Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8205
Gene name
LocationContig_52:23278..25309
Strand-
Gene length (bp)2031
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 6.8E-20 147 264
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 6.1E-14 411 573
PF08022 FAD_binding_8 FAD-binding domain 1.2E-09 307 400

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12333|FRE7_YEAST Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE7 PE=1 SV=2 106 598 2.0E-34
sp|A6ZN61|FRE7_YEAS7 Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain YJM789) GN=FRE7 PE=3 SV=1 106 598 5.0E-33
sp|P53746|FRE4_YEAST Ferric reductase transmembrane component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE4 PE=2 SV=1 143 576 1.0E-23
sp|P32791|FRE1_YEAST Ferric/cupric reductase transmembrane component 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE1 PE=1 SV=1 126 576 6.0E-22
sp|Q08905|FRE3_YEAST Ferric reductase transmembrane component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE3 PE=1 SV=1 107 576 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12333|FRE7_YEAST Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE7 PE=1 SV=2 106 598 2.0E-34
sp|A6ZN61|FRE7_YEAS7 Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain YJM789) GN=FRE7 PE=3 SV=1 106 598 5.0E-33
sp|P53746|FRE4_YEAST Ferric reductase transmembrane component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE4 PE=2 SV=1 143 576 1.0E-23
sp|P32791|FRE1_YEAST Ferric/cupric reductase transmembrane component 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE1 PE=1 SV=1 126 576 6.0E-22
sp|Q08905|FRE3_YEAST Ferric reductase transmembrane component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE3 PE=1 SV=1 107 576 2.0E-21
sp|Q12473|FRE6_YEAST Ferric reductase transmembrane component 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE6 PE=1 SV=1 113 577 2.0E-21
sp|P36033|FRE2_YEAST Ferric/cupric reductase transmembrane component 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE2 PE=1 SV=1 143 576 3.0E-20
sp|Q5A446|FRE1_CANAL Ferric/cupric reductase transmembrane component 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CFL1 PE=2 SV=1 108 577 9.0E-19
sp|P78588|FREL_CANAX Probable ferric reductase transmembrane component OS=Candida albicans GN=CFL1 PE=3 SV=1 108 577 9.0E-19
sp|Q08908|FRE5_YEAST Ferric reductase transmembrane component 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE5 PE=2 SV=1 143 577 2.0E-16
sp|A3LN69|AIM14_PICST Probable metalloreductase AIM14 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=AIM14 PE=3 SV=2 146 569 4.0E-14
sp|Q3KTM0|FRO7_ARATH Ferric reduction oxidase 7, chloroplastic OS=Arabidopsis thaliana GN=FRO7 PE=2 SV=1 144 464 3.0E-13
sp|C4Y9R6|AIM14_CLAL4 Probable metalloreductase AIM14 OS=Clavispora lusitaniae (strain ATCC 42720) GN=AIM14 PE=3 SV=1 146 572 1.0E-12
sp|Q8RWS6|FRO6_ARATH Ferric reduction oxidase 6 OS=Arabidopsis thaliana GN=FRO6 PE=2 SV=1 144 464 2.0E-12
sp|C5M5S1|AIM14_CANTT Probable metalloreductase AIM14 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=AIM14 PE=3 SV=1 143 585 2.0E-12
sp|Q9FLW2|FRO5_ARATH Ferric reduction oxidase 5 OS=Arabidopsis thaliana GN=FRO5 PE=2 SV=1 143 449 2.0E-11
sp|C5E398|AIM14_LACTC Probable metalloreductase AIM14 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=AIM14 PE=3 SV=1 183 588 6.0E-11
sp|F4I4K7|FRO3_ARATH Ferric reduction oxidase 3, mitochondrial OS=Arabidopsis thaliana GN=FRO3 PE=2 SV=1 143 433 1.0E-10
sp|Q8W110|FRO4_ARATH Ferric reduction oxidase 4 OS=Arabidopsis thaliana GN=FRO4 PE=2 SV=1 143 449 1.0E-10
sp|P92949|FRO2_ARATH Ferric reduction oxidase 2 OS=Arabidopsis thaliana GN=FRO2 PE=1 SV=2 144 431 1.0E-10
sp|O81209|RBOHA_ARATH Respiratory burst oxidase homolog protein A OS=Arabidopsis thaliana GN=RBOHA PE=2 SV=2 218 598 3.0E-09
sp|Q9LMM2|FRO1_ARATH Probable ferric reduction oxidase 1 OS=Arabidopsis thaliana GN=FRO1 PE=2 SV=1 143 537 2.0E-08
sp|Q8VY13|FRO8_ARATH Ferric reduction oxidase 8, mitochondrial OS=Arabidopsis thaliana GN=FRO8 PE=2 SV=1 143 451 4.0E-08
sp|Q86GL4|NOXB_DICDI Superoxide-generating NADPH oxidase heavy chain subunit B OS=Dictyostelium discoideum GN=noxB PE=2 SV=1 210 598 8.0E-08
sp|B9WB34|AIM14_CANDC Probable metalloreductase AIM14 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=AIM14 PE=3 SV=1 236 580 4.0E-06
sp|Q9XYS3|NOXA_DICDI Superoxide-generating NADPH oxidase heavy chain subunit A OS=Dictyostelium discoideum GN=noxA PE=2 SV=1 174 421 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 103 125 22
3 147 169 22
4 181 203 22
5 218 240 22
6 252 274 22
7 278 295 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8205
MWHLPLFRSNLQFHSSRDPGHCRLTAEQCALKTSHWLSWFGADLAYSIPTVCFFTLGILFFAFARIISENAPESL
ARTAAWRRTLSALRFLAYKSWRVGRRNLQPLGVLLIAALCAAFFLAMALGPRPYYWPTDARYGGSPPLAIRSGWL
ALACLPFLFALAAKANLVSALTAVPPDRLALWHGWVAWIMYFLAVAHVVPFLVLHNAKGDTAEQFRKGSTWLTGV
IAILAQTWLTLMSISRIRNRWYEFFKATHYFFAITFVVFFFLHCGARLTSWDYFVVAGVIYLACLLWALAKTFLK
HGTGLKARLRLESPDALRIAINTKSSWRPGDYFYLRFKTCGLHALTTHPFTVSSLPDTDTGDRELLVYLQPRAGL
TRRLARLAEKQPDLAVGVLLEGPYGGLPVRWYAGFDRTLLIAGGSGCGFTLPLIHDWLRRRDPSSTRELSVLLAT
RDPGMPSWYMHELRCLVERECGTNPTDMSELSISIYQTGAATTTESVAPTPAFAQSDDKEKGLCEPQVRNETDSV
KSLFNINFLRGRPDAAAAVGRLSSLEPHGTLGIAVCGPAGLVHDAAAAAAEQQRRILSGQKGASEVWFHKEAFSC
*
Coding >Hirsu2|8205
ATGTGGCATCTGCCTCTCTTTCGCTCCAACCTGCAGTTCCATTCCTCTCGGGACCCCGGACACTGCAGACTCACA
GCAGAGCAGTGTGCCTTGAAGACGAGCCACTGGCTGTCTTGGTTCGGGGCCGACCTCGCCTATTCAATTCCGACC
GTCTGCTTCTTCACCCTCGGCATCCTCTTCTTCGCCTTCGCCCGCATCATCTCCGAGAATGCCCCCGAGAGCCTG
GCCCGGACGGCGGCTTGGCGTCGCACCCTCTCGGCCTTGCGCTTCCTCGCCTACAAGAGCTGGCGCGTCGGAAGG
CGGAACTTGCAGCCCCTAGGCGTTCTTTTGATCGCCGCCCTCTGCGCCGCCTTCTTCCTCGCCATGGCCCTCGGG
CCCAGGCCCTACTACTGGCCCACGGATGCCCGTTACGGAGGCTCGCCTCCCCTCGCCATCCGCTCCGGCTGGCTG
GCCCTGGCCTGTCTGCCTTTCCTCTTCGCCCTGGCCGCCAAGGCCAATCTCGTGTCTGCCCTGACGGCCGTGCCG
CCGGACCGGCTCGCCCTCTGGCACGGCTGGGTCGCCTGGATCATGTACTTCTTGGCCGTCGCCCACGTCGTTCCC
TTCCTTGTTCTGCACAACGCAAAGGGCGACACGGCCGAGCAGTTTCGAAAGGGCAGCACCTGGCTGACGGGCGTC
ATTGCCATTCTTGCCCAGACCTGGCTGACTCTCATGTCTATTTCACGTATCCGGAACCGCTGGTACGAGTTCTTC
AAGGCCACTCATTACTTTTTCGCCATTACCTTTGTCGTCTTCTTCTTCCTTCATTGCGGCGCCCGCCTGACGTCT
TGGGATTACTTCGTCGTCGCCGGCGTCATTTACCTGGCCTGCTTGCTTTGGGCGCTGGCCAAGACATTCCTGAAG
CACGGCACCGGTCTCAAGGCTCGCCTTCGCCTCGAGTCGCCCGACGCCTTGCGCATCGCCATTAATACCAAGTCC
AGCTGGCGCCCTGGCGACTATTTCTATCTTCGCTTCAAGACGTGCGGCCTGCACGCACTCACAACCCATCCCTTC
ACTGTTTCTTCGCTCCCGGACACCGATACTGGAGACCGGGAGCTGTTGGTCTATCTTCAGCCGCGGGCCGGCTTA
ACACGGAGGCTTGCCAGACTAGCCGAAAAGCAGCCCGACCTGGCTGTGGGCGTCCTGCTCGAGGGGCCGTACGGC
GGCTTGCCTGTGAGGTGGTACGCGGGCTTTGACCGCACACTCCTGATCGCCGGCGGCTCCGGCTGCGGCTTCACC
CTCCCTCTGATCCACGACTGGCTTCGCAGGCGAGACCCGTCCTCGACGAGGGAGCTCAGCGTCCTCCTCGCCACT
CGAGATCCCGGTATGCCCTCCTGGTACATGCACGAGTTACGGTGCTTGGTTGAGCGCGAGTGCGGCACCAATCCC
ACCGACATGTCCGAACTCAGCATCTCCATCTATCAGACCGGCGCGGCCACGACGACCGAGTCCGTGGCGCCGACC
CCCGCCTTCGCCCAGTCGGATGACAAGGAGAAGGGTCTCTGTGAGCCCCAAGTCCGCAATGAGACCGACTCGGTC
AAGTCTCTCTTCAACATCAACTTCTTGCGCGGGCGGCCAGACGCAGCCGCTGCCGTCGGCCGCTTATCCTCGCTG
GAGCCGCACGGCACCCTAGGCATCGCCGTGTGCGGACCAGCTGGTCTGGTACACGACGCGGCGGCGGCGGCGGCC
GAGCAGCAGCGAAGGATTCTGAGCGGCCAAAAGGGCGCATCTGAGGTCTGGTTCCACAAGGAGGCCTTTTCGTGC
TGA
Transcript >Hirsu2|8205
ATGTGGCATCTGCCTCTCTTTCGCTCCAACCTGCAGTTCCATTCCTCTCGGGACCCCGGACACTGCAGACTCACA
GCAGAGCAGTGTGCCTTGAAGACGAGCCACTGGCTGTCTTGGTTCGGGGCCGACCTCGCCTATTCAATTCCGACC
GTCTGCTTCTTCACCCTCGGCATCCTCTTCTTCGCCTTCGCCCGCATCATCTCCGAGAATGCCCCCGAGAGCCTG
GCCCGGACGGCGGCTTGGCGTCGCACCCTCTCGGCCTTGCGCTTCCTCGCCTACAAGAGCTGGCGCGTCGGAAGG
CGGAACTTGCAGCCCCTAGGCGTTCTTTTGATCGCCGCCCTCTGCGCCGCCTTCTTCCTCGCCATGGCCCTCGGG
CCCAGGCCCTACTACTGGCCCACGGATGCCCGTTACGGAGGCTCGCCTCCCCTCGCCATCCGCTCCGGCTGGCTG
GCCCTGGCCTGTCTGCCTTTCCTCTTCGCCCTGGCCGCCAAGGCCAATCTCGTGTCTGCCCTGACGGCCGTGCCG
CCGGACCGGCTCGCCCTCTGGCACGGCTGGGTCGCCTGGATCATGTACTTCTTGGCCGTCGCCCACGTCGTTCCC
TTCCTTGTTCTGCACAACGCAAAGGGCGACACGGCCGAGCAGTTTCGAAAGGGCAGCACCTGGCTGACGGGCGTC
ATTGCCATTCTTGCCCAGACCTGGCTGACTCTCATGTCTATTTCACGTATCCGGAACCGCTGGTACGAGTTCTTC
AAGGCCACTCATTACTTTTTCGCCATTACCTTTGTCGTCTTCTTCTTCCTTCATTGCGGCGCCCGCCTGACGTCT
TGGGATTACTTCGTCGTCGCCGGCGTCATTTACCTGGCCTGCTTGCTTTGGGCGCTGGCCAAGACATTCCTGAAG
CACGGCACCGGTCTCAAGGCTCGCCTTCGCCTCGAGTCGCCCGACGCCTTGCGCATCGCCATTAATACCAAGTCC
AGCTGGCGCCCTGGCGACTATTTCTATCTTCGCTTCAAGACGTGCGGCCTGCACGCACTCACAACCCATCCCTTC
ACTGTTTCTTCGCTCCCGGACACCGATACTGGAGACCGGGAGCTGTTGGTCTATCTTCAGCCGCGGGCCGGCTTA
ACACGGAGGCTTGCCAGACTAGCCGAAAAGCAGCCCGACCTGGCTGTGGGCGTCCTGCTCGAGGGGCCGTACGGC
GGCTTGCCTGTGAGGTGGTACGCGGGCTTTGACCGCACACTCCTGATCGCCGGCGGCTCCGGCTGCGGCTTCACC
CTCCCTCTGATCCACGACTGGCTTCGCAGGCGAGACCCGTCCTCGACGAGGGAGCTCAGCGTCCTCCTCGCCACT
CGAGATCCCGGTATGCCCTCCTGGTACATGCACGAGTTACGGTGCTTGGTTGAGCGCGAGTGCGGCACCAATCCC
ACCGACATGTCCGAACTCAGCATCTCCATCTATCAGACCGGCGCGGCCACGACGACCGAGTCCGTGGCGCCGACC
CCCGCCTTCGCCCAGTCGGATGACAAGGAGAAGGGTCTCTGTGAGCCCCAAGTCCGCAATGAGACCGACTCGGTC
AAGTCTCTCTTCAACATCAACTTCTTGCGCGGGCGGCCAGACGCAGCCGCTGCCGTCGGCCGCTTATCCTCGCTG
GAGCCGCACGGCACCCTAGGCATCGCCGTGTGCGGACCAGCTGGTCTGGTACACGACGCGGCGGCGGCGGCGGCC
GAGCAGCAGCGAAGGATTCTGAGCGGCCAAAAGGGCGCATCTGAGGTCTGGTTCCACAAGGAGGCCTTTTCGTGC
TGA
Gene >Hirsu2|8205
ATGTGGCATCTGCCTCTCTTTCGCTCCAACCTGCAGTTCCATTCCTCTCGGGACCCCGGACACTGCAGACTCACA
GCAGAGCAGTGTGCCTTGAAGACGAGCCACTGGCTGTCTTGGTATTGCCACCGGCCACAGTCGTCCGTCGGGTCG
AGAGAAGAAACGAGGCCTTGCTGACCCTTTCTTTCTCCGGCACACAGGTTCGGGGCCGACCTCGCCTATTCAATT
CCGACCGTCTGCTTCTTCACCCTCGGCATCCTCTTCTTCGCCTTCGCCCGCATCATCTCCGAGAATGCCCCCGAG
AGCCTGGCCCGGACGGCGGCTTGGCGTCGCACCCTCTCGGCCTTGCGCTTCCTCGCCTACAAGAGCTGGCGCGTC
GGAAGGCGGAACTTGCAGCCCCTAGGCGTTCTTTTGATCGCCGCCCTCTGCGCCGCCTTCTTCCTCGCCATGGCC
CTCGGGCCCAGGCCCTACTACTGGCCCACGGATGCCCGTTACGGAGGCTCGCCTCCCCTCGCCATCCGCTCCGGC
TGGCTGGCCCTGGCCTGTCTGCCTTTCCTCTTCGCCCTGGCCGCCAAGGCCAATCTCGTGTCTGCCCTGACGGCC
GTGCCGCCGGACCGGCTCGCCCTCTGGCACGGCTGGGTCGCCTGGATCATGTACTTCTTGGCCGTCGCCCACGTC
GTTCCCTTCCTTGTTCTGCACAACGCAAAGGGCGACACGGCCGAGCAGTTTCGAAAGGGCAGCACCTGGCTGACG
GGCGTCATTGCCATTCTTGCCCAGACCTGGCTGACTCTCATGTCTATTTCACGTATCCGGTACGTCTGCTCTCAC
CGGTCTCCTCTCGTTGAGGCCGCGGGACAGCGGCCTGCTGTAGGGCCGAGACACTAAGCACCATCCATCTAGGAA
CCGCTGGTACGAGTTCTTCAAGGCCACTCATTACTTTTTCGCCATTACCTTTGTCGTCTTCTTCTTCCTTCATTG
CGGCGCCCGCCTGACGTCTTGGGATTACTTCGTCGTCGCCGGCGTCATTTACCTGGCCTGCTTGCTTTGGGCGCT
GGCCAAGACATTCCTGAAGCACGGCACCGGTCTCAAGGCTCGCCTTCGCCTCGAGTCGCCCGACGCCTTGCGCAT
CGCCATTAATACCAAGTCCAGCTGGCGCCCTGGCGACTATTTCTATCTTCGCTTCAAGACGTGCGGCCTGCACGC
ACTCACAACCCATCCCTTCACTGTTTCTTCGCTCCCGGACACCGATACTGGAGACCGGGAGCTGTTGGTCTATCT
TCAGCCGCGGGCCGGCTTAACACGGAGGCTTGCCAGACTAGCCGAAAAGCAGCCCGACCTGGCTGTGGGCGTCCT
GCTCGAGGGGCCGTACGGCGGCTTGCCTGTGAGGTGGTACGCGGGCTTTGACCGCACACTCCTGATCGCCGGCGG
CTCCGGCTGCGGCTTCACCCTCCCTCTGATCCACGACTGGCTTCGCAGGCGAGACCCGTCCTCGACGAGGGAGCT
CAGCGTCCTCCTCGCCACTCGAGATCCCGGTATGCCCTCCTGGTACATGCACGAGTTACGGTGCTTGGTTGAGCG
CGAGTGCGGCACCAATCCCACCGACATGTCCGAACTCAGCATCTCCATCTATCAGACCGGCGCGGCCACGACGAC
CGAGTCCGTGGCGCCGACCCCCGCCTTCGCCCAGTCGGATGACAAGGAGAAGGGTCTCTGTGAGCCCCAAGTCCG
CAATGAGACCGACTCGGTCAAGTCTCTCTTCAACATCAACTTCTTGCGCGGGCGGCCAGACGCAGCCGCTGCCGT
CGGCCGCTTATCCTCGCTGGAGCCGCACGGCACCCTAGGCATCGCCGTGTGCGGACCAGCTGGTCTGGTACACGA
CGCGGCGGCGGCGGCGGCCGAGCAGCAGCGAAGGATTCTGAGCGGCCAAAAGGGCGCATCTGAGGTCTGGTTCCA
CAAGGAGGCCTTTTCGTGAGTCTGCCGATACCCAGAGAGCCGGGACGATCAGACGTCGCTGACCCTGGCCCTAGG
TGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail