Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|821
Gene name
LocationContig_117:33587..36161
Strand+
Gene length (bp)2574
Transcript length (bp)2265
Coding sequence length (bp)2265
Protein length (aa) 755

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01979 Amidohydro_1 Amidohydrolase family 3.3E-76 395 724
PF00449 Urease_alpha Urease alpha-subunit, N-terminal domain 9.6E-55 270 389
PF00699 Urease_beta Urease beta subunit 1.1E-40 138 234
PF00547 Urease_gamma Urease, gamma subunit 2.0E-39 1 100
PF07969 Amidohydro_3 Amidohydrolase family 6.1E-09 496 716

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6A3P9|UREA_ASPFU Urease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ure1 PE=2 SV=2 1 729 0.0E+00
sp|O00084|UREA_SCHPO Urease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ure1 PE=1 SV=1 3 729 0.0E+00
sp|P0CS22|UREA_CRYNJ Urease OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=URE1 PE=3 SV=1 1 729 0.0E+00
sp|P0CS23|UREA_CRYNB Urease OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=URE1 PE=3 SV=1 1 729 0.0E+00
sp|O13465|UREA_CRYNH Urease OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=URE1 PE=3 SV=3 1 727 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6A3P9|UREA_ASPFU Urease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ure1 PE=2 SV=2 1 729 0.0E+00
sp|O00084|UREA_SCHPO Urease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ure1 PE=1 SV=1 3 729 0.0E+00
sp|P0CS22|UREA_CRYNJ Urease OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=URE1 PE=3 SV=1 1 729 0.0E+00
sp|P0CS23|UREA_CRYNB Urease OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=URE1 PE=3 SV=1 1 729 0.0E+00
sp|O13465|UREA_CRYNH Urease OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=URE1 PE=3 SV=3 1 727 0.0E+00
sp|E0ZS48|UREA_ORYSI Urease OS=Oryza sativa subsp. indica PE=1 SV=1 1 729 0.0E+00
sp|B9GCH9|UREA_ORYSJ Urease OS=Oryza sativa subsp. japonica GN=Os12g0234800 PE=3 SV=2 1 729 0.0E+00
sp|Q9SR52|UREA_ARATH Urease OS=Arabidopsis thaliana GN=URE PE=3 SV=1 1 729 0.0E+00
sp|P07374|UREA_CANEN Urease OS=Canavalia ensiformis PE=1 SV=3 1 729 0.0E+00
sp|Q2JQ88|URE1_SYNJB Urease subunit alpha OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q11VN3|URE1_CYTH3 Urease subunit alpha OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|A4WR75|URE1_RHOS5 Urease subunit alpha OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ureC PE=3 SV=1 269 729 0.0E+00
sp|A3PL38|URE1_RHOS1 Urease subunit alpha OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ureC PE=3 SV=1 269 729 0.0E+00
sp|Q3J154|URE1_RHOS4 Urease subunit alpha OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ureC PE=3 SV=1 269 729 0.0E+00
sp|B9KK46|URE1_RHOSK Urease subunit alpha OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ureC PE=3 SV=1 269 729 0.0E+00
sp|Q9KG59|URE1_BACHD Urease subunit alpha OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q8XAG0|URE1_ECO57 Urease subunit alpha OS=Escherichia coli O157:H7 GN=ureC1 PE=3 SV=1 268 729 0.0E+00
sp|B5YUX3|URE1_ECO5E Urease subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|A6SZ07|URE1_JANMA Urease subunit alpha OS=Janthinobacterium sp. (strain Marseille) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|P17086|URE1_PROMH Urease subunit alpha OS=Proteus mirabilis (strain HI4320) GN=ureC PE=1 SV=2 271 729 0.0E+00
sp|A5FAD1|URE1_FLAJ1 Urease subunit alpha OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q0I656|URE1_SYNS3 Urease subunit alpha OS=Synechococcus sp. (strain CC9311) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q3AVR1|URE1_SYNS9 Urease subunit alpha OS=Synechococcus sp. (strain CC9902) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|B5FBC6|URE1_VIBFM Urease subunit alpha OS=Vibrio fischeri (strain MJ11) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q7U3I3|URE1_SYNPX Urease subunit alpha OS=Synechococcus sp. (strain WH8102) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A7Z9N4|URE1_BACMF Urease subunit alpha OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ureC PE=3 SV=1 270 753 0.0E+00
sp|B0JKA1|URE1_MICAN Urease subunit alpha OS=Microcystis aeruginosa (strain NIES-843) GN=ureC PE=3 SV=1 270 749 0.0E+00
sp|P16122|URE1_PROHU Urease subunit alpha OS=Proteus hauseri GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|Q3AGD0|URE1_SYNSC Urease subunit alpha OS=Synechococcus sp. (strain CC9605) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q5E728|URE1_VIBF1 Urease subunit alpha OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|A8LRS0|URE1_DINSH Urease subunit alpha OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ureC PE=3 SV=1 271 749 0.0E+00
sp|A6TE42|URE1_KLEP7 Urease subunit alpha OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ureC PE=3 SV=1 268 736 0.0E+00
sp|P18314|URE1_ENTAE Urease subunit alpha OS=Enterobacter aerogenes GN=ureC PE=1 SV=1 268 736 0.0E+00
sp|B5XU27|URE1_KLEP3 Urease subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=ureC PE=3 SV=1 268 736 0.0E+00
sp|P77837|URE1_BACSU Urease subunit alpha OS=Bacillus subtilis (strain 168) GN=ureC PE=1 SV=1 270 753 0.0E+00
sp|A5U9V6|URE1_HAEIE Urease subunit alpha OS=Haemophilus influenzae (strain PittEE) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|Q4QN09|URE1_HAEI8 Urease subunit alpha OS=Haemophilus influenzae (strain 86-028NP) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|P44391|URE1_HAEIN Urease subunit alpha OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|B8EPU9|URE1_METSB Urease subunit alpha OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|A5UH45|URE1_HAEIG Urease subunit alpha OS=Haemophilus influenzae (strain PittGG) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|C4LF63|URE1_TOLAT Urease subunit alpha OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|Q5LSQ2|URE1_RUEPO Urease subunit alpha OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|A3DGF8|URE1_CLOTH Urease subunit alpha OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q1GJP8|URE1_RUEST Urease subunit alpha OS=Ruegeria sp. (strain TM1040) GN=ureC PE=3 SV=1 269 729 0.0E+00
sp|A5GWV7|URE1_SYNR3 Urease subunit alpha OS=Synechococcus sp. (strain RCC307) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q117Z3|URE1_TRIEI Urease subunit alpha OS=Trichodesmium erythraeum (strain IMS101) GN=ureC PE=3 SV=1 270 749 0.0E+00
sp|A4WEJ5|URE1_ENT38 Urease subunit alpha OS=Enterobacter sp. (strain 638) GN=ureC PE=3 SV=1 268 736 0.0E+00
sp|A9GP84|URE1_SORC5 Urease subunit alpha OS=Sorangium cellulosum (strain So ce56) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|Q5KYM1|URE1_GEOKA Urease subunit alpha OS=Geobacillus kaustophilus (strain HTA426) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|B4RSX9|URE1_ALTMD Urease subunit alpha OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=ureC PE=3 SV=1 268 749 0.0E+00
sp|O87402|URE1_SYNPV Urease subunit alpha OS=Synechococcus sp. (strain WH7805) GN=ureC PE=1 SV=1 270 729 0.0E+00
sp|Q161S8|URE1_ROSDO Urease subunit alpha OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ureC PE=3 SV=1 270 749 0.0E+00
sp|Q89UG0|URE1_BRADU Urease subunit alpha OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ureC PE=3 SV=1 269 729 0.0E+00
sp|Q210F9|URE1_RHOPB Urease subunit alpha OS=Rhodopseudomonas palustris (strain BisB18) GN=ureC PE=3 SV=1 269 729 0.0E+00
sp|A3N2R4|URE1_ACTP2 Urease subunit alpha OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|B3H2L3|URE1_ACTP7 Urease subunit alpha OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|A0L6F2|URE1_MAGMM Urease subunit alpha OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|Q47G55|URE1_DECAR Urease subunit alpha OS=Dechloromonas aromatica (strain RCB) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|B0BRU2|URE1_ACTPJ Urease subunit alpha OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|P41020|URE1_SPOPA Urease subunit alpha OS=Sporosarcina pasteurii GN=ureC PE=1 SV=1 269 736 0.0E+00
sp|Q11EW4|URE1_CHESB Urease subunit alpha OS=Chelativorans sp. (strain BNC1) GN=ureC PE=3 SV=1 269 729 0.0E+00
sp|Q5FB23|URE1_CAMLA Urease subunit beta OS=Campylobacter lari GN=ureB PE=3 SV=1 268 729 0.0E+00
sp|C3MGI5|URE1_RHISN Urease subunit alpha OS=Rhizobium sp. (strain NGR234) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|B9JR81|URE1_AGRVS Urease subunit alpha OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|O54420|URE1_ACTPL Urease subunit alpha OS=Actinobacillus pleuropneumoniae GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|A6VTV8|URE1_MARMS Urease subunit alpha OS=Marinomonas sp. (strain MWYL1) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|A8APV0|URE1_CITK8 Urease subunit alpha OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ureC PE=3 SV=1 268 736 0.0E+00
sp|A6UC35|URE1_SINMW Urease subunit alpha OS=Sinorhizobium medicae (strain WSM419) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q492E9|URE1_BLOPB Urease subunit alpha OS=Blochmannia pennsylvanicus (strain BPEN) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|Q8XXT1|URE1_RALSO Urease subunit alpha OS=Ralstonia solanacearum (strain GMI1000) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q07397|URE1_BACSB Urease subunit alpha OS=Bacillus sp. (strain TB-90) GN=ureC PE=1 SV=1 271 729 0.0E+00
sp|Q07K73|URE1_RHOP5 Urease subunit alpha OS=Rhodopseudomonas palustris (strain BisA53) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q46IY3|URE1_PROMT Urease subunit alpha OS=Prochlorococcus marinus (strain NATL2A) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A2C4S2|URE1_PROM1 Urease subunit alpha OS=Prochlorococcus marinus (strain NATL1A) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A3PCP1|URE1_PROM0 Urease subunit alpha OS=Prochlorococcus marinus (strain MIT 9301) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|B4UFU2|URE1_ANASK Urease subunit alpha OS=Anaeromyxobacter sp. (strain K) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|B9J8M3|URE1_AGRRK Urease subunit alpha OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q3IH68|URE1_PSEHT Urease subunit alpha OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ureC PE=3 SV=1 270 750 0.0E+00
sp|P42885|URE1_RHIME Urease subunit alpha OS=Rhizobium meliloti (strain 1021) GN=ureC PE=3 SV=2 270 729 0.0E+00
sp|A7HHN1|URE1_ANADF Urease subunit alpha OS=Anaeromyxobacter sp. (strain Fw109-5) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A1U4Z8|URE1_MARHV Urease subunit alpha OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q28RJ3|URE1_JANSC Urease subunit alpha OS=Jannaschia sp. (strain CCS1) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|C5BUN9|URE1_TERTT Urease subunit alpha OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|B5ZMP0|URE1_RHILW Urease subunit alpha OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q1MCV9|URE1_RHIL3 Urease subunit alpha OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|B3PXB3|URE1_RHIE6 Urease subunit alpha OS=Rhizobium etli (strain CIAT 652) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|B4ECC7|URE1_BURCJ Urease subunit alpha OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A2BQW8|URE1_PROMS Urease subunit alpha OS=Prochlorococcus marinus (strain AS9601) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A0K576|URE1_BURCH Urease subunit alpha OS=Burkholderia cenocepacia (strain HI2424) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|B1JX29|URE1_BURCC Urease subunit alpha OS=Burkholderia cenocepacia (strain MC0-3) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q1BYH2|URE1_BURCA Urease subunit alpha OS=Burkholderia cenocepacia (strain AU 1054) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|B6YQL8|URE1_AZOPC Urease subunit alpha OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q2K517|URE1_RHIEC Urease subunit alpha OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q1H0F2|URE1_METFK Urease subunit alpha OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=ureC PE=3 SV=1 269 729 0.0E+00
sp|Q31B49|URE1_PROM9 Urease subunit alpha OS=Prochlorococcus marinus (strain MIT 9312) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q7V3V2|URE1_PROMM Urease subunit alpha OS=Prochlorococcus marinus (strain MIT 9313) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A9AF72|URE1_BURM1 Urease subunit alpha OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A8G4K9|URE1_PROM2 Urease subunit alpha OS=Prochlorococcus marinus (strain MIT 9215) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q0BHN5|URE1_BURCM Urease subunit alpha OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q39IW3|URE1_BURL3 Urease subunit alpha OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|B3QGK1|URE1_RHOPT Urease subunit alpha OS=Rhodopseudomonas palustris (strain TIE-1) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A4JC42|URE1_BURVG Urease subunit alpha OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q133L6|URE1_RHOPS Urease subunit alpha OS=Rhodopseudomonas palustris (strain BisB5) GN=ureC PE=3 SV=1 269 729 0.0E+00
sp|A1KBB4|URE1_AZOSB Urease subunit alpha OS=Azoarcus sp. (strain BH72) GN=ureC PE=3 SV=1 268 724 0.0E+00
sp|Q6N3N3|URE1_RHOPA Urease subunit alpha OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A2CE01|URE1_PROM3 Urease subunit alpha OS=Prochlorococcus marinus (strain MIT 9303) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q8G2P8|URE11_BRUSU Urease subunit alpha 1 OS=Brucella suis biovar 1 (strain 1330) GN=ureC1 PE=1 SV=1 269 729 0.0E+00
sp|Q93T81|URE11_BRUAB Urease subunit alpha 1 OS=Brucella abortus biovar 1 (strain 9-941) GN=ureC1 PE=3 SV=1 269 729 0.0E+00
sp|Q2YPD5|URE11_BRUA2 Urease subunit alpha 1 OS=Brucella abortus (strain 2308) GN=ureC1 PE=1 SV=1 269 729 0.0E+00
sp|Q08716|URE1_HELFC Urease subunit beta OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=ureB PE=1 SV=2 270 750 0.0E+00
sp|Q98CY9|URE1_RHILO Urease subunit alpha OS=Rhizobium loti (strain MAFF303099) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|B1YUF9|URE1_BURA4 Urease subunit alpha OS=Burkholderia ambifaria (strain MC40-6) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|B1Y3V1|URE1_LEPCP Urease subunit alpha OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|P73061|URE1_SYNY3 Urease subunit alpha OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q1IBP0|URE1_PSEE4 Urease subunit alpha OS=Pseudomonas entomophila (strain L48) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q21P94|URE1_SACD2 Urease subunit alpha OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q3KIT2|URE1_PSEPF Urease subunit alpha OS=Pseudomonas fluorescens (strain Pf0-1) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q8UCT2|URE1_AGRFC Urease subunit alpha OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q8YF72|URE11_BRUME Urease subunit alpha 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ureC1 PE=3 SV=1 269 729 0.0E+00
sp|B1J815|URE1_PSEPW Urease subunit alpha OS=Pseudomonas putida (strain W619) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|B0KUZ7|URE1_PSEPG Urease subunit alpha OS=Pseudomonas putida (strain GB-1) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q2SYF7|URE1_BURTA Urease subunit alpha OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|Q6FD83|URE1_ACIAD Urease subunit alpha OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ureC PE=3 SV=1 270 736 0.0E+00
sp|Q87VP0|URE1_PSESM Urease subunit alpha OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q3J770|URE1_NITOC Urease subunit alpha OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A1B1B9|URE1_PARDP Urease subunit alpha OS=Paracoccus denitrificans (strain Pd 1222) GN=ureC PE=3 SV=1 271 753 0.0E+00
sp|Q48DE6|URE1_PSE14 Urease subunit alpha OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q0KCP6|URE1_CUPNH Urease subunit alpha OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q88J04|URE1_PSEPK Urease subunit alpha OS=Pseudomonas putida (strain KT2440) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|A5W4B6|URE1_PSEP1 Urease subunit alpha OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q3M712|URE1_ANAVT Urease subunit alpha OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q4ZN06|URE12_PSEU2 Urease subunit alpha 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ureC2 PE=3 SV=1 270 729 0.0E+00
sp|Q2IZ49|URE1_RHOP2 Urease subunit alpha OS=Rhodopseudomonas palustris (strain HaA2) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q1QCE0|URE11_PSYCK Urease subunit alpha 1 OS=Psychrobacter cryohalolentis (strain K5) GN=ureC1 PE=3 SV=1 270 750 0.0E+00
sp|Q8YQZ0|URE1_NOSS1 Urease subunit alpha OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q4KJ10|URE1_PSEF5 Urease subunit alpha OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A1V1G6|URE1_BURMS Urease subunit alpha OS=Burkholderia mallei (strain SAVP1) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q62HS0|URE1_BURMA Urease subunit alpha OS=Burkholderia mallei (strain ATCC 23344) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A2S996|URE1_BURM9 Urease subunit alpha OS=Burkholderia mallei (strain NCTC 10229) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A3MMV2|URE1_BURM7 Urease subunit alpha OS=Burkholderia mallei (strain NCTC 10247) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|B1ZP06|URE1_OPITP Urease subunit alpha OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A3NYC9|URE1_BURP0 Urease subunit alpha OS=Burkholderia pseudomallei (strain 1106a) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|B2IT66|URE1_NOSP7 Urease subunit alpha OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ureC PE=3 SV=1 270 749 0.0E+00
sp|Q9HUU5|URE1_PSEAE Urease subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A3NCL7|URE1_BURP6 Urease subunit alpha OS=Burkholderia pseudomallei (strain 668) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q63RL3|URE1_BURPS Urease subunit alpha OS=Burkholderia pseudomallei (strain K96243) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A8ESZ8|URE1_ARCB4 Urease subunit beta OS=Arcobacter butzleri (strain RM4018) GN=ureB PE=3 SV=1 270 729 0.0E+00
sp|B8HW50|URE1_CYAP4 Urease subunit alpha OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|Q3JPJ6|URE1_BURP1 Urease subunit alpha OS=Burkholderia pseudomallei (strain 1710b) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|Q2SDQ1|URE1_HAHCH Urease subunit alpha OS=Hahella chejuensis (strain KCTC 2396) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q9L644|URE1_PROS9 Urease subunit alpha OS=Prochlorococcus marinus subsp. pastoris (strain PCC 9511) GN=ureC PE=1 SV=1 270 729 0.0E+00
sp|Q7V1B6|URE1_PROMP Urease subunit alpha OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q1QC36|URE12_PSYCK Urease subunit alpha 2 OS=Psychrobacter cryohalolentis (strain K5) GN=ureC2 PE=3 SV=2 270 749 0.0E+00
sp|A9BUC4|URE1_DELAS Urease subunit alpha OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q473Q9|URE1_CUPPJ Urease subunit alpha OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|B8HA07|URE1_ARTCA Urease subunit alpha OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q8DMV6|URE1_THEEB Urease subunit alpha OS=Thermosynechococcus elongatus (strain BP-1) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A4XMA9|URE1_CALS8 Urease subunit alpha OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A4SY44|URE1_POLSQ Urease subunit alpha OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=ureC PE=3 SV=1 268 754 0.0E+00
sp|B2GI06|URE1_KOCRD Urease subunit alpha OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=ureC PE=3 SV=1 270 751 0.0E+00
sp|Q9RYJ4|URE1_DEIRA Urease subunit alpha OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A1SYY1|URE1_PSYIN Urease subunit alpha OS=Psychromonas ingrahamii (strain 37) GN=ureC PE=3 SV=1 271 749 0.0E+00
sp|Q9FCD3|URE11_STRCO Urease subunit alpha 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ureC1 PE=3 SV=1 270 729 0.0E+00
sp|Q733J6|URE1_BACC1 Urease subunit alpha OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q7VRS6|URE1_BLOFL Urease subunit alpha OS=Blochmannia floridanus GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|Q0VKY1|URE1_ALCBS Urease subunit alpha OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|B2IIJ1|URE1_BEII9 Urease subunit alpha OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|B2UW70|URE1_HELPS Urease subunit beta OS=Helicobacter pylori (strain Shi470) GN=ureB PE=3 SV=1 270 753 0.0E+00
sp|Q826R9|URE12_STRAW Urease subunit alpha 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ureC2 PE=3 SV=1 270 729 0.0E+00
sp|Q1CV82|URE1_HELPH Urease subunit beta OS=Helicobacter pylori (strain HPAG1) GN=ureB PE=3 SV=1 270 753 0.0E+00
sp|A0JRH4|URE1_ARTS2 Urease subunit alpha OS=Arthrobacter sp. (strain FB24) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|A9AZE6|URE1_HERA2 Urease subunit alpha OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|A9KJR9|URE1_CLOPH Urease subunit alpha OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ureC PE=3 SV=1 273 729 0.0E+00
sp|C5C8U3|URE1_MICLC Urease subunit alpha OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=ureC PE=3 SV=1 270 726 0.0E+00
sp|Q8FQX2|URE1_COREF Urease subunit alpha OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q2JWP0|URE1_SYNJA Urease subunit alpha OS=Synechococcus sp. (strain JA-3-3Ab) GN=ureC PE=3 SV=1 269 729 0.0E+00
sp|P69996|URE1_HELPY Urease subunit beta OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ureB PE=1 SV=1 270 753 0.0E+00
sp|P69997|URE1_HELPJ Urease subunit beta OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ureB PE=3 SV=1 270 753 0.0E+00
sp|B5Z674|URE1_HELPG Urease subunit beta OS=Helicobacter pylori (strain G27) GN=ureB PE=3 SV=1 270 753 0.0E+00
sp|B6JPH5|URE1_HELP2 Urease subunit beta OS=Helicobacter pylori (strain P12) GN=ureB PE=3 SV=1 270 753 0.0E+00
sp|P42823|URE1_HELHE Urease subunit beta OS=Helicobacter heilmannii GN=ureB PE=3 SV=1 270 750 0.0E+00
sp|Q93PJ4|URE1_HELHP Urease subunit beta OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=ureB PE=2 SV=1 268 729 0.0E+00
sp|B7K912|URE1_CYAP7 Urease subunit alpha OS=Cyanothece sp. (strain PCC 7424) GN=ureC PE=3 SV=1 271 749 0.0E+00
sp|A1VKW3|URE1_POLNA Urease subunit alpha OS=Polaromonas naphthalenivorans (strain CJ2) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|A1R1C5|URE1_ARTAT Urease subunit alpha OS=Arthrobacter aurescens (strain TC1) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q2Y9M7|URE1_NITMU Urease subunit alpha OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|B0TT71|URE1_SHEHH Urease subunit alpha OS=Shewanella halifaxensis (strain HAW-EB4) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|A1TSZ6|URE1_ACIAC Urease subunit alpha OS=Acidovorax citrulli (strain AAC00-1) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q8CNC9|URE1_STAES Urease subunit alpha OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ureC PE=3 SV=1 269 724 0.0E+00
sp|Q5HLW1|URE1_STAEQ Urease subunit alpha OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ureC PE=3 SV=1 269 724 0.0E+00
sp|Q12DU3|URE1_POLSJ Urease subunit alpha OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|P67405|URE1_STAAW Urease subunit alpha OS=Staphylococcus aureus (strain MW2) GN=ureC PE=3 SV=1 270 727 0.0E+00
sp|A8Z387|URE1_STAAT Urease subunit alpha OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ureC PE=3 SV=1 270 727 0.0E+00
sp|Q6G732|URE1_STAAS Urease subunit alpha OS=Staphylococcus aureus (strain MSSA476) GN=ureC PE=3 SV=1 270 727 0.0E+00
sp|P67404|URE1_STAAN Urease subunit alpha OS=Staphylococcus aureus (strain N315) GN=ureC PE=1 SV=1 270 727 0.0E+00
sp|P67403|URE1_STAAM Urease subunit alpha OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ureC PE=3 SV=1 270 727 0.0E+00
sp|A6QJD0|URE1_STAAE Urease subunit alpha OS=Staphylococcus aureus (strain Newman) GN=ureC PE=3 SV=1 270 727 0.0E+00
sp|Q5HDR8|URE1_STAAC Urease subunit alpha OS=Staphylococcus aureus (strain COL) GN=ureC PE=3 SV=1 270 727 0.0E+00
sp|Q2G2K5|URE1_STAA8 Urease subunit alpha OS=Staphylococcus aureus (strain NCTC 8325) GN=ureC PE=3 SV=1 270 727 0.0E+00
sp|Q2FEK3|URE1_STAA3 Urease subunit alpha OS=Staphylococcus aureus (strain USA300) GN=ureC PE=3 SV=1 270 727 0.0E+00
sp|A7X5M3|URE1_STAA1 Urease subunit alpha OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ureC PE=3 SV=1 270 727 0.0E+00
sp|Q4A0J5|URE1_STAS1 Urease subunit alpha OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ureC PE=1 SV=3 270 727 0.0E+00
sp|A5IV71|URE1_STAA9 Urease subunit alpha OS=Staphylococcus aureus (strain JH9) GN=ureC PE=3 SV=1 270 727 0.0E+00
sp|A6U414|URE1_STAA2 Urease subunit alpha OS=Staphylococcus aureus (strain JH1) GN=ureC PE=3 SV=1 270 727 0.0E+00
sp|Q6GEE4|URE1_STAAR Urease subunit alpha OS=Staphylococcus aureus (strain MRSA252) GN=ureC PE=3 SV=1 270 727 0.0E+00
sp|Q2YYQ6|URE1_STAAB Urease subunit alpha OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ureC PE=3 SV=1 270 727 0.0E+00
sp|Q7W417|URE1_BORPA Urease subunit alpha OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ureC PE=3 SV=1 268 749 0.0E+00
sp|A2SDJ0|URE1_METPP Urease subunit alpha OS=Methylibium petroleiphilum (strain PM1) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|Q7VUD3|URE1_BORPE Urease subunit alpha OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ureC PE=3 SV=1 268 749 0.0E+00
sp|Q0RQS0|URE1_FRAAA Urease subunit alpha OS=Frankia alni (strain ACN14a) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q2JES6|URE1_FRASC Urease subunit alpha OS=Frankia sp. (strain CcI3) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|A8L7B0|URE1_FRASN Urease subunit alpha OS=Frankia sp. (strain EAN1pec) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|O08400|URE1_BORBR Urease subunit alpha OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ureC PE=3 SV=2 268 749 0.0E+00
sp|C5CY00|URE1_VARPS Urease subunit alpha OS=Variovorax paradoxus (strain S110) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|P42873|URE1_STAXY Urease subunit alpha OS=Staphylococcus xylosus GN=ureC PE=1 SV=3 270 724 0.0E+00
sp|A1T9N4|URE1_MYCVP Urease subunit alpha OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|A1WIM3|URE1_VEREI Urease subunit alpha OS=Verminephrobacter eiseniae (strain EF01-2) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q21SZ2|URE1_RHOFT Urease subunit alpha OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|B1VHT2|URE1_CORU7 Urease subunit alpha OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q1B872|URE1_MYCSS Urease subunit alpha OS=Mycobacterium sp. (strain MCS) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|A1UGT5|URE1_MYCSK Urease subunit alpha OS=Mycobacterium sp. (strain KMS) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|A3Q0D5|URE1_MYCSJ Urease subunit alpha OS=Mycobacterium sp. (strain JLS) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|P0CB00|URE1_UREUR Urease subunit alpha OS=Ureaplasma urealyticum GN=ureC PE=1 SV=1 268 749 0.0E+00
sp|B5ZBS9|URE1_UREU1 Urease subunit alpha OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=ureC PE=3 SV=1 268 749 0.0E+00
sp|Q79VJ3|URE1_CORGL Urease subunit alpha OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ureC PE=1 SV=1 270 729 0.0E+00
sp|P0C7K7|URE1_UREPA Urease subunit alpha OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=ureC PE=3 SV=1 268 749 0.0E+00
sp|B1AJ73|URE1_UREP2 Urease subunit alpha OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=ureC PE=3 SV=1 268 749 0.0E+00
sp|A0QYE0|URE1_MYCS2 Urease subunit alpha OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q0S4S7|URE1_RHOJR Urease subunit alpha OS=Rhodococcus jostii (strain RHA1) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|P9WFF1|URE1_MYCTU Urease subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ureC PE=1 SV=1 268 729 0.0E+00
sp|P9WFF0|URE1_MYCTO Urease subunit alpha OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|A5U3L7|URE1_MYCTA Urease subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|C1APC7|URE1_MYCBT Urease subunit alpha OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|A1KJR2|URE1_MYCBP Urease subunit alpha OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|P0A661|URE1_MYCBO Urease subunit alpha OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q5YWR8|URE1_NOCFA Urease subunit alpha OS=Nocardia farcinica (strain IFM 10152) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|B2HSZ2|URE1_MYCMM Urease subunit alpha OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|C5BBR6|URE1_EDWI9 Urease subunit alpha OS=Edwardsiella ictaluri (strain 93-146) GN=ureC PE=3 SV=1 270 736 0.0E+00
sp|C1AXZ2|URE1_RHOOB Urease subunit alpha OS=Rhodococcus opacus (strain B4) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|B1MB85|URE1_MYCA9 Urease subunit alpha OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q3IRZ5|URE1_NATPD Urease subunit alpha OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ureC PE=3 SV=1 273 754 0.0E+00
sp|B9DLY0|URE1_STACT Urease subunit alpha OS=Staphylococcus carnosus (strain TM300) GN=ureC PE=3 SV=1 269 727 0.0E+00
sp|Q03ME3|URE1_STRTD Urease subunit alpha OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|C1D5Z8|URE1_LARHH Urease subunit alpha OS=Laribacter hongkongensis (strain HLHK9) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|Q5M607|URE1_STRT2 Urease subunit alpha OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q5M1G6|URE1_STRT1 Urease subunit alpha OS=Streptococcus thermophilus (strain CNRZ 1066) GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q7N4Y7|URE1_PHOLL Urease subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ureC PE=3 SV=1 271 729 0.0E+00
sp|A0PSG2|URE1_MYCUA Urease subunit alpha OS=Mycobacterium ulcerans (strain Agy99) GN=ureC PE=3 SV=1 268 729 0.0E+00
sp|P50047|URE1_STRE5 Urease subunit alpha OS=Streptococcus salivarius (strain 57.I) GN=ureC PE=1 SV=3 270 729 0.0E+00
sp|Q8YHZ8|URE12_BRUME Urease subunit alpha 2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ureC2 PE=3 SV=1 268 729 0.0E+00
sp|Q8FZW2|URE12_BRUSU Urease subunit alpha 2 OS=Brucella suis biovar 1 (strain 1330) GN=ureC2 PE=3 SV=1 268 729 0.0E+00
sp|P94669|URE1_CLOPF Urease subunit alpha OS=Clostridium perfringens GN=ureC PE=3 SV=1 270 729 0.0E+00
sp|Q75ZQ5|URE1_HALMA Urease subunit alpha OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=ureC PE=3 SV=1 271 754 0.0E+00
sp|P31494|URE1_YEREN Urease subunit alpha OS=Yersinia enterocolitica GN=ureC PE=3 SV=3 270 749 0.0E+00
sp|A1JKD9|URE1_YERE8 Urease subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ureC PE=3 SV=1 270 749 0.0E+00
sp|Q57CE8|URE12_BRUAB Urease subunit alpha 2 OS=Brucella abortus biovar 1 (strain 9-941) GN=ureC2 PE=3 SV=1 268 729 0.0E+00
sp|Q2YQD8|URE12_BRUA2 Urease subunit alpha 2 OS=Brucella abortus (strain 2308) GN=ureC2 PE=3 SV=1 268 729 0.0E+00
sp|Q4ZUD2|URE11_PSEU2 Urease subunit alpha 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ureC1 PE=3 SV=1 273 749 0.0E+00
sp|P26929|URE1_LACFE Urease subunit alpha OS=Lactobacillus fermentum GN=ureC PE=3 SV=1 271 726 0.0E+00
sp|B1JR71|URE1_YERPY Urease subunit alpha OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ureC PE=3 SV=1 270 749 0.0E+00
sp|P52313|URE1_YERPS Urease subunit alpha OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ureC PE=3 SV=3 270 749 0.0E+00
sp|A4TL32|URE1_YERPP Urease subunit alpha OS=Yersinia pestis (strain Pestoides F) GN=ureC PE=3 SV=1 270 749 0.0E+00
sp|Q1CKJ9|URE1_YERPN Urease subunit alpha OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ureC PE=3 SV=1 270 749 0.0E+00
sp|A9R3V0|URE1_YERPG Urease subunit alpha OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ureC PE=3 SV=1 270 749 0.0E+00
sp|Q9ZFR9|URE1_YERPE Urease subunit alpha OS=Yersinia pestis GN=ureC PE=3 SV=3 270 749 0.0E+00
sp|B2KAA4|URE1_YERPB Urease subunit alpha OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ureC PE=3 SV=1 270 749 0.0E+00
sp|Q1C5B3|URE1_YERPA Urease subunit alpha OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ureC PE=3 SV=1 270 749 0.0E+00
sp|A7FFN2|URE1_YERP3 Urease subunit alpha OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ureC PE=3 SV=1 270 749 0.0E+00
sp|Q18EB9|URE1_HALWD Urease subunit alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=ureC PE=3 SV=1 270 754 0.0E+00
sp|Q972W0|URE1_SULTO Urease subunit alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=ureC PE=3 SV=2 269 729 1.0E-170
sp|Q82JN9|URE11_STRAW Urease subunit alpha 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ureC1 PE=3 SV=1 275 726 3.0E-129
sp|O86508|URE12_STRCO Urease subunit alpha 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ureC2 PE=3 SV=1 271 726 8.0E-129
sp|P50045|URE1_HELMU Urease subunit beta (Fragment) OS=Helicobacter mustelae GN=ureB PE=3 SV=1 268 576 2.0E-119
sp|P50046|URE1_PHODD Urease subunit alpha (Fragment) OS=Photobacterium damselae subsp. damselae GN=ureC PE=3 SV=1 361 515 7.0E-62
sp|Q93PJ5|URE23_HELHP Urease subunit alpha OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=ureA PE=3 SV=1 1 255 8.0E-59
sp|Q08715|URE23_HELFE Urease subunit alpha OS=Helicobacter felis GN=ureA PE=3 SV=1 1 231 8.0E-57
sp|P42822|URE23_HELHE Urease subunit alpha OS=Helicobacter heilmannii GN=ureA PE=3 SV=1 1 231 5.0E-56
sp|Q8GH98|URE23_HELBI Urease subunit alpha OS=Helicobacter bizzozeronii GN=ureA PE=3 SV=1 1 231 7.0E-55
sp|P50044|URE23_HELMU Urease subunit alpha (Fragment) OS=Helicobacter mustelae GN=ureA PE=3 SV=1 17 236 6.0E-52
sp|Q5FB24|URE23_CAMLA Urease subunit alpha OS=Campylobacter lari GN=ureA PE=3 SV=1 1 253 3.0E-50
sp|Q17VS7|URE23_HELAH Urease subunit alpha OS=Helicobacter acinonychis (strain Sheeba) GN=ureA PE=3 SV=1 1 231 2.0E-49
sp|Q9RYJ3|URE23_DEIRA Urease subunit gamma/beta OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ureAB PE=3 SV=1 1 237 6.0E-49
sp|Q4ZUD1|URE23_PSEU2 Urease subunit gamma/beta OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ureAB PE=3 SV=1 1 234 1.0E-48
sp|P14916|URE23_HELPY Urease subunit alpha OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ureA PE=1 SV=2 1 231 9.0E-48
sp|Q1CV81|URE23_HELPH Urease subunit alpha OS=Helicobacter pylori (strain HPAG1) GN=ureA PE=3 SV=1 1 231 9.0E-48
sp|B6JPH6|URE23_HELP2 Urease subunit alpha OS=Helicobacter pylori (strain P12) GN=ureA PE=3 SV=1 1 231 9.0E-48
sp|Q9ZMZ4|URE23_HELPJ Urease subunit alpha OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ureA PE=3 SV=1 1 231 1.0E-47
sp|B2UW71|URE23_HELPS Urease subunit alpha OS=Helicobacter pylori (strain Shi470) GN=ureA PE=3 SV=1 1 231 2.0E-47
sp|Q972V9|URE23_SULTO Urease subunit gamma/beta OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=ureAB PE=3 SV=2 1 254 3.0E-46
sp|Q883F3|URE23_PSESM Urease subunit gamma/beta OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ureAB PE=3 SV=1 1 234 3.0E-45
sp|A3DGF9|URE2_CLOTH Urease subunit beta OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ureB PE=3 SV=1 138 253 1.0E-31
sp|Q75ZQ6|URE2_HALMA Urease subunit beta OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=ureB PE=3 SV=1 138 270 1.0E-29
sp|O86507|URE23_STRCO Urease subunit gamma/beta OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ureAB PE=3 SV=1 1 253 2.0E-29
sp|A7Z9N5|URE2_BACMF Urease subunit beta OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ureB PE=3 SV=1 137 256 3.0E-29
sp|P08298|UREA_SOYBN Urease (Fragment) OS=Glycine max PE=3 SV=1 640 729 5.0E-29
sp|A0L6F1|URE2_MAGMM Urease subunit beta OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ureB PE=3 SV=1 138 237 1.0E-28
sp|Q9KG60|URE2_BACHD Urease subunit beta OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ureB PE=3 SV=1 138 251 2.0E-28
sp|P42874|URE2_STAXY Urease subunit beta OS=Staphylococcus xylosus GN=ureB PE=1 SV=1 137 241 2.0E-28
sp|A4QA22|URE2_CORGB Urease subunit beta OS=Corynebacterium glutamicum (strain R) GN=ureB PE=3 SV=1 138 265 3.0E-28
sp|Q79VJ4|URE2_CORGL Urease subunit beta OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ureB PE=1 SV=1 138 265 5.0E-28
sp|Q07398|URE2_BACSB Urease subunit beta OS=Bacillus sp. (strain TB-90) GN=ureB PE=1 SV=1 138 237 6.0E-28
sp|Q82JN8|URE23_STRAW Urease subunit gamma/beta OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ureAB PE=3 SV=1 1 253 8.0E-28
sp|Q7V3V3|URE2_PROMM Urease subunit beta OS=Prochlorococcus marinus (strain MIT 9313) GN=ureB PE=3 SV=1 133 237 1.0E-27
sp|P74386|URE2_SYNY3 Urease subunit beta OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ureB PE=3 SV=1 138 237 2.0E-27
sp|Q63RL4|URE2_BURPS Urease subunit beta OS=Burkholderia pseudomallei (strain K96243) GN=ureB PE=3 SV=1 138 236 2.0E-27
sp|Q3JPJ7|URE2_BURP1 Urease subunit beta OS=Burkholderia pseudomallei (strain 1710b) GN=ureB PE=3 SV=2 138 236 2.0E-27
sp|A3NYC8|URE2_BURP0 Urease subunit beta OS=Burkholderia pseudomallei (strain 1106a) GN=ureB PE=3 SV=1 138 236 2.0E-27
sp|A1V1G7|URE2_BURMS Urease subunit beta OS=Burkholderia mallei (strain SAVP1) GN=ureB PE=3 SV=1 138 236 2.0E-27
sp|Q62HS1|URE2_BURMA Urease subunit beta OS=Burkholderia mallei (strain ATCC 23344) GN=ureB PE=3 SV=1 138 236 2.0E-27
sp|A2S997|URE2_BURM9 Urease subunit beta OS=Burkholderia mallei (strain NCTC 10229) GN=ureB PE=3 SV=1 138 236 2.0E-27
sp|A3MMV1|URE2_BURM7 Urease subunit beta OS=Burkholderia mallei (strain NCTC 10247) GN=ureB PE=3 SV=1 138 236 2.0E-27
sp|B3QGK3|URE2_RHOPT Urease subunit beta OS=Rhodopseudomonas palustris (strain TIE-1) GN=ureB PE=3 SV=1 138 227 2.0E-27
sp|Q210F6|URE2_RHOPB Urease subunit beta OS=Rhodopseudomonas palustris (strain BisB18) GN=ureB PE=3 SV=1 138 227 2.0E-27
sp|B2GI07|URE2_KOCRD Urease subunit beta OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=ureB PE=3 SV=1 138 238 2.0E-27
sp|Q4A0J4|URE2_STAS1 Urease subunit beta OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ureB PE=1 SV=1 137 241 2.0E-27
sp|A3NCL6|URE2_BURP6 Urease subunit beta OS=Burkholderia pseudomallei (strain 668) GN=ureB PE=3 SV=1 138 236 3.0E-27
sp|Q6N3N1|URE2_RHOPA Urease subunit beta OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ureB PE=3 SV=1 138 227 3.0E-27
sp|A4YM26|URE2_BRASO Urease subunit beta OS=Bradyrhizobium sp. (strain ORS278) GN=ureB PE=3 SV=1 138 227 4.0E-27
sp|Q133L3|URE2_RHOPS Urease subunit beta OS=Rhodopseudomonas palustris (strain BisB5) GN=ureB PE=3 SV=1 138 227 5.0E-27
sp|A5ERV2|URE2_BRASB Urease subunit beta OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ureB PE=3 SV=1 138 227 6.0E-27
sp|Q8FZW3|URE22_BRUSU Urease subunit beta 2 OS=Brucella suis biovar 1 (strain 1330) GN=ureB2 PE=3 SV=1 119 234 6.0E-27
sp|Q8YHZ7|URE22_BRUME Urease subunit beta 2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ureB2 PE=3 SV=1 119 234 7.0E-27
sp|Q57CE9|URE22_BRUAB Urease subunit beta 2 OS=Brucella abortus biovar 1 (strain 9-941) GN=ureB2 PE=3 SV=1 119 234 7.0E-27
sp|Q2YQD9|URE22_BRUA2 Urease subunit beta 2 OS=Brucella abortus (strain 2308) GN=ureB2 PE=3 SV=1 119 234 7.0E-27
sp|Q5LSQ3|URE2_RUEPO Urease subunit beta OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ureB PE=3 SV=1 138 234 1.0E-26
sp|Q2IZ51|URE2_RHOP2 Urease subunit beta OS=Rhodopseudomonas palustris (strain HaA2) GN=ureB PE=3 SV=1 138 227 1.0E-26
sp|B5ZMP3|URE2_RHILW Urease subunit beta OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ureB PE=3 SV=1 138 234 1.0E-26
sp|C4LF64|URE2_TOLAT Urease subunit beta OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ureB PE=3 SV=1 138 237 1.0E-26
sp|Q21P95|URE2_SACD2 Urease subunit beta OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ureB PE=3 SV=1 137 227 1.0E-26
sp|Q473R0|URE2_CUPPJ Urease subunit beta OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ureB PE=3 SV=1 138 229 1.0E-26
sp|Q18EC0|URE2_HALWD Urease subunit beta OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=ureB PE=3 SV=1 138 237 2.0E-26
sp|Q8DLZ6|URE2_THEEB Urease subunit beta OS=Thermosynechococcus elongatus (strain BP-1) GN=ureB PE=3 SV=1 138 227 2.0E-26
sp|A2CE00|URE2_PROM3 Urease subunit beta OS=Prochlorococcus marinus (strain MIT 9303) GN=ureB PE=3 SV=1 133 237 2.0E-26
sp|B3PXB6|URE2_RHIE6 Urease subunit beta OS=Rhizobium etli (strain CIAT 652) GN=ureB PE=3 SV=1 138 234 2.0E-26
sp|Q3J151|URE2_RHOS4 Urease subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ureB PE=3 SV=1 138 229 2.0E-26
sp|A3PL41|URE2_RHOS1 Urease subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ureB PE=3 SV=1 138 229 2.0E-26
sp|Q47G54|URE2_DECAR Urease subunit beta OS=Dechloromonas aromatica (strain RCB) GN=ureB PE=3 SV=1 138 234 3.0E-26
sp|Q89UG2|URE2_BRADU Urease subunit beta OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ureB PE=3 SV=1 138 227 3.0E-26
sp|B8EPV0|URE2_METSB Urease subunit beta OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ureB PE=3 SV=1 138 237 3.0E-26
sp|Q2K514|URE2_RHIEC Urease subunit beta OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ureB PE=3 SV=1 138 234 3.0E-26
sp|Q07K71|URE2_RHOP5 Urease subunit beta OS=Rhodopseudomonas palustris (strain BisA53) GN=ureB PE=3 SV=1 138 227 4.0E-26
sp|B8HW51|URE2_CYAP4 Urease subunit beta OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ureB PE=3 SV=1 138 237 4.0E-26
sp|Q2SDQ2|URE2_HAHCH Urease subunit beta OS=Hahella chejuensis (strain KCTC 2396) GN=ureB PE=3 SV=1 138 227 4.0E-26
sp|A4WR73|URE2_RHOS5 Urease subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ureB PE=3 SV=1 138 229 4.0E-26
sp|B9KK50|URE2_RHOSK Urease subunit beta OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ureB PE=3 SV=1 138 229 4.0E-26
sp|Q1LPT0|URE2_CUPMC Urease subunit beta OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ureB PE=3 SV=1 138 229 5.0E-26
sp|A8LRS3|URE2_DINSH Urease subunit beta OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ureB PE=3 SV=1 138 230 6.0E-26
sp|Q98CY6|URE2_RHILO Urease subunit beta OS=Rhizobium loti (strain MAFF303099) GN=ureB PE=3 SV=1 138 227 6.0E-26
sp|Q1MCV6|URE2_RHIL3 Urease subunit beta OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ureB PE=3 SV=1 138 234 6.0E-26
sp|B2IT65|URE2_NOSP7 Urease subunit beta OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ureB PE=3 SV=1 138 234 7.0E-26
sp|Q2SYF6|URE2_BURTA Urease subunit beta OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ureB PE=3 SV=1 138 236 7.0E-26
sp|C1DNK6|URE3_AZOVD Urease subunit gamma OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ureA PE=3 SV=1 1 101 7.0E-26
sp|Q3IRZ6|URE2_NATPD Urease subunit beta OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ureB PE=3 SV=1 138 253 7.0E-26
sp|B9JR84|URE2_AGRVS Urease subunit beta OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=ureB PE=3 SV=1 137 236 7.0E-26
sp|C5C8U2|URE2_MICLC Urease subunit beta OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=ureB PE=3 SV=1 137 239 1.0E-25
sp|Q3IH69|URE2_PSEHT Urease subunit beta OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ureB PE=3 SV=1 138 237 1.0E-25
sp|A1R1C4|URE2_ARTAT Urease subunit beta OS=Arthrobacter aurescens (strain TC1) GN=ureB PE=3 SV=1 138 237 1.0E-25
sp|Q1H0F1|URE2_METFK Urease subunit beta OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=ureB PE=3 SV=1 138 227 1.0E-25
sp|Q2Y9M8|URE2_NITMU Urease subunit beta OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ureB PE=3 SV=1 138 237 1.0E-25
sp|Q0KCP7|URE2_CUPNH Urease subunit beta OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ureB PE=3 SV=1 138 229 1.0E-25
sp|Q3AGD1|URE2_SYNSC Urease subunit beta OS=Synechococcus sp. (strain CC9605) GN=ureB PE=3 SV=1 138 237 2.0E-25
sp|Q7N4Y8|URE2_PHOLL Urease subunit beta OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ureB PE=3 SV=1 139 234 2.0E-25
sp|A2BQW7|URE2_PROMS Urease subunit beta OS=Prochlorococcus marinus (strain AS9601) GN=ureB PE=3 SV=1 138 234 2.0E-25
sp|A8G4K8|URE2_PROM2 Urease subunit beta OS=Prochlorococcus marinus (strain MIT 9215) GN=ureB PE=3 SV=1 138 237 3.0E-25
sp|A3PCP0|URE2_PROM0 Urease subunit beta OS=Prochlorococcus marinus (strain MIT 9301) GN=ureB PE=3 SV=1 138 237 3.0E-25
sp|Q8CND0|URE2_STAES Urease subunit beta OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ureB PE=3 SV=1 138 241 3.0E-25
sp|Q5HLW2|URE2_STAEQ Urease subunit beta OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ureB PE=3 SV=1 138 241 3.0E-25
sp|B3R401|URE2_CUPTR Urease subunit beta OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ureB PE=3 SV=1 138 229 3.0E-25
sp|P71035|URE2_BACSU Urease subunit beta OS=Bacillus subtilis (strain 168) GN=ureB PE=1 SV=1 137 253 3.0E-25
sp|C3MGX4|URE2_RHISN Urease subunit beta OS=Rhizobium sp. (strain NGR234) GN=ureB PE=3 SV=1 138 227 3.0E-25
sp|A6TE41|URE2_KLEP7 Urease subunit beta OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ureB PE=3 SV=1 138 237 4.0E-25
sp|P18315|URE2_ENTAE Urease subunit beta OS=Enterobacter aerogenes GN=ureB PE=1 SV=1 138 237 4.0E-25
sp|B1YUG0|URE2_BURA4 Urease subunit beta OS=Burkholderia ambifaria (strain MC40-6) GN=ureB PE=3 SV=1 138 236 4.0E-25
sp|A1U4Z9|URE2_MARHV Urease subunit beta OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ureB PE=3 SV=1 138 227 4.0E-25
sp|A0K577|URE2_BURCH Urease subunit beta OS=Burkholderia cenocepacia (strain HI2424) GN=ureB PE=3 SV=1 138 236 5.0E-25
sp|Q1BYH1|URE2_BURCA Urease subunit beta OS=Burkholderia cenocepacia (strain AU 1054) GN=ureB PE=3 SV=1 138 236 5.0E-25
sp|A9KJS0|URE2_CLOPH Urease subunit beta OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ureB PE=3 SV=1 137 240 5.0E-25
sp|Q0BHN4|URE2_BURCM Urease subunit beta OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ureB PE=3 SV=1 138 236 5.0E-25
sp|Q4KJ09|URE2_PSEF5 Urease subunit beta OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ureB PE=3 SV=1 138 227 5.0E-25
sp|A6SZ06|URE2_JANMA Urease subunit beta OS=Janthinobacterium sp. (strain Marseille) GN=ureB PE=3 SV=1 138 237 6.0E-25
sp|A4JC43|URE2_BURVG Urease subunit beta OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ureB PE=3 SV=1 138 236 6.0E-25
sp|P42886|URE2_RHIME Urease subunit beta OS=Rhizobium meliloti (strain 1021) GN=ureB PE=3 SV=1 138 227 6.0E-25
sp|Q3M710|URE2_ANAVT Urease subunit beta OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ureB PE=3 SV=1 138 236 7.0E-25
sp|A0L6F0|URE3_MAGMM Urease subunit gamma OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ureA PE=3 SV=1 1 100 7.0E-25
sp|Q39IW2|URE2_BURL3 Urease subunit beta OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ureB PE=3 SV=1 138 236 8.0E-25
sp|B1JX30|URE2_BURCC Urease subunit beta OS=Burkholderia cenocepacia (strain MC0-3) GN=ureB PE=3 SV=1 138 236 8.0E-25
sp|B0BRU3|URE2_ACTPJ Urease subunit beta OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ureB PE=3 SV=1 138 234 9.0E-25
sp|A3N2R5|URE2_ACTP2 Urease subunit beta OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ureB PE=3 SV=1 138 234 9.0E-25
sp|Q5KYM0|URE2_GEOKA Urease subunit beta OS=Geobacillus kaustophilus (strain HTA426) GN=ureB PE=3 SV=1 138 237 9.0E-25
sp|Q8G2P9|URE21_BRUSU Urease subunit beta 1 OS=Brucella suis biovar 1 (strain 1330) GN=ureB1 PE=1 SV=1 138 236 1.0E-24
sp|Q7CNT2|URE21_BRUME Urease subunit beta 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ureB1 PE=3 SV=1 138 236 1.0E-24
sp|P0C1D5|URE21_BRUAB Urease subunit beta 1 OS=Brucella abortus biovar 1 (strain 9-941) GN=ureB1 PE=3 SV=1 138 236 1.0E-24
sp|Q2YPD6|URE21_BRUA2 Urease subunit beta 1 OS=Brucella abortus (strain 2308) GN=ureB1 PE=1 SV=1 138 236 1.0E-24
sp|A9AF71|URE2_BURM1 Urease subunit beta OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ureB PE=3 SV=1 138 236 1.0E-24
sp|B0JTP2|URE2_MICAN Urease subunit beta OS=Microcystis aeruginosa (strain NIES-843) GN=ureB PE=3 SV=1 138 234 1.0E-24
sp|A1KBB7|URE3_AZOSB Urease subunit gamma OS=Azoarcus sp. (strain BH72) GN=ureA PE=3 SV=1 1 100 1.0E-24
sp|A6QJC9|URE2_STAAE Urease subunit beta OS=Staphylococcus aureus (strain Newman) GN=ureB PE=3 SV=1 138 241 1.0E-24
sp|B2JF66|URE2_BURP8 Urease subunit beta OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ureB PE=3 SV=1 138 236 1.0E-24
sp|Q117Z8|URE2_TRIEI Urease subunit beta OS=Trichodesmium erythraeum (strain IMS101) GN=ureB PE=3 SV=1 138 237 1.0E-24
sp|A5FAD2|URE2_FLAJ1 Urease subunit beta OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=ureB PE=3 SV=1 138 234 1.0E-24
sp|O54419|URE2_ACTPL Urease subunit beta OS=Actinobacillus pleuropneumoniae GN=ureB PE=3 SV=1 138 234 1.0E-24
sp|B3H2L4|URE2_ACTP7 Urease subunit beta OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ureB PE=3 SV=1 138 234 1.0E-24
sp|B9DLX9|URE2_STACT Urease subunit beta OS=Staphylococcus carnosus (strain TM300) GN=ureB PE=3 SV=1 137 241 1.0E-24
sp|Q6GEE5|URE2_STAAR Urease subunit beta OS=Staphylococcus aureus (strain MRSA252) GN=ureB PE=3 SV=1 138 241 1.0E-24
sp|B5XU28|URE2_KLEP3 Urease subunit beta OS=Klebsiella pneumoniae (strain 342) GN=ureB PE=3 SV=1 138 237 1.0E-24
sp|Q8NV90|URE2_STAAW Urease subunit beta OS=Staphylococcus aureus (strain MW2) GN=ureB PE=3 SV=1 138 241 1.0E-24
sp|A8Z386|URE2_STAAT Urease subunit beta OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ureB PE=3 SV=1 138 241 1.0E-24
sp|Q6G733|URE2_STAAS Urease subunit beta OS=Staphylococcus aureus (strain MSSA476) GN=ureB PE=3 SV=1 138 241 1.0E-24
sp|Q5HDR9|URE2_STAAC Urease subunit beta OS=Staphylococcus aureus (strain COL) GN=ureB PE=3 SV=1 138 241 1.0E-24
sp|Q2YYQ7|URE2_STAAB Urease subunit beta OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ureB PE=3 SV=1 138 241 1.0E-24
sp|Q2G2K6|URE2_STAA8 Urease subunit beta OS=Staphylococcus aureus (strain NCTC 8325) GN=ureB PE=3 SV=1 138 241 1.0E-24
sp|Q2FEK4|URE2_STAA3 Urease subunit beta OS=Staphylococcus aureus (strain USA300) GN=ureB PE=3 SV=1 138 241 1.0E-24
sp|P44392|URE2_HAEIN Urease subunit beta OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ureB PE=3 SV=1 138 234 1.0E-24
sp|A5U9V5|URE2_HAEIE Urease subunit beta OS=Haemophilus influenzae (strain PittEE) GN=ureB PE=3 SV=1 138 234 1.0E-24
sp|Q4QN08|URE2_HAEI8 Urease subunit beta OS=Haemophilus influenzae (strain 86-028NP) GN=ureB PE=3 SV=1 138 234 1.0E-24
sp|B9J8M5|URE2_AGRRK Urease subunit beta OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ureB PE=3 SV=1 138 227 1.0E-24
sp|B5YUX2|URE2_ECO5E Urease subunit beta OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ureB PE=3 SV=1 138 227 1.0E-24
sp|Q8XAG1|URE2_ECO57 Urease subunit beta OS=Escherichia coli O157:H7 GN=ureB1 PE=3 SV=1 138 227 1.0E-24
sp|P41021|URE2_SPOPA Urease subunit beta OS=Sporosarcina pasteurii GN=ureB PE=1 SV=1 138 237 2.0E-24
sp|P67407|URE2_STAAN Urease subunit beta OS=Staphylococcus aureus (strain N315) GN=ureB PE=3 SV=1 138 241 2.0E-24
sp|P67406|URE2_STAAM Urease subunit beta OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ureB PE=3 SV=1 138 241 2.0E-24
sp|A5IV70|URE2_STAA9 Urease subunit beta OS=Staphylococcus aureus (strain JH9) GN=ureB PE=3 SV=1 138 241 2.0E-24
sp|A6U413|URE2_STAA2 Urease subunit beta OS=Staphylococcus aureus (strain JH1) GN=ureB PE=3 SV=1 138 241 2.0E-24
sp|A7X5M0|URE2_STAA1 Urease subunit beta OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ureB PE=3 SV=1 138 241 2.0E-24
sp|Q144E3|URE2_BURXL Urease subunit beta OS=Burkholderia xenovorans (strain LB400) GN=ureB PE=3 SV=1 138 236 2.0E-24
sp|B0C793|URE2_ACAM1 Urease subunit beta OS=Acaryochloris marina (strain MBIC 11017) GN=ureB PE=3 SV=1 138 234 2.0E-24
sp|Q02FF4|URE3_PSEAB Urease subunit gamma OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ureA PE=3 SV=1 1 101 2.0E-24
sp|A6VCX2|URE3_PSEA7 Urease subunit gamma OS=Pseudomonas aeruginosa (strain PA7) GN=ureA PE=3 SV=1 1 101 2.0E-24
sp|Q46IY4|URE2_PROMT Urease subunit beta OS=Prochlorococcus marinus (strain NATL2A) GN=ureB PE=3 SV=1 138 237 2.0E-24
sp|A2C4S1|URE2_PROM1 Urease subunit beta OS=Prochlorococcus marinus (strain NATL1A) GN=ureB PE=3 SV=1 138 237 2.0E-24
sp|A6VTV7|URE2_MARMS Urease subunit beta OS=Marinomonas sp. (strain MWYL1) GN=ureB PE=3 SV=1 138 227 2.0E-24
sp|Q9HUU8|URE3_PSEAE Urease subunit gamma OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ureA PE=3 SV=1 1 101 2.0E-24
sp|B7V1S8|URE3_PSEA8 Urease subunit gamma OS=Pseudomonas aeruginosa (strain LESB58) GN=ureA PE=3 SV=1 1 101 2.0E-24
sp|O87401|URE2_SYNPV Urease subunit beta OS=Synechococcus sp. (strain WH7805) GN=ureB PE=1 SV=1 138 237 2.0E-24
sp|Q7V1B5|URE2_PROMP Urease subunit beta OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ureB PE=3 SV=1 138 237 3.0E-24
sp|Q8UCS8|URE2_AGRFC Urease subunit beta OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ureB PE=3 SV=1 137 227 3.0E-24
sp|B4ECC6|URE2_BURCJ Urease subunit beta OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ureB PE=3 SV=1 138 236 3.0E-24
sp|Q4ZN10|URE3_PSEU2 Urease subunit gamma OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ureA PE=3 SV=1 1 101 3.0E-24
sp|Q48DF0|URE3_PSE14 Urease subunit gamma OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ureA PE=3 SV=1 1 101 3.0E-24
sp|Q11EW5|URE2_CHESB Urease subunit beta OS=Chelativorans sp. (strain BNC1) GN=ureB PE=3 SV=1 138 227 3.0E-24
sp|Q1GJP7|URE2_RUEST Urease subunit beta OS=Ruegeria sp. (strain TM1040) GN=ureB PE=3 SV=1 138 229 3.0E-24
sp|Q8YQZ2|URE2_NOSS1 Urease subunit beta OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ureB PE=3 SV=1 138 236 4.0E-24
sp|B8EPV1|URE3_METSB Urease subunit gamma OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ureA PE=3 SV=1 1 100 4.0E-24
sp|B2T0P6|URE2_BURPP Urease subunit beta OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ureB PE=3 SV=1 138 236 4.0E-24
sp|A4XQ47|URE3_PSEMY Urease subunit gamma OS=Pseudomonas mendocina (strain ymp) GN=ureA PE=3 SV=1 1 101 4.0E-24
sp|B8GQ25|URE2_THISH Urease subunit beta OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=ureB PE=3 SV=1 138 236 5.0E-24
sp|A4VQU9|URE3_PSEU5 Urease subunit gamma OS=Pseudomonas stutzeri (strain A1501) GN=ureA PE=3 SV=1 1 101 5.0E-24
sp|Q7U3I4|URE2_SYNPX Urease subunit beta OS=Synechococcus sp. (strain WH8102) GN=ureB PE=3 SV=1 138 237 5.0E-24
sp|Q8FQX3|URE2_COREF Urease subunit beta OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=ureB PE=3 SV=1 138 237 5.0E-24
sp|Q28RJ8|URE2_JANSC Urease subunit beta OS=Jannaschia sp. (strain CCS1) GN=ureB PE=3 SV=1 138 234 5.0E-24
sp|Q87VP4|URE3_PSESM Urease subunit gamma OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ureA PE=3 SV=1 1 101 5.0E-24
sp|Q6FD84|URE2_ACIAD Urease subunit beta OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ureB PE=3 SV=1 138 227 6.0E-24
sp|C1DNK5|URE2_AZOVD Urease subunit beta OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ureB PE=3 SV=1 138 227 6.0E-24
sp|Q0BQ42|URE3_GRABC Urease subunit gamma OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=ureA PE=3 SV=1 1 100 6.0E-24
sp|C3K5A5|URE3_PSEFS Urease subunit gamma OS=Pseudomonas fluorescens (strain SBW25) GN=ureA PE=3 SV=1 1 101 8.0E-24
sp|Q733J5|URE2_BACC1 Urease subunit beta OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ureB PE=3 SV=1 138 239 9.0E-24
sp|Q9FCD2|URE2_STRCO Urease subunit beta OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ureB PE=3 SV=1 138 227 9.0E-24
sp|A6UC38|URE2_SINMW Urease subunit beta OS=Sinorhizobium medicae (strain WSM419) GN=ureB PE=3 SV=1 138 227 1.0E-23
sp|Q3KIS8|URE3_PSEPF Urease subunit gamma OS=Pseudomonas fluorescens (strain Pf0-1) GN=ureA PE=3 SV=1 1 100 1.0E-23
sp|B8HA06|URE2_ARTCA Urease subunit beta OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=ureB PE=3 SV=1 138 239 1.0E-23
sp|Q31B50|URE2_PROM9 Urease subunit beta OS=Prochlorococcus marinus (strain MIT 9312) GN=ureB PE=3 SV=1 138 237 1.0E-23
sp|Q89UG3|URE3_BRADU Urease subunit gamma OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ureA PE=3 SV=1 1 100 2.0E-23
sp|C5BUP0|URE2_TERTT Urease subunit beta OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ureB PE=3 SV=1 138 237 2.0E-23
sp|Q0AC99|URE2_ALKEH Urease subunit beta OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ureB PE=3 SV=1 138 235 2.0E-23
sp|Q0I657|URE2_SYNS3 Urease subunit beta OS=Synechococcus sp. (strain CC9311) GN=ureB PE=3 SV=1 138 237 2.0E-23
sp|Q8G2Q0|URE31_BRUSU Urease subunit gamma 1 OS=Brucella suis biovar 1 (strain 1330) GN=ureA1 PE=1 SV=1 1 100 2.0E-23
sp|B1HZE3|URE2_LYSSC Urease subunit beta OS=Lysinibacillus sphaericus (strain C3-41) GN=ureB PE=3 SV=1 138 258 2.0E-23
sp|A4F7F6|URE2_SACEN Urease subunit beta OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=ureB PE=3 SV=1 137 227 3.0E-23
sp|B0TT70|URE2_SHEHH Urease subunit beta OS=Shewanella halifaxensis (strain HAW-EB4) GN=ureB PE=3 SV=1 138 237 3.0E-23
sp|Q8YF71|URE31_BRUME Urease subunit gamma 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ureA1 PE=3 SV=2 1 100 4.0E-23
sp|P0C121|URE31_BRUAB Urease subunit gamma 1 OS=Brucella abortus biovar 1 (strain 9-941) GN=ureA1 PE=3 SV=1 1 100 4.0E-23
sp|Q2YPD7|URE31_BRUA2 Urease subunit gamma 1 OS=Brucella abortus (strain 2308) GN=ureA1 PE=1 SV=1 1 100 4.0E-23
sp|Q0VKY0|URE2_ALCBS Urease subunit beta OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ureB PE=3 SV=1 138 236 4.0E-23
sp|B1ZP08|URE3_OPITP Urease subunit gamma OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ureA PE=3 SV=1 1 100 4.0E-23
sp|Q03ME4|URE2_STRTD Urease subunit beta OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=ureB PE=3 SV=1 138 234 4.0E-23
sp|Q5M608|URE2_STRT2 Urease subunit beta OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=ureB PE=3 SV=1 138 234 4.0E-23
sp|Q5M1G7|URE2_STRT1 Urease subunit beta OS=Streptococcus thermophilus (strain CNRZ 1066) GN=ureB PE=3 SV=1 138 234 4.0E-23
sp|Q55054|URE2_STRE5 Urease subunit beta OS=Streptococcus salivarius (strain 57.I) GN=ureB PE=1 SV=2 138 234 4.0E-23
sp|B8HW52|URE3_CYAP4 Urease subunit gamma OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ureA PE=3 SV=1 1 100 4.0E-23
sp|O30334|URE3_CUPNH Urease subunit gamma OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ureA PE=3 SV=1 1 100 4.0E-23
sp|A1WIM6|URE3_VEREI Urease subunit gamma OS=Verminephrobacter eiseniae (strain EF01-2) GN=ureA PE=3 SV=1 1 100 4.0E-23
sp|A4WEJ4|URE2_ENT38 Urease subunit beta OS=Enterobacter sp. (strain 638) GN=ureB PE=3 SV=1 138 237 4.0E-23
sp|Q161T2|URE3_ROSDO Urease subunit gamma OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ureA PE=3 SV=1 1 100 5.0E-23
sp|Q8XXS8|URE3_RALSO Urease subunit gamma OS=Ralstonia solanacearum (strain GMI1000) GN=ureA PE=3 SV=1 1 100 5.0E-23
sp|A4SY47|URE3_POLSQ Urease subunit gamma OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=ureA PE=3 SV=1 1 100 5.0E-23
sp|Q0BQ41|URE2_GRABC Urease subunit beta OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=ureB PE=3 SV=1 138 230 5.0E-23
sp|A6VTV6|URE3_MARMS Urease subunit gamma OS=Marinomonas sp. (strain MWYL1) GN=ureA PE=3 SV=1 1 101 5.0E-23
sp|P42887|URE3_RHIME Urease subunit gamma OS=Rhizobium meliloti (strain 1021) GN=ureA PE=3 SV=1 1 100 5.0E-23
sp|B1W5G8|URE2_STRGG Urease subunit beta OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=ureB PE=3 SV=1 138 227 6.0E-23
sp|Q3AVR2|URE2_SYNS9 Urease subunit beta OS=Synechococcus sp. (strain CC9902) GN=ureB PE=3 SV=1 138 237 6.0E-23
sp|B0VSC1|URE2_ACIBS Urease subunit beta OS=Acinetobacter baumannii (strain SDF) GN=ureB PE=3 SV=1 138 227 6.0E-23
sp|Q21SZ5|URE3_RHOFT Urease subunit gamma OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ureA PE=3 SV=1 1 100 6.0E-23
sp|Q88J05|URE2_PSEPK Urease subunit beta OS=Pseudomonas putida (strain KT2440) GN=ureB PE=3 SV=1 138 237 6.0E-23
sp|B0KUZ8|URE2_PSEPG Urease subunit beta OS=Pseudomonas putida (strain GB-1) GN=ureB PE=3 SV=1 138 237 6.0E-23
sp|Q0S4S8|URE2_RHOJR Urease subunit beta OS=Rhodococcus jostii (strain RHA1) GN=ureB PE=3 SV=1 138 227 7.0E-23
sp|A6UC40|URE3_SINMW Urease subunit gamma OS=Sinorhizobium medicae (strain WSM419) GN=ureA PE=3 SV=1 1 100 7.0E-23
sp|C3MGX6|URE3_RHISN Urease subunit gamma OS=Rhizobium sp. (strain NGR234) GN=ureA PE=3 SV=1 1 100 7.0E-23
sp|A5GWV5|URE3_SYNR3 Urease subunit gamma OS=Synechococcus sp. (strain RCC307) GN=ureA PE=3 SV=1 1 100 8.0E-23
sp|Q161T1|URE2_ROSDO Urease subunit beta OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ureB PE=3 SV=1 138 234 8.0E-23
sp|Q3M709|URE3_ANAVT Urease subunit gamma OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ureA PE=3 SV=1 1 100 8.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0016151 nickel cation binding Yes
GO:0043419 urea catabolic process Yes
GO:1901565 organonitrogen compound catabolic process No
GO:1901575 organic substance catabolic process No
GO:0043605 cellular amide catabolic process No
GO:0003674 molecular_function No
GO:0071941 nitrogen cycle metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0008150 biological_process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0043169 cation binding No
GO:0044248 cellular catabolic process No
GO:0008152 metabolic process No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046914 transition metal ion binding No
GO:0044282 small molecule catabolic process No
GO:0003824 catalytic activity No
GO:0009056 catabolic process No
GO:0019627 urea metabolic process No
GO:0043167 ion binding No
GO:0044281 small molecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|821
MHLVPKELDKLVISQLGVLAQRRLARGVRLNHTEATALIANNLHELIRDGNHSVADLMSLGSTMLGRRHVLPAVC
STLREIQVEGTFPTGTYLVTVHNPVSTDDGDLRRALYGSFLPIPDNEAFPLPPDAEYMPENRPGAVIAVKGKIAI
NGKRHRIRLRVTSRGDRPIQVGSHYHFVETNPQLQFDRARAYGYRLDIAAGTSVRFEPGDTKTVTLVEIGGLRII
RGGNNLASGPVEPHRVEDVVTKLQAAGFAHQPEPRADAAHIDVCQIDRAAYATMFGPTTGDLVRLGNTDLWIRVE
KDLGCYGDECKFGGGKTLREGMGQASARTDADSLDLVVTNALIVDWTGIYKADIGVKDGIIVGIGKAGSPDVMDG
VTPNMVVGSCTDVVAGEGKIVTAGGIDTHIHCICPQQADESLASGITTMLGGGTGPSAGSNATTCTPGQTYIRSM
LQAADALPVNFGFTGKGCDSSPEALREQIRAGACGLKIHEDWGATPAAIDACLSVCDELDVQCCVHTDTLNESGF
VESTIAAVGGRTIHTYHTEGAGGGHAPDIISVVEHANVLPASTNPTRPFTRNTLDEHLDMLMVCHHLSRNIPEDV
AFAESRIRAETIAAEDVLQDMGAISIMSSDSQAMGRCGEVIVRTWNTAHKNKLQRGRLAEDEAAGADNLRVRRYI
SKYTINPALAQGFSHLVGSIEVGKLADLVVWEPAWFGTKPSLVLKGGFIAFAQMVRLSLSLCLSLSLCLPVYLRR
ARAG*
Coding >Hirsu2|821
ATGCATCTTGTGCCCAAAGAGCTCGACAAACTCGTCATCTCGCAGCTGGGCGTCCTGGCTCAGAGAAGGCTCGCG
AGGGGCGTCAGGCTCAATCATACGGAAGCAACAGCTCTCATCGCCAACAACCTCCATGAACTCATCCGGGATGGC
AACCACTCCGTCGCCGATCTCATGTCCCTCGGCTCCACCATGCTCGGCCGCCGACATGTGCTGCCCGCCGTCTGC
AGCACCCTGCGGGAGATCCAGGTCGAGGGCACGTTCCCCACGGGCACCTATCTCGTGACCGTCCACAACCCCGTC
AGCACCGACGACGGCGACCTGCGGCGCGCGCTCTACGGCAGCTTCTTGCCCATCCCCGACAACGAGGCCTTCCCG
CTGCCGCCGGACGCCGAGTACATGCCCGAAAACCGGCCCGGCGCCGTCATCGCCGTCAAGGGCAAGATCGCCATC
AACGGGAAGCGTCACAGAATCCGGCTGCGCGTGACGAGCAGGGGGGATCGCCCGATCCAGGTCGGCTCGCACTAC
CACTTCGTCGAAACGAACCCCCAGCTCCAGTTCGACCGGGCCCGGGCCTACGGCTACCGCCTCGACATCGCCGCC
GGCACGTCGGTGCGGTTCGAGCCCGGCGACACCAAGACGGTCACGCTCGTCGAGATTGGCGGCCTGAGGATCATC
CGCGGCGGCAACAACCTCGCCTCCGGCCCGGTCGAGCCCCATCGCGTCGAGGATGTTGTCACGAAGCTGCAGGCG
GCCGGATTCGCCCACCAGCCGGAGCCGCGGGCGGACGCGGCGCACATCGACGTCTGCCAGATCGACCGCGCCGCC
TACGCCACCATGTTCGGCCCGACCACCGGCGACCTCGTGCGGCTCGGAAACACTGACCTCTGGATCCGGGTCGAG
AAGGACCTGGGCTGCTACGGCGACGAGTGCAAGTTCGGCGGCGGCAAGACGTTGAGGGAGGGCATGGGCCAGGCC
TCGGCCAGGACCGACGCCGACTCACTCGACCTCGTAGTCACCAACGCCCTCATCGTCGACTGGACGGGCATCTAC
AAGGCCGATATCGGCGTCAAGGACGGCATCATCGTCGGCATCGGCAAGGCGGGCAGCCCCGACGTCATGGACGGC
GTGACGCCGAACATGGTCGTGGGCAGCTGCACCGACGTCGTGGCGGGCGAGGGCAAGATCGTGACGGCCGGCGGC
ATCGACACGCACATCCACTGCATCTGCCCGCAGCAGGCGGACGAGTCTCTGGCGTCGGGCATCACGACGATGCTG
GGAGGCGGCACGGGGCCAAGCGCCGGCTCCAATGCGACGACCTGCACCCCCGGCCAGACGTACATCCGGTCCATG
CTGCAGGCGGCCGACGCGCTGCCGGTCAACTTCGGCTTCACGGGCAAGGGGTGCGACTCGTCGCCCGAGGCGCTG
CGGGAGCAGATCCGGGCCGGCGCGTGCGGGCTCAAGATCCACGAGGACTGGGGGGCGACGCCGGCGGCCATCGAC
GCGTGCCTGAGCGTGTGCGACGAGCTGGACGTGCAGTGCTGCGTGCACACGGACACGCTCAACGAGAGCGGCTTC
GTCGAGAGCACCATCGCCGCCGTGGGCGGGCGCACGATCCACACGTACCACACGGAGGGCGCCGGGGGCGGGCAC
GCGCCCGACATCATCTCGGTGGTGGAGCACGCCAACGTGCTGCCGGCGTCGACGAACCCGACGCGGCCGTTCACG
CGCAACACGCTGGACGAGCACCTGGACATGCTGATGGTGTGCCACCACCTGTCGCGCAACATCCCCGAGGACGTG
GCCTTCGCCGAGAGCCGGATCCGGGCCGAGACGATCGCGGCCGAGGACGTGCTGCAGGACATGGGGGCCATCAGC
ATCATGAGCTCCGACTCGCAGGCCATGGGCCGCTGCGGCGAGGTGATTGTGCGGACGTGGAACACGGCGCACAAG
AACAAGCTGCAGCGCGGCCGGCTGGCCGAGGACGAGGCGGCGGGCGCGGACAACCTGCGCGTCCGGCGCTACATC
AGCAAGTACACCATCAACCCGGCCCTGGCCCAGGGCTTCTCCCACCTGGTCGGCAGCATCGAGGTGGGCAAGCTG
GCGGACCTGGTGGTCTGGGAGCCGGCCTGGTTCGGCACGAAGCCGTCGCTCGTCCTCAAGGGCGGCTTCATCGCC
TTTGCGCAAATGGTCCGTCTCTCTCTCTCTCTCTGTCTCTCTCTCTCTCTCTGTCTCCCTGTCTACCTCCGACGA
GCCCGTGCCGGCTGA
Transcript >Hirsu2|821
ATGCATCTTGTGCCCAAAGAGCTCGACAAACTCGTCATCTCGCAGCTGGGCGTCCTGGCTCAGAGAAGGCTCGCG
AGGGGCGTCAGGCTCAATCATACGGAAGCAACAGCTCTCATCGCCAACAACCTCCATGAACTCATCCGGGATGGC
AACCACTCCGTCGCCGATCTCATGTCCCTCGGCTCCACCATGCTCGGCCGCCGACATGTGCTGCCCGCCGTCTGC
AGCACCCTGCGGGAGATCCAGGTCGAGGGCACGTTCCCCACGGGCACCTATCTCGTGACCGTCCACAACCCCGTC
AGCACCGACGACGGCGACCTGCGGCGCGCGCTCTACGGCAGCTTCTTGCCCATCCCCGACAACGAGGCCTTCCCG
CTGCCGCCGGACGCCGAGTACATGCCCGAAAACCGGCCCGGCGCCGTCATCGCCGTCAAGGGCAAGATCGCCATC
AACGGGAAGCGTCACAGAATCCGGCTGCGCGTGACGAGCAGGGGGGATCGCCCGATCCAGGTCGGCTCGCACTAC
CACTTCGTCGAAACGAACCCCCAGCTCCAGTTCGACCGGGCCCGGGCCTACGGCTACCGCCTCGACATCGCCGCC
GGCACGTCGGTGCGGTTCGAGCCCGGCGACACCAAGACGGTCACGCTCGTCGAGATTGGCGGCCTGAGGATCATC
CGCGGCGGCAACAACCTCGCCTCCGGCCCGGTCGAGCCCCATCGCGTCGAGGATGTTGTCACGAAGCTGCAGGCG
GCCGGATTCGCCCACCAGCCGGAGCCGCGGGCGGACGCGGCGCACATCGACGTCTGCCAGATCGACCGCGCCGCC
TACGCCACCATGTTCGGCCCGACCACCGGCGACCTCGTGCGGCTCGGAAACACTGACCTCTGGATCCGGGTCGAG
AAGGACCTGGGCTGCTACGGCGACGAGTGCAAGTTCGGCGGCGGCAAGACGTTGAGGGAGGGCATGGGCCAGGCC
TCGGCCAGGACCGACGCCGACTCACTCGACCTCGTAGTCACCAACGCCCTCATCGTCGACTGGACGGGCATCTAC
AAGGCCGATATCGGCGTCAAGGACGGCATCATCGTCGGCATCGGCAAGGCGGGCAGCCCCGACGTCATGGACGGC
GTGACGCCGAACATGGTCGTGGGCAGCTGCACCGACGTCGTGGCGGGCGAGGGCAAGATCGTGACGGCCGGCGGC
ATCGACACGCACATCCACTGCATCTGCCCGCAGCAGGCGGACGAGTCTCTGGCGTCGGGCATCACGACGATGCTG
GGAGGCGGCACGGGGCCAAGCGCCGGCTCCAATGCGACGACCTGCACCCCCGGCCAGACGTACATCCGGTCCATG
CTGCAGGCGGCCGACGCGCTGCCGGTCAACTTCGGCTTCACGGGCAAGGGGTGCGACTCGTCGCCCGAGGCGCTG
CGGGAGCAGATCCGGGCCGGCGCGTGCGGGCTCAAGATCCACGAGGACTGGGGGGCGACGCCGGCGGCCATCGAC
GCGTGCCTGAGCGTGTGCGACGAGCTGGACGTGCAGTGCTGCGTGCACACGGACACGCTCAACGAGAGCGGCTTC
GTCGAGAGCACCATCGCCGCCGTGGGCGGGCGCACGATCCACACGTACCACACGGAGGGCGCCGGGGGCGGGCAC
GCGCCCGACATCATCTCGGTGGTGGAGCACGCCAACGTGCTGCCGGCGTCGACGAACCCGACGCGGCCGTTCACG
CGCAACACGCTGGACGAGCACCTGGACATGCTGATGGTGTGCCACCACCTGTCGCGCAACATCCCCGAGGACGTG
GCCTTCGCCGAGAGCCGGATCCGGGCCGAGACGATCGCGGCCGAGGACGTGCTGCAGGACATGGGGGCCATCAGC
ATCATGAGCTCCGACTCGCAGGCCATGGGCCGCTGCGGCGAGGTGATTGTGCGGACGTGGAACACGGCGCACAAG
AACAAGCTGCAGCGCGGCCGGCTGGCCGAGGACGAGGCGGCGGGCGCGGACAACCTGCGCGTCCGGCGCTACATC
AGCAAGTACACCATCAACCCGGCCCTGGCCCAGGGCTTCTCCCACCTGGTCGGCAGCATCGAGGTGGGCAAGCTG
GCGGACCTGGTGGTCTGGGAGCCGGCCTGGTTCGGCACGAAGCCGTCGCTCGTCCTCAAGGGCGGCTTCATCGCC
TTTGCGCAAATGGTCCGTCTCTCTCTCTCTCTCTGTCTCTCTCTCTCTCTCTGTCTCCCTGTCTACCTCCGACGA
GCCCGTGCCGGCTGA
Gene >Hirsu2|821
ATGCATCTTGTGCCCAAAGAGGTCCGTACTCGTCCAACCCTGGCCATACCCCTGCCTCGTCCTCCGCCCCACGCT
CTCCGTCCATCTATCCCGCCGGCATCGCTAAAATCATACCACGCCTTCGACTCCAGCTCGACAAACTCGTCATCT
CGCAGCTGGGCGTCCTGGCTCAGAGAAGGCTCGCGAGGGGCGTCAGGCTCAATCATACGGAAGCAACAGTATGTC
ACCAGCTTCACTGACAGGGTCGCCTCCCGCTCATCGCCTCCCGTCCGCGGCAGGCTCTCATCGCCAACAACCTCC
ATGAACTCATCCGGGATGGCAACCACTCCGTCGCCGATCTCATGTCCCTCGGCTCCACCATGCTCGGCCGCCGAC
ATGTGCTGCCCGCCGTCTGCAGCACCCTGCGGGAGATCCAGGTCGAGGGCACGTTCCCCACGGGCACCTATCTCG
TGACCGTCCACAACCCCGTCAGCACCGACGACGGCGACCTGCGGCGCGCGCTCTACGGCAGCTTCTTGCCCATCC
CCGACAACGAGGCCTTCCCGCTGCCGCCGGACGCCGAGTACATGCCCGAAAACCGGCCCGGCGCCGTCATCGCCG
TCAAGGGCAAGATCGCCATCAACGGGAAGCGTCACAGAATCCGGCTGCGCGTGACGAGCAGGGGGGATCGCCCGA
TCCAGGTCGGCTCGCACTACCACTTCGTCGAAACGAACCCCCAGCTCCAGTTCGACCGGGCCCGGGCCTACGGCT
ACCGCCTCGACATCGCCGCCGGCACGTCGGTGCGGTTCGAGCCCGGCGACACCAAGACGGTCACGCTCGTCGAGA
TTGGCGGCCTGAGGATCATCCGCGGCGGCAACAACCTCGCCTCCGGCCCGGTCGAGCCCCATCGCGTCGAGGATG
TTGTCACGAAGCTGCAGGCGGCCGGATTCGCCCACCAGCCGGAGCCGCGGGCGGACGCGGCGCACATCGACGTCT
GCCAGATCGACCGCGCCGCCTACGCCACCATGTTCGGCCCGACCACCGGCGACCTCGTGCGGCTCGGAAACACTG
ACCTCTGGATCCGGGTCGAGAAGGACCTGGGCTGCTACGGCGACGAGTGCAAGTTCGGCGGCGGCAAGACGTTGA
GGGAGGGCATGGGCCAGGCCTCGGCCAGGACCGACGCCGACTCACTCGACCTCGTAGTCACCAACGCCCTCATCG
TCGACTGGACGGGCATCTACAAGGCCGATATCGGCGTCAAGGACGGCATCATCGTCGGCATCGGCAAGGCGGGCA
GCCCCGACGTCATGGACGGCGTGACGCCGAACATGGTCGTGGGCAGCTGCACCGACGTCGTGGCGGGCGAGGGCA
AGATCGTGACGGCCGGCGGCATCGACACGCACATCCACTGCATCTGCCCGCAGCAGGCGGACGAGTCTCTGGCGT
CGGGCATCACGACGATGCTGGGAGGCGGCACGGGGCCAAGGTCAGTCTGTCCGTCCGTCCGTCCGTCCACAGCCC
TGGGATTCGGATGATGCAAGACACACCACCCATCGTCATCCACCCGCACACCGCCCCCCCCCCCTCGTGCCTTGA
ACTCATCATCTCTCTCCCGTTTCCCACAGCGCCGGCTCCAATGCGACGACCTGCACCCCCGGCCAGACGTACATC
CGGTCCATGCTGCAGGCGGCCGACGCGCTGCCGGTCAACTTCGGCTTCACGGGCAAGGGGTGCGACTCGTCGCCC
GAGGCGCTGCGGGAGCAGATCCGGGCCGGCGCGTGCGGGCTCAAGATCCACGAGGACTGGGGGGCGACGCCGGCG
GCCATCGACGCGTGCCTGAGCGTGTGCGACGAGCTGGACGTGCAGTGCTGCGTGCACACGGACACGCTCAACGAG
AGCGGCTTCGTCGAGAGCACCATCGCCGCCGTGGGCGGGCGCACGATCCACACGTACCACACGGAGGGCGCCGGG
GGCGGGCACGCGCCCGACATCATCTCGGTGGTGGAGCACGCCAACGTGCTGCCGGCGTCGACGAACCCGACGCGG
CCGTTCACGCGCAACACGCTGGACGAGCACCTGGACATGCTGATGGTGTGCCACCACCTGTCGCGCAACATCCCC
GAGGACGTGGCCTTCGCCGAGAGCCGGATCCGGGCCGAGACGATCGCGGCCGAGGACGTGCTGCAGGACATGGGG
GCCATCAGCATCATGAGCTCCGACTCGCAGGCCATGGGCCGCTGCGGCGAGGTGATTGTGCGGACGTGGAACACG
GCGCACAAGAACAAGCTGCAGCGCGGCCGGCTGGCCGAGGACGAGGCGGCGGGCGCGGACAACCTGCGCGTCCGG
CGCTACATCAGCAAGTACACCATCAACCCGGCCCTGGCCCAGGGCTTCTCCCACCTGGTCGGCAGCATCGAGGTG
GGCAAGCTGGCGGACCTGGTGGTCTGGGAGCCGGCCTGGTTCGGCACGAAGCCGTCGCTCGTCCTCAAGGGCGGC
TTCATCGCCTTTGCGCAAATGGTCCGTCTCTCTCTCTCTCTCTGTCTCTCTCTCTCTCTCTGTCTCCCTGTCTAC
CTCCGACGAGCCCGTGCCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail