Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8203
Gene name
LocationContig_52:16380..18742
Strand-
Gene length (bp)2362
Transcript length (bp)2310
Coding sequence length (bp)2310
Protein length (aa) 770

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12066 DUF3546 Domain of unknown function (DUF3546) 1.7E-33 55 158
PF13821 DUF4187 Domain of unknown function (DUF4187) 1.4E-11 408 453
PF04959 ARS2 Arsenite-resistance protein 2 1.7E-09 517 709

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94326|YGK8_SCHPO Zinc finger protein C725.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.08 PE=1 SV=1 404 613 3.0E-17
sp|Q17FR9|SRRT_AEDAE Serrate RNA effector molecule homolog OS=Aedes aegypti GN=Ars2 PE=3 SV=1 187 634 6.0E-10
sp|Q60436|SRRT_CRIGR Serrate RNA effector molecule homolog (Fragment) OS=Cricetulus griseus GN=SRRT PE=2 SV=3 520 757 2.0E-06
sp|A4IFB1|SRRT_BOVIN Serrate RNA effector molecule homolog OS=Bos taurus GN=SRRT PE=2 SV=1 363 757 3.0E-06
sp|Q99MR6|SRRT_MOUSE Serrate RNA effector molecule homolog OS=Mus musculus GN=Srrt PE=1 SV=1 520 757 4.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94326|YGK8_SCHPO Zinc finger protein C725.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.08 PE=1 SV=1 404 613 3.0E-17
sp|Q17FR9|SRRT_AEDAE Serrate RNA effector molecule homolog OS=Aedes aegypti GN=Ars2 PE=3 SV=1 187 634 6.0E-10
sp|Q60436|SRRT_CRIGR Serrate RNA effector molecule homolog (Fragment) OS=Cricetulus griseus GN=SRRT PE=2 SV=3 520 757 2.0E-06
sp|A4IFB1|SRRT_BOVIN Serrate RNA effector molecule homolog OS=Bos taurus GN=SRRT PE=2 SV=1 363 757 3.0E-06
sp|Q99MR6|SRRT_MOUSE Serrate RNA effector molecule homolog OS=Mus musculus GN=Srrt PE=1 SV=1 520 757 4.0E-06
sp|Q9BXP5|SRRT_HUMAN Serrate RNA effector molecule homolog OS=Homo sapiens GN=SRRT PE=1 SV=1 520 757 6.0E-06
sp|Q5R539|SRRT_PONAB Serrate RNA effector molecule homolog OS=Pongo abelii GN=SRRT PE=2 SV=1 520 757 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8203
MVVNPLADPSRLPYQVGFSYFGEWWRLNEKIKDDKERARTGRRREPERNRGPRELQEEREKEKAKIQAAYDTYKE
ELQAKMARTFVAEHKKEQWFRERYVPDVRDDVKAKLNEIRRGAYSQWEQDLESGTFDHFSLEGLPKSESNGAGGV
VEKEEGEATASNEILGVGDLVPANGADIRDENQYQPTLLIKTIAPHVSRRNLEAFCKENLGEEEGGFKWLSLSDP
NPSKRYHRIGWVMLHPSSETAMPVDRADPKDDDGDELIKSPQPVSTADKALEAVNGKTVKDEVRGDFVCHVGVHN
PPNNPRKKALWDLFSAPERIEKDLLLVQRLVNKFEEEFGSDFQGVLKIEEKIYDLRNAGLLQPAVPSSTTKTKKV
REVAMDVAMDDEDGAVEEEEEEEEDGAIDDDDTDDEYLLIKKKQLDLLIEYLRRVFNFCFFCVFESDSIHELTRK
CPGGHLRRPRSTLSSTARSVARASANGEPFPFKKRSEAAEEGEAESAEADKKFRNTSTKTEQQLLRAYNWVKTFE
DKLMQILEPQSVDLRKLGGRAVGEAVDEELVKFVKQEDEHKWRCKVPECTKLFKEEHFWKKHVEKRHTEWLDGMK
QEFELINAYVMDPSHIAPSRTDANSNGHFPPTSGQSTTGTPRGFNLQNFSMNGMMGMPGFPMPPGGFPPMSAVMQ
TAGWNPMGDDRSGGVVRRGGMGGGRGQFRAGPYDRRGGHRWEGGGGRGRMGGSRWGDGAGGATGGPREAVQGRSL
KSYEDLDQVSGGGGGELNY*
Coding >Hirsu2|8203
ATGGTGGTGAATCCCCTCGCCGATCCGTCTCGACTACCCTACCAGGTCGGCTTCTCGTACTTTGGGGAGTGGTGG
CGACTGAACGAAAAGATCAAAGATGACAAAGAGCGAGCTCGCACAGGCCGCAGACGGGAGCCCGAGCGAAACCGA
GGCCCTCGTGAGCTGCAAGAGGAGCGCGAGAAGGAGAAGGCCAAGATCCAAGCAGCCTACGATACGTACAAGGAG
GAGCTCCAAGCCAAGATGGCGCGAACCTTTGTGGCGGAGCACAAGAAGGAGCAGTGGTTCAGGGAGCGATACGTC
CCAGATGTCAGAGACGACGTCAAGGCCAAGCTCAACGAGATTCGACGCGGTGCATATAGCCAGTGGGAACAAGAT
CTCGAGTCTGGTACGTTTGACCACTTCTCGCTCGAAGGCCTCCCCAAGAGCGAAAGCAACGGCGCCGGCGGCGTC
GTCGAGAAGGAAGAGGGCGAAGCGACTGCCAGCAACGAGATACTGGGCGTCGGCGATCTCGTTCCCGCCAACGGG
GCCGACATCCGTGACGAAAACCAGTACCAGCCCACCTTGCTCATCAAGACCATCGCCCCGCACGTCAGCCGCCGG
AACTTGGAAGCGTTCTGCAAGGAGAATCTCGGCGAGGAGGAGGGCGGTTTCAAGTGGCTGTCGCTGTCTGACCCC
AACCCCAGCAAACGGTACCACCGCATCGGTTGGGTCATGCTTCACCCCTCGTCCGAGACTGCGATGCCCGTCGAT
CGGGCCGACCCCAAGGATGACGACGGTGACGAACTGATCAAATCGCCGCAGCCCGTCTCCACTGCGGACAAGGCC
CTCGAGGCGGTAAACGGAAAGACGGTCAAGGACGAAGTGCGGGGAGACTTCGTCTGCCATGTCGGCGTGCACAAC
CCACCCAACAACCCGAGGAAGAAGGCGCTTTGGGACCTGTTCTCGGCCCCCGAGCGCATCGAGAAGGACCTTCTC
CTCGTCCAACGGCTGGTCAACAAGTTCGAGGAGGAGTTCGGATCCGACTTCCAGGGGGTTCTGAAGATTGAGGAG
AAGATCTACGATCTCCGCAATGCCGGGCTGCTACAGCCTGCTGTTCCGTCGTCGACGACCAAGACCAAAAAGGTG
CGGGAGGTGGCCATGGATGTGGCCATGGACGACGAAGACGGCGCTGTCGAGGAGGAGGAGGAGGAGGAGGAGGAC
GGAGCGATTGACGATGACGACACGGACGATGAGTATTTGCTCATCAAGAAGAAACAGTTGGATCTCCTGATCGAA
TATCTGCGTCGAGTCTTCAACTTCTGCTTCTTCTGCGTGTTTGAGAGCGACTCGATCCACGAGCTCACCCGGAAG
TGCCCCGGCGGCCACCTGCGCCGACCCAGAAGCACGCTCTCGTCGACGGCGCGGTCGGTAGCTCGAGCGAGCGCC
AATGGCGAACCGTTCCCCTTCAAGAAGCGCAGCGAGGCGGCCGAGGAAGGTGAGGCGGAATCGGCCGAGGCGGAC
AAGAAGTTCCGAAACACGTCGACCAAGACGGAACAGCAGCTTCTTCGGGCCTACAACTGGGTCAAGACGTTTGAA
GATAAGTTGATGCAGATCCTGGAGCCGCAGTCGGTCGATCTCCGCAAGCTGGGCGGACGGGCTGTGGGCGAAGCC
GTGGACGAGGAGCTCGTCAAGTTTGTCAAGCAGGAAGACGAGCACAAGTGGCGCTGCAAGGTCCCCGAGTGCACC
AAGCTGTTTAAGGAAGAGCACTTTTGGAAAAAGCACGTGGAGAAGAGACACACGGAGTGGCTGGACGGCATGAAG
CAGGAGTTTGAGCTCATCAACGCCTACGTCATGGATCCGTCGCACATCGCGCCGTCGCGAACGGATGCCAACTCG
AACGGCCACTTCCCGCCGACGAGCGGGCAGTCGACGACGGGCACGCCGCGGGGCTTCAACCTGCAGAACTTCTCG
ATGAACGGCATGATGGGGATGCCAGGCTTCCCCATGCCGCCGGGCGGGTTCCCGCCCATGTCTGCCGTGATGCAG
ACGGCCGGGTGGAACCCGATGGGCGACGACCGCTCTGGCGGAGTGGTGCGGCGAGGCGGAATGGGCGGGGGCCGC
GGGCAGTTCCGGGCCGGGCCCTACGATCGACGCGGCGGGCACCGCTGGGAGGGCGGCGGCGGACGAGGCCGCATG
GGCGGATCCCGATGGGGAGACGGGGCCGGCGGAGCGACGGGCGGACCACGGGAGGCGGTGCAGGGCAGAAGCCTG
AAGAGCTACGAGGACCTCGACCAGGTCTCGGGCGGAGGCGGCGGGGAACTCAATTACTGA
Transcript >Hirsu2|8203
ATGGTGGTGAATCCCCTCGCCGATCCGTCTCGACTACCCTACCAGGTCGGCTTCTCGTACTTTGGGGAGTGGTGG
CGACTGAACGAAAAGATCAAAGATGACAAAGAGCGAGCTCGCACAGGCCGCAGACGGGAGCCCGAGCGAAACCGA
GGCCCTCGTGAGCTGCAAGAGGAGCGCGAGAAGGAGAAGGCCAAGATCCAAGCAGCCTACGATACGTACAAGGAG
GAGCTCCAAGCCAAGATGGCGCGAACCTTTGTGGCGGAGCACAAGAAGGAGCAGTGGTTCAGGGAGCGATACGTC
CCAGATGTCAGAGACGACGTCAAGGCCAAGCTCAACGAGATTCGACGCGGTGCATATAGCCAGTGGGAACAAGAT
CTCGAGTCTGGTACGTTTGACCACTTCTCGCTCGAAGGCCTCCCCAAGAGCGAAAGCAACGGCGCCGGCGGCGTC
GTCGAGAAGGAAGAGGGCGAAGCGACTGCCAGCAACGAGATACTGGGCGTCGGCGATCTCGTTCCCGCCAACGGG
GCCGACATCCGTGACGAAAACCAGTACCAGCCCACCTTGCTCATCAAGACCATCGCCCCGCACGTCAGCCGCCGG
AACTTGGAAGCGTTCTGCAAGGAGAATCTCGGCGAGGAGGAGGGCGGTTTCAAGTGGCTGTCGCTGTCTGACCCC
AACCCCAGCAAACGGTACCACCGCATCGGTTGGGTCATGCTTCACCCCTCGTCCGAGACTGCGATGCCCGTCGAT
CGGGCCGACCCCAAGGATGACGACGGTGACGAACTGATCAAATCGCCGCAGCCCGTCTCCACTGCGGACAAGGCC
CTCGAGGCGGTAAACGGAAAGACGGTCAAGGACGAAGTGCGGGGAGACTTCGTCTGCCATGTCGGCGTGCACAAC
CCACCCAACAACCCGAGGAAGAAGGCGCTTTGGGACCTGTTCTCGGCCCCCGAGCGCATCGAGAAGGACCTTCTC
CTCGTCCAACGGCTGGTCAACAAGTTCGAGGAGGAGTTCGGATCCGACTTCCAGGGGGTTCTGAAGATTGAGGAG
AAGATCTACGATCTCCGCAATGCCGGGCTGCTACAGCCTGCTGTTCCGTCGTCGACGACCAAGACCAAAAAGGTG
CGGGAGGTGGCCATGGATGTGGCCATGGACGACGAAGACGGCGCTGTCGAGGAGGAGGAGGAGGAGGAGGAGGAC
GGAGCGATTGACGATGACGACACGGACGATGAGTATTTGCTCATCAAGAAGAAACAGTTGGATCTCCTGATCGAA
TATCTGCGTCGAGTCTTCAACTTCTGCTTCTTCTGCGTGTTTGAGAGCGACTCGATCCACGAGCTCACCCGGAAG
TGCCCCGGCGGCCACCTGCGCCGACCCAGAAGCACGCTCTCGTCGACGGCGCGGTCGGTAGCTCGAGCGAGCGCC
AATGGCGAACCGTTCCCCTTCAAGAAGCGCAGCGAGGCGGCCGAGGAAGGTGAGGCGGAATCGGCCGAGGCGGAC
AAGAAGTTCCGAAACACGTCGACCAAGACGGAACAGCAGCTTCTTCGGGCCTACAACTGGGTCAAGACGTTTGAA
GATAAGTTGATGCAGATCCTGGAGCCGCAGTCGGTCGATCTCCGCAAGCTGGGCGGACGGGCTGTGGGCGAAGCC
GTGGACGAGGAGCTCGTCAAGTTTGTCAAGCAGGAAGACGAGCACAAGTGGCGCTGCAAGGTCCCCGAGTGCACC
AAGCTGTTTAAGGAAGAGCACTTTTGGAAAAAGCACGTGGAGAAGAGACACACGGAGTGGCTGGACGGCATGAAG
CAGGAGTTTGAGCTCATCAACGCCTACGTCATGGATCCGTCGCACATCGCGCCGTCGCGAACGGATGCCAACTCG
AACGGCCACTTCCCGCCGACGAGCGGGCAGTCGACGACGGGCACGCCGCGGGGCTTCAACCTGCAGAACTTCTCG
ATGAACGGCATGATGGGGATGCCAGGCTTCCCCATGCCGCCGGGCGGGTTCCCGCCCATGTCTGCCGTGATGCAG
ACGGCCGGGTGGAACCCGATGGGCGACGACCGCTCTGGCGGAGTGGTGCGGCGAGGCGGAATGGGCGGGGGCCGC
GGGCAGTTCCGGGCCGGGCCCTACGATCGACGCGGCGGGCACCGCTGGGAGGGCGGCGGCGGACGAGGCCGCATG
GGCGGATCCCGATGGGGAGACGGGGCCGGCGGAGCGACGGGCGGACCACGGGAGGCGGTGCAGGGCAGAAGCCTG
AAGAGCTACGAGGACCTCGACCAGGTCTCGGGCGGAGGCGGCGGGGAACTCAATTACTGA
Gene >Hirsu2|8203
ATGGTGGTGAATCCCCTCGCCGATCCGTCTCGACTACCCTACCAGGTCGGCTTCTCGTACTTTGGGGAGTGGTGG
CGACTGAACGAAAAGATCAAAGATGACAAAGAGCGAGCTCGCACAGGCCGCAGACGGGAGCCCGAGCGAAACCGA
GGCCCTCGTGAGCTGCAAGAGGAGCGCGAGAAGGAGAAGGCCAAGATCCAAGCAGCCTACGATACGTACAAGGAG
GAGCTCCAAGCCAAGATGGCGCGAACCTTTGTGGCGGAGCACAAGAAGGAGCAGTGGTTCAGGGAGCGATACGTC
CCAGATGTCAGAGACGACGTCAAGGCCAAGCTCAACGAGATTCGACGCGGTGCATATAGCCAGTGGGAACAAGAT
CTCGAGTCTGGTACGTTTGACCACTTCTCGCTCGAAGGCCTCCCCAAGAGCGAAAGCAACGGCGCCGGCGGCGTC
GTCGAGAAGGAAGAGGGCGAAGCGACTGCCAGCAACGAGATACTGGGCGTCGGCGATCTCGTTCCCGCCAACGGG
GCCGACATCCGTGACGAAAACCAGTACCAGCCCACCTTGCTCATCAAGACCATCGCCCCGCACGTCAGCCGCCGG
AACTTGGAAGCGTTCTGCAAGGAGAATCTCGGCGAGGAGGAGGGCGGTTTCAAGTGGCTGTCGCTGTCTGACCCC
AACCCCAGCAAACGGTACCACCGCATCGGTTGGGTCATGCTTCACCCCTCGTCCGAGACTGCGATGCCCGTCGAT
CGGGCCGACCCCAAGGATGACGACGGTGACGAACTGATCAAATCGCCGCAGCCCGTCTCCACTGCGGACAAGGCC
CTCGAGGCGGTAAACGGAAAGACGGTCAAGGACGAAGTGCGGGGAGACTTCGTCTGCCATGTCGGCGTGCACAAC
CCACCCAACAACCCGAGGAAGAAGGCGCTTTGGGACCTGTTCTCGGCCCCCGAGCGCATCGAGAAGGACCTTCTC
CTCGTCCAACGGCTGGTCAACAAGTTCGAGGAGGAGTTCGGATCCGACTTCCAGGGGGTTCTGAAGATTGAGGAG
AAGATCTACGATCTCCGCAATGCCGGGCTGCTACAGCCTGCTGTTCCGTCGTCGACGACCAAGACCAAAAAGGTG
CGGGAGGTGGCCATGGATGTGGCCATGGACGACGAAGACGGCGCTGTCGAGGAGGAGGAGGAGGAGGAGGAGGAC
GGAGCGATTGACGATGACGACACGGACGATGAGTATTTGCTCATCAAGAAGAAACAGTTGGATCTCCTGATCGAA
TATCTGCGTCGAGTCTTCAACTTCTGCTTCTTCTGCGTGTTTGAGAGCGACTCGATCCACGAGCTCACCCGGAAG
TGCCCCGGCGGCCACCTGCGCCGACCCAGAAGCACGCTCTCGTCGACGGCGCGGTCGGTAGCTCGAGCGAGCGCC
AATGGCGAACCGTTCCCCTTCAAGAAGCGCAGCGAGGCGGCCGAGGAAGGTGAGGCGGAATCGGCCGAGGCGGAC
AAGAAGTTCCGAAACACGTCGACCAAGACGGAACAGCAGCTTCTTCGGGCCTACAACTGGGTCAAGACGTTTGAA
GATAAGTTGATGCAGATCCTGGAGCCGCAGTCGGTCGATCTCCGCAAGCTGGGCGGACGGGCTGTGGGCGAAGCC
GTGGACGAGGAGCTCGTCAAGTTTGTCAAGCAGGAAGACGAGCACAAGTGGCGCTGCAAGGTCCCCGAGTGCACC
AAGCTGTTTAAGGAAGAGCACTTTTGGAAAAAGCACGTGGAGAAGAGACACACGGAGTGGCTGGACGGCATGAAG
CAGGAGGTAAGAGAGACAAGGCCGTCGAGAGGTGTACAATCTGACGGCGACGGCATAGTTTGAGCTCATCAACGC
CTACGTCATGGATCCGTCGCACATCGCGCCGTCGCGAACGGATGCCAACTCGAACGGCCACTTCCCGCCGACGAG
CGGGCAGTCGACGACGGGCACGCCGCGGGGCTTCAACCTGCAGAACTTCTCGATGAACGGCATGATGGGGATGCC
AGGCTTCCCCATGCCGCCGGGCGGGTTCCCGCCCATGTCTGCCGTGATGCAGACGGCCGGGTGGAACCCGATGGG
CGACGACCGCTCTGGCGGAGTGGTGCGGCGAGGCGGAATGGGCGGGGGCCGCGGGCAGTTCCGGGCCGGGCCCTA
CGATCGACGCGGCGGGCACCGCTGGGAGGGCGGCGGCGGACGAGGCCGCATGGGCGGATCCCGATGGGGAGACGG
GGCCGGCGGAGCGACGGGCGGACCACGGGAGGCGGTGCAGGGCAGAAGCCTGAAGAGCTACGAGGACCTCGACCA
GGTCTCGGGCGGAGGCGGCGGGGAACTCAATTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail