGTCATCGTCGGGGGCGGAGGGGGTGACCC
CGCCGGTGTTGGCGGGCCTGGCAAGTCAGGAGACGGTCGAGACGGGCATCTGGATGCTGAGCGTGCTGTTCTGCA
GCTGTGTGTGCTTCGGCAACATCGGTAGACGGCTGGCCTGGAGCAAAAAGGCGGGCGTCAGGGGGCGCTGGGGAG
GCGTGCGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail