Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8218
Gene name
LocationContig_520:6187..9279
Strand+
Gene length (bp)3092
Transcript length (bp)2940
Coding sequence length (bp)2940
Protein length (aa) 980

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.7E-39 30 298
PF07714 Pkinase_Tyr Protein tyrosine kinase 1.6E-28 27 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43066|PPK30_SCHPO Serine/threonine-protein kinase ppk30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk30 PE=1 SV=1 16 313 9.0E-109
sp|P53974|ARK1_YEAST Actin-regulating kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARK1 PE=1 SV=1 11 319 3.0E-103
sp|P40494|PRK1_YEAST Actin-regulating kinase PRK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRK1 PE=1 SV=1 13 359 1.0E-100
sp|Q9USS2|PPK29_SCHPO Serine/threonine-protein kinase ppk29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk29 PE=1 SV=1 16 326 3.0E-100
sp|Q9UU85|PPK38_SCHPO Protein kinase domain-containing protein ppk38 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk38 PE=3 SV=1 4 317 5.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43066|PPK30_SCHPO Serine/threonine-protein kinase ppk30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk30 PE=1 SV=1 16 313 9.0E-109
sp|P53974|ARK1_YEAST Actin-regulating kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARK1 PE=1 SV=1 11 319 3.0E-103
sp|P40494|PRK1_YEAST Actin-regulating kinase PRK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRK1 PE=1 SV=1 13 359 1.0E-100
sp|Q9USS2|PPK29_SCHPO Serine/threonine-protein kinase ppk29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk29 PE=1 SV=1 16 326 3.0E-100
sp|Q9UU85|PPK38_SCHPO Protein kinase domain-containing protein ppk38 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk38 PE=3 SV=1 4 317 5.0E-96
sp|Q5A961|PRK1_CANAL Actin-regulating kinase PRK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRK1 PE=1 SV=1 9 388 3.0E-92
sp|P38080|AKL1_YEAST Serine/threonine-protein kinase AKL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKL1 PE=1 SV=1 13 314 7.0E-88
sp|Q54VV7|Y0111_DICDI Probable serine/threonine-protein kinase DDB_G0280111 OS=Dictyostelium discoideum GN=DDB_G0280111 PE=3 SV=1 16 306 2.0E-66
sp|F1MH24|AAK1_BOVIN AP2-associated protein kinase 1 OS=Bos taurus GN=AAK1 PE=1 SV=2 16 337 4.0E-66
sp|Q2M2I8|AAK1_HUMAN AP2-associated protein kinase 1 OS=Homo sapiens GN=AAK1 PE=1 SV=3 16 337 1.0E-65
sp|F1SPM8|AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa GN=AAK1 PE=2 SV=2 16 337 3.0E-65
sp|Q9NSY1|BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens GN=BMP2K PE=1 SV=2 21 319 5.0E-65
sp|Q3UHJ0|AAK1_MOUSE AP2-associated protein kinase 1 OS=Mus musculus GN=Aak1 PE=1 SV=2 16 312 6.0E-65
sp|P0C1X8|AAK1_RAT AP2-associated protein kinase 1 OS=Rattus norvegicus GN=Aak1 PE=1 SV=1 16 319 1.0E-64
sp|Q91Z96|BMP2K_MOUSE BMP-2-inducible protein kinase OS=Mus musculus GN=Bmp2k PE=1 SV=1 21 319 5.0E-64
sp|Q86HW6|Y6461_DICDI Probable serine/threonine-protein kinase DDB_G0276461 OS=Dictyostelium discoideum GN=DDB_G0276461 PE=3 SV=1 16 304 3.0E-59
sp|G5ECQ3|SEL5_CAEEL Protein sel-5 OS=Caenorhabditis elegans GN=sel-5 PE=2 SV=1 16 295 2.0E-53
sp|O14976|GAK_HUMAN Cyclin-G-associated kinase OS=Homo sapiens GN=GAK PE=1 SV=2 16 298 2.0E-44
sp|P97874|GAK_RAT Cyclin-G-associated kinase OS=Rattus norvegicus GN=Gak PE=1 SV=1 16 298 1.0E-43
sp|Q99KY4|GAK_MOUSE Cyclin-G-associated kinase OS=Mus musculus GN=Gak PE=1 SV=2 16 298 4.0E-43
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 30 297 9.0E-24
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 28 297 8.0E-23
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 32 318 5.0E-21
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 28 291 1.0E-20
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 26 297 8.0E-20
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 28 318 1.0E-19
sp|Q12003|ENV7_YEAST Serine/threonine-protein kinase ENV7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV7 PE=1 SV=1 13 291 2.0E-19
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 28 310 5.0E-19
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 35 310 7.0E-19
sp|Q54RJ4|IKSA_DICDI Probable serine/threonine-protein kinase iksA OS=Dictyostelium discoideum GN=iksA PE=3 SV=1 32 296 1.0E-18
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 12 292 1.0E-18
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 32 309 2.0E-18
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 24 340 2.0E-18
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 26 297 3.0E-18
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 8 378 3.0E-18
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 27 291 4.0E-18
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 32 308 6.0E-18
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 24 352 8.0E-18
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 58 258 1.0E-17
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 30 310 1.0E-17
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 30 298 4.0E-17
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 71 302 4.0E-17
sp|P57760|STK16_RAT Serine/threonine-protein kinase 16 OS=Rattus norvegicus GN=Stk16 PE=2 SV=2 14 303 4.0E-17
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 32 249 4.0E-17
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 25 297 6.0E-17
sp|O75716|STK16_HUMAN Serine/threonine-protein kinase 16 OS=Homo sapiens GN=STK16 PE=1 SV=4 14 303 7.0E-17
sp|O13839|FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fin1 PE=3 SV=1 28 297 8.0E-17
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 19 308 8.0E-17
sp|A8X775|DLK1_CAEBR Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis briggsae GN=dlk-1 PE=3 SV=1 58 258 1.0E-16
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 87 312 1.0E-16
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 28 310 1.0E-16
sp|Q8C0Q4|NEK11_MOUSE Serine/threonine-protein kinase Nek11 OS=Mus musculus GN=Nek11 PE=2 SV=2 25 297 1.0E-16
sp|O88697|STK16_MOUSE Serine/threonine-protein kinase 16 OS=Mus musculus GN=Stk16 PE=1 SV=3 14 303 1.0E-16
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 51 307 2.0E-16
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 28 304 2.0E-16
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 30 298 2.0E-16
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 24 309 3.0E-16
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 16 309 3.0E-16
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 25 282 5.0E-16
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 34 289 5.0E-16
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 34 289 6.0E-16
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 28 297 6.0E-16
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 30 313 6.0E-16
sp|Q8VCR8|MYLK2_MOUSE Myosin light chain kinase 2, skeletal/cardiac muscle OS=Mus musculus GN=Mylk2 PE=1 SV=2 56 296 7.0E-16
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 19 306 7.0E-16
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 19 306 9.0E-16
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 56 297 1.0E-15
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 20 347 1.0E-15
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 32 297 1.0E-15
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 36 298 1.0E-15
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 18 308 1.0E-15
sp|P20689|MYLK2_RAT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Rattus norvegicus GN=Mylk2 PE=1 SV=2 56 296 1.0E-15
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 25 297 1.0E-15
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 28 313 1.0E-15
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 3 310 1.0E-15
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 36 298 1.0E-15
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 32 445 2.0E-15
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 67 294 2.0E-15
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 32 278 3.0E-15
sp|P07313|MYLK2_RABIT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Oryctolagus cuniculus GN=MYLK2 PE=1 SV=3 56 296 3.0E-15
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 36 298 3.0E-15
sp|A4IFM7|MYLK2_BOVIN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Bos taurus GN=MYLK2 PE=2 SV=1 56 296 4.0E-15
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 32 297 4.0E-15
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 28 298 5.0E-15
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 56 297 5.0E-15
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 23 304 5.0E-15
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 28 298 5.0E-15
sp|Q10078|PPK13_SCHPO Serine/threonine-protein kinase ppk13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk13 PE=3 SV=2 19 291 5.0E-15
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 104 296 6.0E-15
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 35 296 6.0E-15
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 28 253 7.0E-15
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 32 297 7.0E-15
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 32 297 8.0E-15
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 28 294 8.0E-15
sp|Q75CH3|ATG1_ASHGO Serine/threonine-protein kinase ATG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG1 PE=3 SV=1 14 282 8.0E-15
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 57 297 8.0E-15
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 24 268 9.0E-15
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 24 268 9.0E-15
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 73 297 9.0E-15
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 28 320 1.0E-14
sp|Q20845|PLK3_CAEEL Serine/threonine-protein kinase plk-3 OS=Caenorhabditis elegans GN=plk-3 PE=2 SV=1 31 291 1.0E-14
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 24 268 1.0E-14
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 24 268 1.0E-14
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 16 284 1.0E-14
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 73 297 1.0E-14
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 14 308 1.0E-14
sp|Q54QQ1|PHG2_DICDI Serine/threonine-protein kinase phg2 OS=Dictyostelium discoideum GN=phg2 PE=1 SV=1 67 303 1.0E-14
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 23 304 1.0E-14
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 13 297 1.0E-14
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 32 304 1.0E-14
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 28 294 1.0E-14
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 28 294 2.0E-14
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 25 294 2.0E-14
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 25 304 2.0E-14
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 28 251 2.0E-14
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 16 311 2.0E-14
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 20 296 2.0E-14
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 28 298 2.0E-14
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 28 298 2.0E-14
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 21 296 2.0E-14
sp|Q8VZJ9|CRCK2_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 2 OS=Arabidopsis thaliana GN=CRCK2 PE=2 SV=1 32 242 3.0E-14
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 28 303 3.0E-14
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 32 258 3.0E-14
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 28 294 3.0E-14
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 23 304 3.0E-14
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 26 304 3.0E-14
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 32 297 3.0E-14
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 23 304 4.0E-14
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 106 318 4.0E-14
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 32 297 4.0E-14
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 28 308 4.0E-14
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 28 298 4.0E-14
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 27 297 4.0E-14
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 27 297 5.0E-14
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 20 304 5.0E-14
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 1 304 5.0E-14
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 32 297 6.0E-14
sp|Q15746|MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4 28 320 6.0E-14
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 47 297 6.0E-14
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 32 297 6.0E-14
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 32 389 6.0E-14
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 67 294 7.0E-14
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 28 296 7.0E-14
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 32 288 8.0E-14
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 32 297 8.0E-14
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 32 297 8.0E-14
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 28 316 8.0E-14
sp|Q6CSX2|ATG1_KLULA Serine/threonine-protein kinase ATG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG1 PE=3 SV=1 28 289 9.0E-14
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 32 324 9.0E-14
sp|Q5KQF5|CIPKM_ORYSJ CBL-interacting protein kinase 22 OS=Oryza sativa subsp. japonica GN=CIPK22 PE=2 SV=1 74 296 9.0E-14
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 20 267 1.0E-13
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 32 297 1.0E-13
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 20 306 1.0E-13
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 28 297 1.0E-13
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 30 316 1.0E-13
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 16 263 1.0E-13
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 20 306 1.0E-13
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 28 237 1.0E-13
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 20 306 1.0E-13
sp|Q23023|UNC51_CAEEL Serine/threonine-protein kinase unc-51 OS=Caenorhabditis elegans GN=unc-51 PE=1 SV=1 20 252 1.0E-13
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 67 294 1.0E-13
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 32 297 1.0E-13
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 20 267 1.0E-13
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 32 304 1.0E-13
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 32 297 1.0E-13
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 28 356 2.0E-13
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 21 250 2.0E-13
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 72 300 2.0E-13
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 32 296 2.0E-13
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 13 258 2.0E-13
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 28 308 2.0E-13
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 54 297 2.0E-13
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 58 300 2.0E-13
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 32 308 2.0E-13
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 32 296 2.0E-13
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 28 308 2.0E-13
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 32 296 2.0E-13
sp|P11799|MYLK_CHICK Myosin light chain kinase, smooth muscle OS=Gallus gallus GN=Mylk PE=1 SV=2 28 297 2.0E-13
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 32 298 2.0E-13
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 74 250 2.0E-13
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 28 296 2.0E-13
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 87 326 2.0E-13
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 16 292 2.0E-13
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 105 282 2.0E-13
sp|Q9FIL7|CRCK1_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 1 OS=Arabidopsis thaliana GN=CRCK1 PE=1 SV=1 32 250 2.0E-13
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 28 251 2.0E-13
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 28 283 2.0E-13
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 28 254 2.0E-13
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 74 250 3.0E-13
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 18 282 3.0E-13
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 21 250 3.0E-13
sp|Q3U1V8|M3K9_MOUSE Mitogen-activated protein kinase kinase kinase 9 OS=Mus musculus GN=Map3k9 PE=2 SV=2 4 257 3.0E-13
sp|P49138|MAPK2_MOUSE MAP kinase-activated protein kinase 2 OS=Mus musculus GN=Mapkapk2 PE=1 SV=2 72 333 3.0E-13
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 72 300 3.0E-13
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 32 296 3.0E-13
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 20 306 3.0E-13
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 20 306 3.0E-13
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 32 304 3.0E-13
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 73 298 3.0E-13
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 56 297 3.0E-13
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 54 294 4.0E-13
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 20 267 4.0E-13
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 25 282 4.0E-13
sp|P49136|MAPK2_CRILO MAP kinase-activated protein kinase 2 (Fragment) OS=Cricetulus longicaudatus GN=MAPKAPK2 PE=2 SV=1 72 333 4.0E-13
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 63 330 4.0E-13
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 28 242 4.0E-13
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 25 297 4.0E-13
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 27 309 4.0E-13
sp|Q8C0V0|TLK1_MOUSE Serine/threonine-protein kinase tousled-like 1 OS=Mus musculus GN=Tlk1 PE=1 SV=2 108 282 5.0E-13
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 32 258 5.0E-13
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 28 296 5.0E-13
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 32 237 5.0E-13
sp|Q9S2C0|PKSC_STRCO Serine/threonine-protein kinase PksC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pksC PE=3 SV=1 21 300 5.0E-13
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 31 296 5.0E-13
sp|P49139|MAPK2_RABIT MAP kinase-activated protein kinase 2 (Fragment) OS=Oryctolagus cuniculus GN=MAPKAPK2 PE=1 SV=2 49 333 5.0E-13
sp|P18160|SPLA_DICDI Dual specificity protein kinase splA OS=Dictyostelium discoideum GN=splA PE=1 SV=3 52 307 5.0E-13
sp|Q9UKI8|TLK1_HUMAN Serine/threonine-protein kinase tousled-like 1 OS=Homo sapiens GN=TLK1 PE=1 SV=2 108 282 5.0E-13
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 32 314 6.0E-13
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 73 298 6.0E-13
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 27 297 6.0E-13
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 28 289 6.0E-13
sp|P49137|MAPK2_HUMAN MAP kinase-activated protein kinase 2 OS=Homo sapiens GN=MAPKAPK2 PE=1 SV=1 49 333 7.0E-13
sp|Q5UQ78|YR517_MIMIV Putative serine/threonine-protein kinase R517/R518 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R517 PE=3 SV=2 32 282 7.0E-13
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 53 258 7.0E-13
sp|C0LGD6|Y1570_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g05700 OS=Arabidopsis thaliana GN=At1g05700 PE=2 SV=1 32 242 7.0E-13
sp|P80192|M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens GN=MAP3K9 PE=1 SV=3 10 303 7.0E-13
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 28 294 7.0E-13
sp|Q86UE8|TLK2_HUMAN Serine/threonine-protein kinase tousled-like 2 OS=Homo sapiens GN=TLK2 PE=1 SV=2 108 282 7.0E-13
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 25 267 7.0E-13
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 51 258 7.0E-13
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 25 263 8.0E-13
sp|Q6SA08|TSSK4_HUMAN Testis-specific serine/threonine-protein kinase 4 OS=Homo sapiens GN=TSSK4 PE=1 SV=1 3 303 8.0E-13
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 32 263 8.0E-13
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 32 258 9.0E-13
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 28 296 9.0E-13
sp|Q08CW1|TLK2_XENTR Serine/threonine-protein kinase tousled-like 2 OS=Xenopus tropicalis GN=tlk2 PE=2 SV=1 108 282 9.0E-13
sp|Q86YV6|MYLK4_HUMAN Myosin light chain kinase family member 4 OS=Homo sapiens GN=MYLK4 PE=1 SV=2 32 249 1.0E-12
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 28 298 1.0E-12
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 32 341 1.0E-12
sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis GN=map3k13-b PE=2 SV=1 107 296 1.0E-12
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 73 282 1.0E-12
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 54 258 1.0E-12
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 30 282 1.0E-12
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 28 243 1.0E-12
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 32 297 1.0E-12
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 32 314 1.0E-12
sp|Q5VST9|OBSCN_HUMAN Obscurin OS=Homo sapiens GN=OBSCN PE=1 SV=3 105 296 1.0E-12
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 32 321 1.0E-12
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 27 263 1.0E-12
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 73 298 1.0E-12
sp|P53684|CDPKB_ORYSJ Calcium-dependent protein kinase isoform 11 OS=Oryza sativa subsp. japonica GN=CPK11 PE=2 SV=2 27 297 1.0E-12
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 11 282 1.0E-12
sp|Q07250|KCCS_MALDO Calcium/calmodulin-dependent serine/threonine-protein kinase OS=Malus domestica PE=2 SV=1 105 296 1.0E-12
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 27 297 1.0E-12
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 64 251 1.0E-12
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 27 297 1.0E-12
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 27 297 1.0E-12
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 54 258 1.0E-12
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 28 268 1.0E-12
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 28 301 1.0E-12
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 32 296 2.0E-12
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 27 297 2.0E-12
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 28 320 2.0E-12
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 27 285 2.0E-12
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 32 314 2.0E-12
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 32 310 2.0E-12
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 27 297 2.0E-12
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 58 300 2.0E-12
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 32 253 2.0E-12
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 25 298 2.0E-12
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 27 309 2.0E-12
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 28 294 2.0E-12
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 60 250 2.0E-12
sp|Q1DB00|MASK_MYXXD Tyrosine-protein kinase MasK OS=Myxococcus xanthus (strain DK 1622) GN=masK PE=1 SV=1 8 260 2.0E-12
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 51 296 2.0E-12
sp|Q6FL58|ATG1_CANGA Serine/threonine-protein kinase ATG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG1 PE=3 SV=1 18 282 2.0E-12
sp|Q9HFF4|PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk1 PE=1 SV=2 69 251 2.0E-12
sp|O08605|MKNK1_MOUSE MAP kinase-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Mknk1 PE=1 SV=2 74 297 2.0E-12
sp|O55047|TLK2_MOUSE Serine/threonine-protein kinase tousled-like 2 OS=Mus musculus GN=Tlk2 PE=1 SV=2 108 282 2.0E-12
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 31 290 2.0E-12
sp|P41719|PK1_NPVHZ Serine/threonine-protein kinase 1 OS=Heliothis zea nuclear polyhedrosis virus GN=PK1 PE=3 SV=1 107 296 2.0E-12
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 49 291 3.0E-12
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 57 298 3.0E-12
sp|A2AAJ9|OBSCN_MOUSE Obscurin OS=Mus musculus GN=Obscn PE=1 SV=2 105 296 3.0E-12
sp|P53104|ATG1_YEAST Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG1 PE=1 SV=1 29 282 3.0E-12
sp|A6ZU07|ATG1_YEAS7 Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG1 PE=3 SV=1 29 282 3.0E-12
sp|Q66JF3|MKNK1_XENTR MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus tropicalis GN=mknk1 PE=2 SV=1 32 297 3.0E-12
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 15 297 3.0E-12
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 28 295 3.0E-12
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 28 321 3.0E-12
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 73 282 3.0E-12
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 63 332 3.0E-12
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 69 313 3.0E-12
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 28 295 3.0E-12
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 10 310 3.0E-12
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 26 292 3.0E-12
sp|Q08217|PSK2_YEAST Serine/threonine-protein kinase PSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSK2 PE=1 SV=1 116 292 3.0E-12
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 49 294 3.0E-12
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 24 308 3.0E-12
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 63 330 4.0E-12
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 68 308 4.0E-12
sp|A7J1T2|M313A_XENLA Mitogen-activated protein kinase kinase kinase 13-A OS=Xenopus laevis GN=map3k13-a PE=2 SV=1 107 296 4.0E-12
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 69 283 4.0E-12
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 18 251 4.0E-12
sp|Q6ZWH5|NEK10_HUMAN Serine/threonine-protein kinase Nek10 OS=Homo sapiens GN=NEK10 PE=2 SV=3 28 295 4.0E-12
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 18 251 4.0E-12
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 105 290 4.0E-12
sp|Q8IWU2|LMTK2_HUMAN Serine/threonine-protein kinase LMTK2 OS=Homo sapiens GN=LMTK2 PE=1 SV=2 1 263 4.0E-12
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 105 298 4.0E-12
sp|D7UQM5|AURK_PATPE Aurora kinase OS=Patiria pectinifera GN=aur PE=1 SV=1 32 303 4.0E-12
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 32 283 4.0E-12
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 78 308 4.0E-12
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 3 291 4.0E-12
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 54 297 5.0E-12
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 32 291 5.0E-12
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 25 297 5.0E-12
sp|Q55GG4|Y9847_DICDI Probable serine/threonine-protein kinase DDB_G0267686 OS=Dictyostelium discoideum GN=DDB_G0267686 PE=3 SV=1 21 305 5.0E-12
sp|Q6BS08|ATG1_DEBHA Serine/threonine-protein kinase ATG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG1 PE=3 SV=2 32 283 5.0E-12
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 18 251 5.0E-12
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 32 307 5.0E-12
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 32 289 5.0E-12
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 32 282 5.0E-12
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 28 253 5.0E-12
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 16 292 5.0E-12
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 28 253 5.0E-12
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 32 289 5.0E-12
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 30 297 5.0E-12
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 28 253 5.0E-12
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 18 251 5.0E-12
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 32 296 6.0E-12
sp|P11837|NIMA_EMENI G2-specific protein kinase nimA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimA PE=1 SV=1 84 353 6.0E-12
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 28 253 6.0E-12
sp|Q4G050|MKNK1_RAT MAP kinase-interacting serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mknk1 PE=2 SV=1 74 297 6.0E-12
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 28 298 6.0E-12
sp|Q696W0|SPEG_DANRE Striated muscle preferentially expressed protein kinase OS=Danio rerio GN=speg PE=2 SV=1 64 299 6.0E-12
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 6 291 6.0E-12
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 6 291 6.0E-12
sp|Q8AYG3|TTK_DANRE Dual specificity protein kinase Ttk OS=Danio rerio GN=ttk PE=1 SV=2 4 294 6.0E-12
sp|P0C5D6|SAPK3_ORYSJ Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1 107 304 7.0E-12
sp|A2ZAB5|SAPK3_ORYSI Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. indica GN=SAPK3 PE=1 SV=2 107 304 7.0E-12
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 32 263 7.0E-12
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 28 253 7.0E-12
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 60 252 7.0E-12
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 60 250 8.0E-12
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 30 297 8.0E-12
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 28 320 8.0E-12
sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 28 297 8.0E-12
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 63 289 8.0E-12
sp|Q9D411|TSSK4_MOUSE Testis-specific serine/threonine-protein kinase 4 OS=Mus musculus GN=Tssk4 PE=2 SV=1 74 321 8.0E-12
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 28 304 8.0E-12
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 32 250 8.0E-12
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 28 307 8.0E-12
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 25 289 9.0E-12
sp|Q3E8W4|ANX2_ARATH Receptor-like protein kinase ANXUR2 OS=Arabidopsis thaliana GN=ANX2 PE=2 SV=1 17 243 9.0E-12
sp|P13186|KIN2_YEAST Serine/threonine-protein kinase KIN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN2 PE=1 SV=3 18 306 9.0E-12
sp|C0LGD7|Y1684_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g06840 OS=Arabidopsis thaliana GN=At1g06840 PE=2 SV=2 32 298 9.0E-12
sp|Q1ECX4|TLK2_DANRE Serine/threonine-protein kinase tousled-like 2 OS=Danio rerio GN=tlk2 PE=2 SV=2 108 258 9.0E-12
sp|Q54UL8|MPS1_DICDI Probable serine/threonine-protein kinase mps1 OS=Dictyostelium discoideum GN=mps1 PE=3 SV=1 30 292 9.0E-12
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 57 296 9.0E-12
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 25 345 1.0E-11
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 28 307 1.0E-11
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 32 285 1.0E-11
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 27 237 1.0E-11
sp|O64556|Y2923_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230 OS=Arabidopsis thaliana GN=At2g19230 PE=3 SV=3 28 242 1.0E-11
sp|P13286|PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus GN=Phkg1 PE=2 SV=2 74 282 1.0E-11
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 65 308 1.0E-11
sp|O94768|ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo sapiens GN=STK17B PE=1 SV=1 104 291 1.0E-11
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 30 282 1.0E-11
sp|Q7TPK6|WNK4_RAT Serine/threonine-protein kinase WNK4 OS=Rattus norvegicus GN=Wnk4 PE=1 SV=3 74 310 1.0E-11
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 51 258 1.0E-11
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 59 294 1.0E-11
sp|Q96J92|WNK4_HUMAN Serine/threonine-protein kinase WNK4 OS=Homo sapiens GN=WNK4 PE=1 SV=1 74 310 1.0E-11
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 74 282 1.0E-11
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 32 283 1.0E-11
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 11 282 1.0E-11
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 32 283 1.0E-11
sp|Q9SR05|ANX1_ARATH Receptor-like protein kinase ANXUR1 OS=Arabidopsis thaliana GN=ANX1 PE=2 SV=1 35 243 1.0E-11
sp|Q01919|KIN4_YEAST Serine/threonine-protein kinase KIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN4 PE=1 SV=1 27 296 1.0E-11
sp|Q90ZY6|TLK1B_DANRE Serine/threonine-protein kinase tousled-like 1-B OS=Danio rerio GN=tlk1b PE=2 SV=1 108 295 1.0E-11
sp|Q54RR9|Y9844_DICDI Probable serine/threonine-protein kinase DDB_G0282963 OS=Dictyostelium discoideum GN=DDB_G0282963 PE=3 SV=1 26 257 1.0E-11
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 28 297 1.0E-11
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 11 264 1.0E-11
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 25 292 1.0E-11
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 68 312 1.0E-11
sp|Q8BG48|ST17B_MOUSE Serine/threonine-protein kinase 17B OS=Mus musculus GN=Stk17b PE=1 SV=1 97 291 1.0E-11
sp|Q66H84|MAPK3_RAT MAP kinase-activated protein kinase 3 OS=Rattus norvegicus GN=Mapkapk3 PE=2 SV=1 72 324 1.0E-11
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 105 259 2.0E-11
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 25 304 2.0E-11
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 78 303 2.0E-11
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 105 299 2.0E-11
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 6 297 2.0E-11
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 68 296 2.0E-11
sp|Q91XS8|ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus norvegicus GN=Stk17b PE=1 SV=1 104 291 2.0E-11
sp|P43291|SRK2A_ARATH Serine/threonine-protein kinase SRK2A OS=Arabidopsis thaliana GN=SRK2A PE=1 SV=1 109 304 2.0E-11
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 30 315 2.0E-11
sp|Q80UE6|WNK4_MOUSE Serine/threonine-protein kinase WNK4 OS=Mus musculus GN=Wnk4 PE=1 SV=1 74 310 2.0E-11
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 25 296 2.0E-11
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 24 286 2.0E-11
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 28 282 2.0E-11
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 32 250 2.0E-11
sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana GN=CTR1 PE=1 SV=1 16 249 2.0E-11
sp|Q9FPR3|EDR1_ARATH Serine/threonine-protein kinase EDR1 OS=Arabidopsis thaliana GN=EDR1 PE=1 SV=1 18 260 2.0E-11
sp|Q1HKZ5|M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus GN=Map3k13 PE=1 SV=1 107 296 3.0E-11
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 32 289 3.0E-11
sp|A7MBB4|M3K13_BOVIN Mitogen-activated protein kinase kinase kinase 13 OS=Bos taurus GN=MAP3K13 PE=2 SV=1 107 296 3.0E-11
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 32 282 3.0E-11
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 30 304 3.0E-11
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 32 296 3.0E-11
sp|Q8FUI4|PKN2_COREF Serine/threonine-protein kinases drp72 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0034 PE=3 SV=1 28 284 3.0E-11
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 51 258 3.0E-11
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 28 304 3.0E-11
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 30 265 3.0E-11
sp|Q9M101|CDPKN_ARATH Calcium-dependent protein kinase 23 OS=Arabidopsis thaliana GN=CPK23 PE=1 SV=1 55 312 3.0E-11
sp|Q12852|M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens GN=MAP3K12 PE=1 SV=2 26 296 3.0E-11
sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens GN=SLK PE=1 SV=1 32 314 3.0E-11
sp|Q9BXA6|TSSK6_HUMAN Testis-specific serine/threonine-protein kinase 6 OS=Homo sapiens GN=TSSK6 PE=1 SV=1 104 291 3.0E-11
sp|Q3UMW7|MAPK3_MOUSE MAP kinase-activated protein kinase 3 OS=Mus musculus GN=Mapkapk3 PE=1 SV=2 72 324 4.0E-11
sp|Q7XQP4|SAPK7_ORYSJ Serine/threonine-protein kinase SAPK7 OS=Oryza sativa subsp. japonica GN=SAPK7 PE=2 SV=2 107 292 4.0E-11
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 24 298 4.0E-11
sp|P9WI63|PKNL_MYCTU Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknL PE=1 SV=1 25 257 4.0E-11
sp|P9WI62|PKNL_MYCTO Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknL PE=3 SV=1 25 257 4.0E-11
sp|Q925K9|TSSK6_MOUSE Testis-specific serine/threonine-protein kinase 6 OS=Mus musculus GN=Tssk6 PE=2 SV=1 104 291 4.0E-11
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 18 296 4.0E-11
sp|Q9GT24|ZYG1_CAEEL Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis elegans GN=zyg-1 PE=1 SV=1 30 242 4.0E-11
sp|Q4G3H4|IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio GN=chuk PE=1 SV=1 15 249 4.0E-11
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 30 321 4.0E-11
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 105 290 4.0E-11
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 32 263 4.0E-11
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 27 237 4.0E-11
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 58 319 4.0E-11
sp|A6ZU08|TOS3_YEAS7 Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain YJM789) GN=TOS3 PE=3 SV=1 71 267 4.0E-11
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 71 306 4.0E-11
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 28 250 5.0E-11
sp|Q7TYY6|PKNL_MYCBO Serine/threonine-protein kinase PknL OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknL PE=3 SV=1 25 257 5.0E-11
sp|Q07014|LYN_RAT Tyrosine-protein kinase Lyn OS=Rattus norvegicus GN=Lyn PE=1 SV=3 26 295 5.0E-11
sp|P07948|LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens GN=LYN PE=1 SV=3 26 292 5.0E-11
sp|Q65X23|WNK2_ORYSJ Probable serine/threonine-protein kinase WNK2 OS=Oryza sativa subsp. japonica GN=WNK2 PE=2 SV=1 32 249 5.0E-11
sp|P43637|TOS3_YEAST Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOS3 PE=1 SV=1 71 267 5.0E-11
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 29 297 5.0E-11
sp|P9WI83|PKNA_MYCTU Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknA PE=1 SV=1 13 257 5.0E-11
sp|P9WI82|PKNA_MYCTO Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknA PE=3 SV=1 13 257 5.0E-11
sp|A5TY85|PKNA_MYCTA Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pknA PE=1 SV=1 13 257 5.0E-11
sp|P65727|PKNA_MYCBO Serine/threonine-protein kinase PknA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknA PE=3 SV=1 13 257 5.0E-11
sp|Q60700|M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus GN=Map3k12 PE=1 SV=1 26 296 5.0E-11
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 32 249 5.0E-11
sp|O80396|M2K3_ARATH Mitogen-activated protein kinase kinase 3 OS=Arabidopsis thaliana GN=MKK3 PE=1 SV=1 54 291 6.0E-11
sp|Q6ZI44|SAPK6_ORYSJ Serine/threonine-protein kinase SAPK6 OS=Oryza sativa subsp. japonica GN=SAPK6 PE=2 SV=1 107 292 6.0E-11
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 32 297 6.0E-11
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 28 310 6.0E-11
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 24 258 6.0E-11
sp|P63185|SRC_RSVSE Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain Schmidt-Ruppin E) GN=V-SRC PE=1 SV=3 32 303 6.0E-11
sp|Q8LEB6|Y5185_ARATH Probable receptor-like protein kinase At5g18500 OS=Arabidopsis thaliana GN=At5g18500 PE=2 SV=1 19 239 6.0E-11
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 87 312 7.0E-11
sp|P25911|LYN_MOUSE Tyrosine-protein kinase Lyn OS=Mus musculus GN=Lyn PE=1 SV=4 26 292 7.0E-11
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 87 312 7.0E-11
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 104 249 7.0E-11
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 28 290 7.0E-11
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 2 282 7.0E-11
sp|Q9LIG2|RLK6_ARATH Receptor-like protein kinase At3g21340 OS=Arabidopsis thaliana GN=At3g21340 PE=1 SV=1 28 242 8.0E-11
sp|P07527|WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wee1 PE=1 SV=1 32 241 8.0E-11
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 20 242 8.0E-11
sp|Q15139|KPCD1_HUMAN Serine/threonine-protein kinase D1 OS=Homo sapiens GN=PRKD1 PE=1 SV=2 24 294 8.0E-11
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 30 297 9.0E-11
sp|Q8SSH4|MPS1_ENCCU Probable serine/threonine-protein kinase MPS1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MPS1 PE=3 SV=1 18 307 9.0E-11
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 60 308 9.0E-11
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 18 252 9.0E-11
sp|Q54WS5|ROCO6_DICDI Probable serine/threonine-protein kinase roco6 OS=Dictyostelium discoideum GN=roco6 PE=3 SV=1 54 307 9.0E-11
sp|P35761|TTK_MOUSE Dual specificity protein kinase TTK OS=Mus musculus GN=Ttk PE=1 SV=1 5 250 1.0E-10
sp|O43283|M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens GN=MAP3K13 PE=1 SV=1 107 296 1.0E-10
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 18 252 1.0E-10
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 30 265 1.0E-10
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 45 242 1.0E-10
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 105 308 1.0E-10
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 65 297 1.0E-10
sp|C0LGG3|Y5182_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51820 OS=Arabidopsis thaliana GN=At1g51820 PE=2 SV=1 28 242 1.0E-10
sp|Q9C958|SRK2B_ARATH Serine/threonine-protein kinase SRK2B OS=Arabidopsis thaliana GN=SRK2B PE=1 SV=1 109 292 1.0E-10
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 32 297 1.0E-10
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 24 292 1.0E-10
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 52 252 1.0E-10
sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens GN=MAP4K4 PE=1 SV=2 32 237 1.0E-10
sp|C0LGR6|Y4291_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g29180 OS=Arabidopsis thaliana GN=At4g29180 PE=2 SV=2 28 242 1.0E-10
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 24 308 1.0E-10
sp|O04086|Y1105_ARATH Probable receptor-like protein kinase At1g11050 OS=Arabidopsis thaliana GN=At1g11050 PE=2 SV=1 29 242 1.0E-10
sp|Q63796|M3K12_RAT Mitogen-activated protein kinase kinase kinase 12 OS=Rattus norvegicus GN=Map3k12 PE=1 SV=1 26 296 1.0E-10
sp|Q9V3Q6|M3K7_DROME Mitogen-activated protein kinase kinase kinase 7 OS=Drosophila melanogaster GN=Tak1 PE=2 SV=1 69 296 1.0E-10
sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase roco8 OS=Dictyostelium discoideum GN=roco8 PE=3 SV=1 66 251 1.0E-10
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 63 249 1.0E-10
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 70 339 1.0E-10
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 30 249 1.0E-10
sp|Q5R8X7|M3K13_PONAB Mitogen-activated protein kinase kinase kinase 13 OS=Pongo abelii GN=MAP3K13 PE=2 SV=1 107 296 1.0E-10
sp|P41808|SMK1_YEAST Sporulation-specific mitogen-activated protein kinase SMK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMK1 PE=1 SV=1 18 239 1.0E-10
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 18 252 1.0E-10
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 18 252 1.0E-10
sp|Q5A649|ATG1_CANAL Serine/threonine-protein kinase ATG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG1 PE=3 SV=1 32 310 1.0E-10
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 30 249 1.0E-10
sp|Q9UTH3|PPK6_SCHPO Serine/threonine-protein kinase ppk6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk6 PE=1 SV=2 114 292 1.0E-10
sp|Q3UGM2|NEK10_MOUSE Serine/threonine-protein kinase Nek10 OS=Mus musculus GN=Nek10 PE=2 SV=2 21 295 1.0E-10
sp|Q9WTQ1|KPCD1_RAT Serine/threonine-protein kinase D1 OS=Rattus norvegicus GN=Prkd1 PE=1 SV=2 32 294 1.0E-10
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 5 272 1.0E-10
sp|Q9M9E9|SRK2C_ARATH Serine/threonine-protein kinase SRK2C OS=Arabidopsis thaliana GN=SRK2C PE=1 SV=1 107 292 1.0E-10
sp|Q58D94|MKNK1_BOVIN MAP kinase-interacting serine/threonine-protein kinase 1 OS=Bos taurus GN=MKNK1 PE=2 SV=2 74 297 1.0E-10
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 20 254 2.0E-10
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 20 254 2.0E-10
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 20 254 5.0E-10
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 28 250 5.0E-10
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 20 253 2.0E-09
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 60 251 3.0E-09
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 60 249 3.0E-09
sp|Q696W0|SPEG_DANRE Striated muscle preferentially expressed protein kinase OS=Danio rerio GN=speg PE=2 SV=1 84 294 5.0E-09
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 28 267 1.0E-08
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 28 241 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8218
MAGPGLAAPPGTFSPGTKIQVGGHRVVIQKYLSEGGFAHVYLVKMAKPVDGTDLAVLKRVAVPDKDALRNMRTEV
ETMKRLKGHRPIVTYIDSHASELRGGGYEVFLLMEYCNGGGLIDFMNTRLQHRLTEPEILTIFADIAEGVACMHY
LKPPLLHRDLKVENVLITSRASAKRFKLCDFGSAAAPRPAPTTVVECRLMDEDVQKHTTLQYRSPEMIDVYRKQP
LNEKSDIWALGVLLYKLCYYTTPFEDQGQLAILNASYRYPSYPVFSDRIKKLIASMLRESIDARPTIYHVLKEAC
AMQGREVPIKNIYAARSPTDSRTHDKASGGDAKTRPQVVGAVFSAPVQEQQRIPDVVPMRRGRPAKSSELSESPP
KKVTEGDPFAALDGRNGKGLDADELSSRFPTLDQFTLLHDQGAKFDFDSSAASPPAEAPAADLGQRVAERLADDA
FVSPESAPADPLPSPGPHSASIVGADRVVSPVLARPASAAAGARPRTDLSKAQTIISSNPDLKAIASHANSKYVS
IGTMTSDMPSESPTRQADQGPGPRHHPGNLALSAVQSHSSHARQSSLSSQRSLEDGRPLASPPESAGRAEMPAIR
PRPASTTFESSTLEFLRERESWKAQSRSGRPLSRGSQPRSSSSLNAATRADDSTQPFKVGDLLLDADGSDSDAAE
RPRSSKRTSVSLPTGTISKLAGKFGDAFKRFEGSTTPEAAAGGLHRPPSKGAGQHELTPIAGSEATDGRSDDGLV
EVDPDKATPEMRREIERRQLQEEEERVAAAQAEYRRRVASDGASSSSSSSRPVPGPKKVGGVSRAAAIQSRVQSL
LDEEQRPSQVQRTAEGYGKYSDAATAASRDKALPSIPRKPSAALSKAKANHAKAEPSPSPAETPTASRPAATGSR
PVAPRKPVHLNSLPTGGRPPSPAKRSEHLMAAELPGRPVLEMSAQERDDYVREFAKRFPSLNSMELQAAMSREGG
ATER*
Coding >Hirsu2|8218
ATGGCCGGTCCCGGCCTCGCCGCGCCGCCCGGCACCTTCTCGCCCGGCACCAAGATCCAGGTCGGCGGCCACCGG
GTCGTGATCCAAAAGTACCTGTCCGAGGGCGGCTTCGCCCACGTCTACCTCGTCAAGATGGCCAAGCCCGTCGAC
GGCACCGACCTGGCCGTGCTCAAGCGCGTGGCCGTGCCGGACAAGGACGCGCTGCGCAACATGCGCACCGAGGTC
GAGACGATGAAGCGCCTCAAGGGCCACCGCCCCATCGTCACCTACATCGACTCCCACGCCTCCGAGCTCCGCGGC
GGCGGCTACGAGGTCTTCCTGCTCATGGAGTACTGCAACGGCGGCGGCCTCATCGACTTCATGAACACGCGCCTG
CAGCACCGCCTGACCGAGCCCGAGATCCTCACCATCTTCGCCGACATTGCCGAGGGCGTCGCCTGCATGCACTAC
CTCAAGCCCCCGCTCCTGCACCGCGACCTCAAGGTCGAGAACGTCCTCATCACCTCCCGCGCCTCCGCCAAGCGC
TTCAAGCTGTGCGACTTCGGCTCCGCCGCCGCCCCGCGCCCCGCGCCCACCACCGTCGTCGAGTGCCGCCTCATG
GACGAGGACGTCCAGAAGCACACGACGCTGCAGTACCGCAGCCCCGAGATGATCGACGTCTACCGGAAGCAGCCC
CTGAACGAGAAGTCGGACATCTGGGCCCTCGGCGTCCTGCTCTACAAGCTGTGCTACTACACCACCCCCTTCGAG
GACCAGGGCCAGCTGGCCATCCTCAACGCCAGCTACCGCTACCCGAGCTACCCCGTCTTTTCGGATCGCATAAAA
AAGCTGATCGCCTCCATGCTGCGAGAGAGCATTGACGCCCGCCCGACCATCTACCACGTTCTGAAGGAGGCTTGC
GCCATGCAGGGACGAGAAGTGCCCATCAAAAACATATACGCGGCAAGGTCGCCGACCGACTCCCGGACGCATGAC
AAGGCCTCCGGCGGTGACGCGAAAACCCGGCCTCAAGTCGTCGGCGCCGTCTTCTCCGCCCCCGTGCAGGAGCAA
CAACGCATCCCCGACGTCGTCCCGATGCGGAGAGGGCGGCCGGCCAAGTCGTCAGAGCTATCCGAATCTCCCCCG
AAAAAGGTCACGGAGGGCGATCCCTTCGCCGCGTTGGACGGTCGAAATGGCAAGGGCCTCGACGCCGACGAGCTG
TCCTCTCGCTTCCCCACGCTGGACCAATTCACCCTGCTCCACGACCAGGGGGCCAAGTTCGACTTCGACTCGTCC
GCGGCCTCGCCCCCGGCAGAGGCTCCGGCCGCTGACCTGGGGCAGAGAGTGGCAGAGAGACTGGCCGATGACGCC
TTCGTGTCGCCCGAAAGCGCCCCTGCAGATCCGTTGCCATCCCCGGGACCGCACTCGGCCTCCATCGTCGGGGCG
GACCGAGTCGTCTCGCCCGTTCTCGCCAGGCCGGCGTCGGCCGCTGCGGGCGCGCGGCCGAGAACGGACCTGAGC
AAGGCGCAGACCATCATCAGCAGCAACCCAGACCTCAAGGCGATCGCGTCTCACGCGAACTCGAAATACGTTTCG
ATCGGCACCATGACATCCGACATGCCCTCCGAGTCGCCGACCAGGCAGGCCGATCAGGGCCCGGGCCCCCGCCAC
CACCCGGGAAACTTGGCGCTCTCCGCCGTCCAGTCCCACTCGAGCCACGCGCGTCAGTCGTCACTCTCGTCACAG
CGGTCGCTCGAAGACGGTCGGCCGCTCGCGTCGCCGCCGGAATCCGCCGGACGCGCCGAGATGCCGGCGATCCGA
CCGCGGCCCGCCAGCACCACGTTCGAGTCGAGCACGCTCGAGTTCCTCCGCGAGAGGGAGTCGTGGAAGGCGCAA
AGCCGGTCGGGCCGCCCGCTGTCCCGCGGCTCGCAGCCCCGATCGTCGTCGAGCCTCAACGCGGCGACCCGCGCC
GACGACAGCACGCAGCCGTTCAAGGTCGGCGACCTGCTGCTCGACGCCGATGGCTCCGACTCGGATGCGGCAGAG
CGGCCGCGGTCGAGCAAACGGACGAGCGTCTCTCTGCCGACCGGGACGATCAGCAAGCTCGCCGGCAAGTTCGGA
GACGCCTTCAAGCGATTCGAGGGCTCCACCACGCCGGAAGCCGCCGCCGGCGGGCTGCACCGCCCCCCGTCCAAG
GGCGCCGGCCAACACGAGCTGACTCCGATCGCGGGTTCCGAGGCGACGGACGGCCGGAGCGACGACGGGCTGGTG
GAAGTCGATCCGGACAAGGCGACGCCGGAGATGAGACGCGAGATCGAGCGCCGCCAGCTGCAAGAGGAGGAGGAG
CGGGTGGCGGCCGCCCAGGCAGAGTACAGGAGGCGCGTGGCCAGCGACGGCGCCAGTTCCTCCTCCTCCTCCTCG
CGGCCGGTCCCGGGACCCAAGAAGGTGGGAGGCGTCTCGAGGGCGGCGGCGATCCAAAGCCGGGTGCAGAGCCTT
CTGGACGAGGAGCAGCGGCCGTCGCAAGTGCAGAGGACGGCCGAGGGGTACGGCAAGTACTCGGACGCGGCCACG
GCGGCCAGCAGGGACAAGGCGCTGCCGTCGATACCGCGCAAGCCGTCGGCCGCCCTGTCCAAGGCCAAGGCCAAC
CACGCCAAGGCCGAGCCGTCGCCGTCTCCGGCAGAGACGCCGACGGCATCCCGGCCGGCGGCGACGGGCAGCCGG
CCGGTGGCGCCGAGGAAGCCGGTGCACCTCAACAGCCTGCCGACGGGAGGGCGGCCGCCGTCGCCGGCCAAGCGG
AGCGAGCACCTGATGGCGGCCGAGCTGCCGGGCCGGCCGGTGCTGGAGATGTCGGCGCAGGAGAGGGACGACTAC
GTCCGGGAGTTTGCCAAGCGCTTCCCCAGCCTGAACTCGATGGAGCTGCAGGCGGCCATGAGCCGCGAGGGGGGC
GCGACGGAGCGGTAG
Transcript >Hirsu2|8218
ATGGCCGGTCCCGGCCTCGCCGCGCCGCCCGGCACCTTCTCGCCCGGCACCAAGATCCAGGTCGGCGGCCACCGG
GTCGTGATCCAAAAGTACCTGTCCGAGGGCGGCTTCGCCCACGTCTACCTCGTCAAGATGGCCAAGCCCGTCGAC
GGCACCGACCTGGCCGTGCTCAAGCGCGTGGCCGTGCCGGACAAGGACGCGCTGCGCAACATGCGCACCGAGGTC
GAGACGATGAAGCGCCTCAAGGGCCACCGCCCCATCGTCACCTACATCGACTCCCACGCCTCCGAGCTCCGCGGC
GGCGGCTACGAGGTCTTCCTGCTCATGGAGTACTGCAACGGCGGCGGCCTCATCGACTTCATGAACACGCGCCTG
CAGCACCGCCTGACCGAGCCCGAGATCCTCACCATCTTCGCCGACATTGCCGAGGGCGTCGCCTGCATGCACTAC
CTCAAGCCCCCGCTCCTGCACCGCGACCTCAAGGTCGAGAACGTCCTCATCACCTCCCGCGCCTCCGCCAAGCGC
TTCAAGCTGTGCGACTTCGGCTCCGCCGCCGCCCCGCGCCCCGCGCCCACCACCGTCGTCGAGTGCCGCCTCATG
GACGAGGACGTCCAGAAGCACACGACGCTGCAGTACCGCAGCCCCGAGATGATCGACGTCTACCGGAAGCAGCCC
CTGAACGAGAAGTCGGACATCTGGGCCCTCGGCGTCCTGCTCTACAAGCTGTGCTACTACACCACCCCCTTCGAG
GACCAGGGCCAGCTGGCCATCCTCAACGCCAGCTACCGCTACCCGAGCTACCCCGTCTTTTCGGATCGCATAAAA
AAGCTGATCGCCTCCATGCTGCGAGAGAGCATTGACGCCCGCCCGACCATCTACCACGTTCTGAAGGAGGCTTGC
GCCATGCAGGGACGAGAAGTGCCCATCAAAAACATATACGCGGCAAGGTCGCCGACCGACTCCCGGACGCATGAC
AAGGCCTCCGGCGGTGACGCGAAAACCCGGCCTCAAGTCGTCGGCGCCGTCTTCTCCGCCCCCGTGCAGGAGCAA
CAACGCATCCCCGACGTCGTCCCGATGCGGAGAGGGCGGCCGGCCAAGTCGTCAGAGCTATCCGAATCTCCCCCG
AAAAAGGTCACGGAGGGCGATCCCTTCGCCGCGTTGGACGGTCGAAATGGCAAGGGCCTCGACGCCGACGAGCTG
TCCTCTCGCTTCCCCACGCTGGACCAATTCACCCTGCTCCACGACCAGGGGGCCAAGTTCGACTTCGACTCGTCC
GCGGCCTCGCCCCCGGCAGAGGCTCCGGCCGCTGACCTGGGGCAGAGAGTGGCAGAGAGACTGGCCGATGACGCC
TTCGTGTCGCCCGAAAGCGCCCCTGCAGATCCGTTGCCATCCCCGGGACCGCACTCGGCCTCCATCGTCGGGGCG
GACCGAGTCGTCTCGCCCGTTCTCGCCAGGCCGGCGTCGGCCGCTGCGGGCGCGCGGCCGAGAACGGACCTGAGC
AAGGCGCAGACCATCATCAGCAGCAACCCAGACCTCAAGGCGATCGCGTCTCACGCGAACTCGAAATACGTTTCG
ATCGGCACCATGACATCCGACATGCCCTCCGAGTCGCCGACCAGGCAGGCCGATCAGGGCCCGGGCCCCCGCCAC
CACCCGGGAAACTTGGCGCTCTCCGCCGTCCAGTCCCACTCGAGCCACGCGCGTCAGTCGTCACTCTCGTCACAG
CGGTCGCTCGAAGACGGTCGGCCGCTCGCGTCGCCGCCGGAATCCGCCGGACGCGCCGAGATGCCGGCGATCCGA
CCGCGGCCCGCCAGCACCACGTTCGAGTCGAGCACGCTCGAGTTCCTCCGCGAGAGGGAGTCGTGGAAGGCGCAA
AGCCGGTCGGGCCGCCCGCTGTCCCGCGGCTCGCAGCCCCGATCGTCGTCGAGCCTCAACGCGGCGACCCGCGCC
GACGACAGCACGCAGCCGTTCAAGGTCGGCGACCTGCTGCTCGACGCCGATGGCTCCGACTCGGATGCGGCAGAG
CGGCCGCGGTCGAGCAAACGGACGAGCGTCTCTCTGCCGACCGGGACGATCAGCAAGCTCGCCGGCAAGTTCGGA
GACGCCTTCAAGCGATTCGAGGGCTCCACCACGCCGGAAGCCGCCGCCGGCGGGCTGCACCGCCCCCCGTCCAAG
GGCGCCGGCCAACACGAGCTGACTCCGATCGCGGGTTCCGAGGCGACGGACGGCCGGAGCGACGACGGGCTGGTG
GAAGTCGATCCGGACAAGGCGACGCCGGAGATGAGACGCGAGATCGAGCGCCGCCAGCTGCAAGAGGAGGAGGAG
CGGGTGGCGGCCGCCCAGGCAGAGTACAGGAGGCGCGTGGCCAGCGACGGCGCCAGTTCCTCCTCCTCCTCCTCG
CGGCCGGTCCCGGGACCCAAGAAGGTGGGAGGCGTCTCGAGGGCGGCGGCGATCCAAAGCCGGGTGCAGAGCCTT
CTGGACGAGGAGCAGCGGCCGTCGCAAGTGCAGAGGACGGCCGAGGGGTACGGCAAGTACTCGGACGCGGCCACG
GCGGCCAGCAGGGACAAGGCGCTGCCGTCGATACCGCGCAAGCCGTCGGCCGCCCTGTCCAAGGCCAAGGCCAAC
CACGCCAAGGCCGAGCCGTCGCCGTCTCCGGCAGAGACGCCGACGGCATCCCGGCCGGCGGCGACGGGCAGCCGG
CCGGTGGCGCCGAGGAAGCCGGTGCACCTCAACAGCCTGCCGACGGGAGGGCGGCCGCCGTCGCCGGCCAAGCGG
AGCGAGCACCTGATGGCGGCCGAGCTGCCGGGCCGGCCGGTGCTGGAGATGTCGGCGCAGGAGAGGGACGACTAC
GTCCGGGAGTTTGCCAAGCGCTTCCCCAGCCTGAACTCGATGGAGCTGCAGGCGGCCATGAGCCGCGAGGGGGGC
GCGACGGAGCGGTAG
Gene >Hirsu2|8218
ATGGCCGGTCCCGGCCTCGCCGCGCCGCCCGGCACCTTCTCGCCCGGCACCAAGATCCAGGTCGGCGGCCACCGG
GTCGTGATCCAAAAGTACCTGTCCGAGGGCGGCTTCGCCCACGTCTACCTCGTCAAGATGGCCAAGCCCGTCGAC
GGCACCGACCTGGCCGTGCTCAAGCGCGTGGCCGTGCCGGACAAGGACGCGCTGCGCAACATGCGCACCGAGGTC
GAGACGATGAAGCGCCTCAAGGGCCACCGCCCCATCGTCACCTACATCGACTCCCACGCCTCCGAGCTCCGCGGC
GGCGGCTACGAGGTCTTCCTGCTCATGGAGTACTGCAACGGCGGCGGCCTCATCGACTTCATGAACACGCGCCTG
CAGCACCGCCTGACCGAGCCCGAGATCCTCACCATCTTCGCCGACATTGCCGAGGGCGTCGCCTGCATGCACTAC
CTCAAGCCCCCGCTCCTGCACCGCGACCTCAAGGTCGAGAACGTCCTCATCACCTCCCGCGCCTCCGCCAAGCGC
TTCAAGCTGTGCGACTTCGGCTCCGCCGCCGCCCCGCGCCCCGCGCCCACCACCGTCGTCGAGTGCCGCCTCATG
GACGAGGACGTCCAGAAGCACACGACGCTGCAGTACCGCAGCCCCGAGATGATCGACGTCTACCGGAAGCAGCCC
CTGAACGAGAAGTCGGACATCTGGGCCCTCGGCGTCCTGCTCTACAAGCTGTGCTACTACACCACCCCCTTCGAG
GACCAGGGCCAGCTGGCCATCCTCAACGCCAGCTACCGCTACCCGAGCTACCCCGTCTTTTCGGATCGCATAAAA
AAGCTGATCGGTATGCCTCCCCCGTTCCTCCCCGTTCCTCCCCGACCTCGTCAACCGACTCTCCGTCTAACCTGC
CTTCCTCAGCCTCCATGCTGCGAGAGAGCATTGACGCCCGCCCGACCATCTACCACGTTCTGAAGGAGGCTTGCG
CCATGCAGGGACGAGAAGTGCCCATCAAAAACGTGAGCACTCACGACTCTCTGCTCCCCACCCTCCCCCCCAACG
CCTAGCGAGGGCGCTGACCGTCTCTGCCATGGTAGATATACGCGGCAAGGTCGCCGACCGACTCCCGGACGCATG
ACAAGGCCTCCGGCGGTGACGCGAAAACCCGGCCTCAAGTCGTCGGCGCCGTCTTCTCCGCCCCCGTGCAGGAGC
AACAACGCATCCCCGACGTCGTCCCGATGCGGAGAGGGCGGCCGGCCAAGTCGTCAGAGCTATCCGAATCTCCCC
CGAAAAAGGTCACGGAGGGCGATCCCTTCGCCGCGTTGGACGGTCGAAATGGCAAGGGCCTCGACGCCGACGAGC
TGTCCTCTCGCTTCCCCACGCTGGACCAATTCACCCTGCTCCACGACCAGGGGGCCAAGTTCGACTTCGACTCGT
CCGCGGCCTCGCCCCCGGCAGAGGCTCCGGCCGCTGACCTGGGGCAGAGAGTGGCAGAGAGACTGGCCGATGACG
CCTTCGTGTCGCCCGAAAGCGCCCCTGCAGATCCGTTGCCATCCCCGGGACCGCACTCGGCCTCCATCGTCGGGG
CGGACCGAGTCGTCTCGCCCGTTCTCGCCAGGCCGGCGTCGGCCGCTGCGGGCGCGCGGCCGAGAACGGACCTGA
GCAAGGCGCAGACCATCATCAGCAGCAACCCAGACCTCAAGGCGATCGCGTCTCACGCGAACTCGAAATACGTTT
CGATCGGCACCATGACATCCGACATGCCCTCCGAGTCGCCGACCAGGCAGGCCGATCAGGGCCCGGGCCCCCGCC
ACCACCCGGGAAACTTGGCGCTCTCCGCCGTCCAGTCCCACTCGAGCCACGCGCGTCAGTCGTCACTCTCGTCAC
AGCGGTCGCTCGAAGACGGTCGGCCGCTCGCGTCGCCGCCGGAATCCGCCGGACGCGCCGAGATGCCGGCGATCC
GACCGCGGCCCGCCAGCACCACGTTCGAGTCGAGCACGCTCGAGTTCCTCCGCGAGAGGGAGTCGTGGAAGGCGC
AAAGCCGGTCGGGCCGCCCGCTGTCCCGCGGCTCGCAGCCCCGATCGTCGTCGAGCCTCAACGCGGCGACCCGCG
CCGACGACAGCACGCAGCCGTTCAAGGTCGGCGACCTGCTGCTCGACGCCGATGGCTCCGACTCGGATGCGGCAG
AGCGGCCGCGGTCGAGCAAACGGACGAGCGTCTCTCTGCCGACCGGGACGATCAGCAAGCTCGCCGGCAAGTTCG
GAGACGCCTTCAAGCGATTCGAGGGCTCCACCACGCCGGAAGCCGCCGCCGGCGGGCTGCACCGCCCCCCGTCCA
AGGGCGCCGGCCAACACGAGCTGACTCCGATCGCGGGTTCCGAGGCGACGGACGGCCGGAGCGACGACGGGCTGG
TGGAAGTCGATCCGGACAAGGCGACGCCGGAGATGAGACGCGAGATCGAGCGCCGCCAGCTGCAAGAGGAGGAGG
AGCGGGTGGCGGCCGCCCAGGCAGAGTACAGGAGGCGCGTGGCCAGCGACGGCGCCAGTTCCTCCTCCTCCTCCT
CGCGGCCGGTCCCGGGACCCAAGAAGGTGGGAGGCGTCTCGAGGGCGGCGGCGATCCAAAGCCGGGTGCAGAGCC
TTCTGGACGAGGAGCAGCGGCCGTCGCAAGTGCAGAGGACGGCCGAGGGGTACGGCAAGTACTCGGACGCGGCCA
CGGCGGCCAGCAGGGACAAGGCGCTGCCGTCGATACCGCGCAAGCCGTCGGCCGCCCTGTCCAAGGCCAAGGCCA
ACCACGCCAAGGCCGAGCCGTCGCCGTCTCCGGCAGAGACGCCGACGGCATCCCGGCCGGCGGCGACGGGCAGCC
GGCCGGTGGCGCCGAGGAAGCCGGTGCACCTCAACAGCCTGCCGACGGGAGGGCGGCCGCCGTCGCCGGCCAAGC
GGAGCGAGCACCTGATGGCGGCCGAGCTGCCGGGCCGGCCGGTGCTGGAGATGTCGGCGCAGGAGAGGGACGACT
ACGTCCGGGAGTTTGCCAAGCGCTTCCCCAGCCTGAACTCGATGGAGCTGCAGGCGGCCATGAGCCGCGAGGGGG
GCGCGACGGAGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail