Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8202
Gene name
LocationContig_52:14443..15775
Strand-
Gene length (bp)1332
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01585 G-patch G-patch domain 4.4E-06 27 77

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HFA6|PXR1_CHAGB Protein PXR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PXR1 PE=3 SV=2 1 145 1.0E-53
sp|A4R0T9|PXR1_MAGO7 Protein PXR1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PXR1 PE=3 SV=1 1 207 1.0E-51
sp|Q7SHT5|PXR1_NEUCR Protein pxr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pxr-1 PE=3 SV=1 1 150 3.0E-46
sp|A7EFS3|PXR1_SCLS1 Protein pxr1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pxr1 PE=3 SV=1 1 146 5.0E-46
sp|A6RIE1|PXR1_BOTFB Protein pxr1 OS=Botryotinia fuckeliana (strain B05.10) GN=pxr1 PE=3 SV=1 1 146 1.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HFA6|PXR1_CHAGB Protein PXR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PXR1 PE=3 SV=2 1 145 1.0E-53
sp|A4R0T9|PXR1_MAGO7 Protein PXR1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PXR1 PE=3 SV=1 1 207 1.0E-51
sp|Q7SHT5|PXR1_NEUCR Protein pxr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pxr-1 PE=3 SV=1 1 150 3.0E-46
sp|A7EFS3|PXR1_SCLS1 Protein pxr1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pxr1 PE=3 SV=1 1 146 5.0E-46
sp|A6RIE1|PXR1_BOTFB Protein pxr1 OS=Botryotinia fuckeliana (strain B05.10) GN=pxr1 PE=3 SV=1 1 146 1.0E-45
sp|A2R156|PXR1_ASPNC Protein pxr1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pxr1 PE=3 SV=1 1 137 1.0E-41
sp|A6R371|PXR1_AJECN Protein PXR1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=PXR1 PE=3 SV=1 1 138 2.0E-41
sp|A1CD56|PXR1_ASPCL Protein pxr1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pxr1 PE=3 SV=2 1 197 7.0E-41
sp|Q0CU52|PXR1_ASPTN Protein pxr1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pxr1 PE=3 SV=2 1 143 1.0E-40
sp|Q1DQE9|PXR1_COCIM Protein PXR1 OS=Coccidioides immitis (strain RS) GN=PXR1 PE=3 SV=2 1 138 1.0E-40
sp|Q2UDW7|PXR1_ASPOR Protein pxr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pxr1 PE=3 SV=1 1 147 2.0E-40
sp|Q4WG40|PXR1_ASPFU Protein pxr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pxr1 PE=3 SV=1 1 150 2.0E-39
sp|A1DC33|PXR1_NEOFI Protein pxr1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pxr1 PE=3 SV=1 1 150 8.0E-39
sp|Q0UWF6|PXR1_PHANO Protein PXR1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PXR1 PE=3 SV=1 1 142 7.0E-30
sp|Q751P0|PXR1_ASHGO Protein PXR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PXR1 PE=3 SV=1 1 150 2.0E-18
sp|Q6BUE3|PXR1_DEBHA Protein PXR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PXR1 PE=3 SV=1 1 137 3.0E-18
sp|P53335|PXR1_YEAST Protein PXR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PXR1 PE=1 SV=1 1 137 7.0E-18
sp|A6ZUT6|PXR1_YEAS7 Protein PXR1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PXR1 PE=3 SV=1 1 137 8.0E-18
sp|A5DRH5|PXR1_PICGU Protein PXR1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PXR1 PE=3 SV=2 1 163 1.0E-17
sp|Q6CTA7|PXR1_KLULA Protein PXR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PXR1 PE=3 SV=1 1 137 1.0E-17
sp|Q6FTR8|PXR1_CANGA Protein PXR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PXR1 PE=3 SV=1 1 134 1.0E-16
sp|Q5A660|PXR1_CANAL Protein PXR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PXR1 PE=3 SV=1 1 172 1.0E-15
sp|A7TG30|PXR1_VANPO Protein PXR1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PXR1 PE=3 SV=1 1 137 2.0E-15
sp|Q6C1L3|PXR1_YARLI Protein PXR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PXR1 PE=3 SV=1 1 139 9.0E-15
sp|Q9URX9|PXR1_SCHPO Protein pxr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pxr1 PE=1 SV=1 1 100 3.0E-13
sp|A4L691|PINX1_RAT PIN2/TERF1-interacting telomerase inhibitor 1 OS=Rattus norvegicus GN=Pinx1 PE=1 SV=1 1 99 4.0E-11
sp|Q9CZX5|PINX1_MOUSE PIN2/TERF1-interacting telomerase inhibitor 1 OS=Mus musculus GN=Pinx1 PE=1 SV=2 1 99 8.0E-11
sp|Q96BK5|PINX1_HUMAN PIN2/TERF1-interacting telomerase inhibitor 1 OS=Homo sapiens GN=PINX1 PE=1 SV=2 1 99 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8202
MGMLAESKSRRKICKDPNNTKWTRDTTTFGHKIMRAQGWEPGQYLGAKDAAHAELHSAANASYIRVSLKDDVKGL
GYNKAKEDEVTGLDVFSDLLSRLNGKADEDIEDDRQARLVIKTNRYVEQKWGPMRFVCGGLLVGDNMDETTASHD
DDDDEAQGEKSKKSKKRKLGEAGPEQGDDTATAEGDKKRRKEERRARRALAKAAPETPEDSTAPSEDPTGPRKKR
KRDKSSSGAAPADGEQAKAETSDDKSLAKPRGSKSKNKRPTSPAAEVLPQETGEAKRAKRDRTEKKAKTERAEKK
EKKDRTEKRDKREKKEKRRRKAAEAEAFEPRPSEATAEEQEGATGTGTPTDGATTGTSTPRGSRNFVRSRFIAAK
RQAMLDTTALNQIFMIKA*
Coding >Hirsu2|8202
ATGGGGATGCTGGCTGAATCCAAGAGCCGGAGGAAAATCTGCAAAGACCCGAACAACACAAAATGGACGCGCGAC
ACGACGACGTTTGGGCACAAGATCATGCGGGCGCAGGGCTGGGAGCCGGGCCAGTACCTCGGAGCCAAGGACGCG
GCGCACGCGGAGCTGCACTCGGCGGCCAATGCGTCGTACATCCGCGTCTCGCTGAAGGACGACGTCAAGGGGCTC
GGCTACAACAAGGCCAAGGAGGACGAGGTGACGGGGCTCGACGTCTTCTCCGACCTGCTGAGCCGGCTCAACGGC
AAGGCGGACGAGGACATCGAGGACGACAGGCAGGCCAGGCTGGTCATCAAGACCAACCGGTACGTGGAGCAGAAA
TGGGGACCCATGCGTTTCGTCTGTGGCGGCCTCCTGGTGGGCGACAACATGGATGAAACGACCGCCTCACACGAC
GACGACGACGACGAGGCCCAGGGCGAGAAGAGCAAGAAGAGCAAGAAGCGGAAGCTTGGCGAGGCTGGGCCCGAG
CAAGGGGACGACACGGCCACGGCAGAAGGGGACAAGAAGCGGCGCAAGGAAGAAAGGAGGGCGAGGAGAGCGCTG
GCCAAGGCGGCGCCGGAAACGCCGGAGGATTCGACGGCACCGAGCGAGGACCCGACGGGTCCGAGGAAGAAACGG
AAGAGGGACAAGAGCTCGTCGGGCGCGGCGCCTGCGGACGGCGAGCAAGCCAAGGCCGAAACCTCAGACGACAAG
TCACTGGCGAAGCCGCGCGGCTCGAAATCCAAGAACAAGCGGCCGACGTCGCCGGCGGCGGAAGTCTTGCCGCAA
GAGACGGGCGAAGCCAAGAGGGCGAAGAGGGACAGGACAGAGAAGAAGGCGAAGACAGAGCGGGCAGAGAAGAAG
GAGAAGAAGGACAGGACGGAGAAGAGGGACAAGAGGGAGAAGAAAGAGAAGAGGCGGCGGAAGGCGGCGGAGGCA
GAGGCTTTCGAGCCCCGGCCGTCCGAGGCGACGGCGGAAGAGCAAGAAGGCGCAACGGGGACGGGGACGCCGACG
GACGGCGCTACCACGGGCACGTCGACGCCAAGGGGCAGCCGGAACTTTGTCCGGTCGCGGTTCATCGCGGCCAAG
AGGCAGGCGATGCTGGACACGACGGCACTGAACCAGATATTTATGATCAAGGCTTGA
Transcript >Hirsu2|8202
ATGGGGATGCTGGCTGAATCCAAGAGCCGGAGGAAAATCTGCAAAGACCCGAACAACACAAAATGGACGCGCGAC
ACGACGACGTTTGGGCACAAGATCATGCGGGCGCAGGGCTGGGAGCCGGGCCAGTACCTCGGAGCCAAGGACGCG
GCGCACGCGGAGCTGCACTCGGCGGCCAATGCGTCGTACATCCGCGTCTCGCTGAAGGACGACGTCAAGGGGCTC
GGCTACAACAAGGCCAAGGAGGACGAGGTGACGGGGCTCGACGTCTTCTCCGACCTGCTGAGCCGGCTCAACGGC
AAGGCGGACGAGGACATCGAGGACGACAGGCAGGCCAGGCTGGTCATCAAGACCAACCGGTACGTGGAGCAGAAA
TGGGGACCCATGCGTTTCGTCTGTGGCGGCCTCCTGGTGGGCGACAACATGGATGAAACGACCGCCTCACACGAC
GACGACGACGACGAGGCCCAGGGCGAGAAGAGCAAGAAGAGCAAGAAGCGGAAGCTTGGCGAGGCTGGGCCCGAG
CAAGGGGACGACACGGCCACGGCAGAAGGGGACAAGAAGCGGCGCAAGGAAGAAAGGAGGGCGAGGAGAGCGCTG
GCCAAGGCGGCGCCGGAAACGCCGGAGGATTCGACGGCACCGAGCGAGGACCCGACGGGTCCGAGGAAGAAACGG
AAGAGGGACAAGAGCTCGTCGGGCGCGGCGCCTGCGGACGGCGAGCAAGCCAAGGCCGAAACCTCAGACGACAAG
TCACTGGCGAAGCCGCGCGGCTCGAAATCCAAGAACAAGCGGCCGACGTCGCCGGCGGCGGAAGTCTTGCCGCAA
GAGACGGGCGAAGCCAAGAGGGCGAAGAGGGACAGGACAGAGAAGAAGGCGAAGACAGAGCGGGCAGAGAAGAAG
GAGAAGAAGGACAGGACGGAGAAGAGGGACAAGAGGGAGAAGAAAGAGAAGAGGCGGCGGAAGGCGGCGGAGGCA
GAGGCTTTCGAGCCCCGGCCGTCCGAGGCGACGGCGGAAGAGCAAGAAGGCGCAACGGGGACGGGGACGCCGACG
GACGGCGCTACCACGGGCACGTCGACGCCAAGGGGCAGCCGGAACTTTGTCCGGTCGCGGTTCATCGCGGCCAAG
AGGCAGGCGATGCTGGACACGACGGCACTGAACCAGATATTTATGATCAAGGCTTGA
Gene >Hirsu2|8202
ATGGGGATGCTGGCTGAATCCAAGAGGTACCTACCTAGTTTTTTTTCCATCTTTTTTTTTTCTGTCCAGCCCGCC
CTCGTTCGCGGAAGACTGGCGCTGACGACCGAGACTATGCTAGCCGGAGGAAAATCTGCAAAGACCCGAACAACA
CAAAATGGACGCGCGACACGACGACGTTTGGGCACAAGATCATGCGGGCGCAGGGCTGGGAGCCGGGCCAGTACC
TCGGAGCCAAGGACGCGGCGCACGCGGAGCTGCACTCGGCGGCCAATGCGTCGTACATCCGCGTCTCGCTGAAGG
ACGACGTCAAGGGGCTCGGCTACAACAAGGCCAAGGAGGACGAGGTGACGGGGCTCGACGTCTTCTCCGACCTGC
TGAGCCGGCTCAACGGCAAGGCGGACGAGGACATCGAGGACGACAGGCAGGCCAGGCTGGTCATCAAGACCAACC
GGTACGTGGAGCAGAAATGGGGACCCATGCGTTTCGTCTGTGGCGGCCTCCTGGTGGGCGACAACATGGATGAAA
CGACCGCCTCACACGACGACGACGACGACGAGGCCCAGGGCGAGAAGAGCAAGAAGAGCAAGAAGCGGAAGCTTG
GCGAGGCTGGGCCCGAGCAAGGGGACGACACGGCCACGGCAGAAGGGGACAAGAAGCGGCGCAAGGAAGAAAGGA
GGGCGAGGAGAGCGCTGGCCAAGGCGGCGCCGGAAACGCCGGAGGATTCGACGGCACCGAGCGAGGACCCGACGG
GTCCGAGGAAGAAACGGAAGAGGGACAAGAGCTCGTCGGGCGCGGCGCCTGCGGACGGCGAGCAAGCCAAGGCCG
AAACCTCAGACGACAAGTCACTGGCGAAGCCGCGCGGCTCGAAATCCAAGAACAAGCGGCCGACGTCGCCGGCGG
CGGAAGTCTTGCCGCAAGAGACGGGCGAAGCCAAGAGGGCGAAGAGGGACAGGACAGAGAAGAAGGCGAAGACAG
AGCGGGCAGAGAAGAAGGAGAAGAAGGACAGGACGGAGAAGAGGGACAAGAGGGAGAAGAAAGAGAAGAGGCGGC
GGAAGGCGGCGGAGGCAGAGGCTTTCGAGCCCCGGCCGTCCGAGGCGACGGCGGAAGAGCAAGAAGGCGCAACGG
GGACGGGGACGCCGACGGACGGCGCTACCACGGGCACGTCGACGCCAAGGGGCAGCCGGAACTTTGTCCGGTCGC
GGTTCATCGCGGCCAAGAGGCAGGCGATGCTGGACACGACGGCACTGAACCAGGTTTGAGCGCCCGCGGCATCAA
CCTATACGACGACGGGACGGCTAACGGTTGCTACAGATATTTATGATCAAGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail