Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8199
Gene name
LocationContig_52:8562..9675
Strand-
Gene length (bp)1113
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08508 DUF1746 Fungal domain of unknown function (DUF1746) 1.8E-38 78 192

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14175|DSC4_SCHPO DSC E3 ubiquitin ligase complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsc4 PE=1 SV=1 74 195 2.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 79 101 22
2 128 150 22
3 173 195 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8199
MSHDPPPPATARDQPASADATQDDTPAAAEPLDDHAASASASGSRSASRHHRKRKSKKKRNPGLAKKLAFLTHLL
KTLDLVVFAELSALYYMECSLFRFLVRAAGQYMYLTPKDESFPFLMPATRVHVLLIVVPNIICIMSHLFSALPVG
PDFHRGYQHGGLIVDFIGQRPPAYRLYYLLADVIILAVQCLMLTIHTERENLRATLKTFRPIFPLVPETVAARSP
EDLDAEERGVSRSPPEILRDEVDGIELQPLGRLRAAGEGGQASQDSAPLLPDASSGVAPGTPLSDIMTSGNAILG
EYHVLHSLLSATIGLERTAAHSLQTISYGATLAALQARRRADSTQA*
Coding >Hirsu2|8199
ATGAGCCATGATCCTCCGCCTCCCGCGACGGCGCGAGACCAGCCGGCGTCCGCAGATGCTACCCAGGACGACACC
CCCGCCGCCGCCGAGCCGCTCGACGACCATGCCGCCTCCGCCTCCGCCTCGGGCTCGCGCTCTGCTTCGCGCCAC
CATCGCAAGAGGAAGAGCAAGAAGAAGCGGAACCCCGGGCTCGCCAAGAAGCTCGCCTTCCTCACCCACCTGCTC
AAGACGCTCGACCTCGTCGTCTTTGCCGAGCTGAGCGCCCTGTACTACATGGAGTGCTCTCTCTTTCGTTTCCTC
GTGCGCGCGGCCGGCCAGTACATGTACCTGACGCCCAAGGACGAGTCGTTTCCATTCCTCATGCCCGCCACCCGG
GTCCACGTCTTGCTCATCGTCGTGCCCAACATCATCTGCATCATGTCGCATCTCTTCAGCGCCTTGCCCGTCGGA
CCCGACTTTCATCGAGGCTACCAGCACGGCGGCCTCATCGTCGATTTCATCGGTCAGCGACCTCCAGCCTACCGA
CTGTACTATCTCCTCGCCGATGTCATAATTCTCGCCGTCCAGTGCTTGATGTTGACGATTCACACGGAGCGCGAG
AACTTGCGCGCCACCCTCAAGACCTTCCGTCCCATATTCCCCCTCGTCCCAGAGACGGTGGCCGCCCGCTCCCCG
GAGGATCTGGACGCCGAGGAGCGCGGCGTCTCGAGGAGCCCGCCAGAGATTCTTCGGGACGAAGTCGACGGCATC
GAGCTCCAACCCCTCGGCCGACTCAGGGCCGCGGGCGAAGGCGGCCAAGCGTCTCAAGACTCGGCGCCCTTGTTA
CCGGACGCCTCCTCCGGCGTCGCGCCCGGGACACCATTGTCCGACATCATGACGTCGGGCAACGCGATTCTCGGC
GAGTATCACGTCCTGCACTCGCTGCTGTCGGCGACGATAGGCTTGGAACGGACCGCCGCGCACTCCCTCCAGACC
ATCAGCTACGGCGCTACCTTGGCCGCTCTGCAGGCTCGACGACGGGCCGACTCCACGCAGGCCTGA
Transcript >Hirsu2|8199
ATGAGCCATGATCCTCCGCCTCCCGCGACGGCGCGAGACCAGCCGGCGTCCGCAGATGCTACCCAGGACGACACC
CCCGCCGCCGCCGAGCCGCTCGACGACCATGCCGCCTCCGCCTCCGCCTCGGGCTCGCGCTCTGCTTCGCGCCAC
CATCGCAAGAGGAAGAGCAAGAAGAAGCGGAACCCCGGGCTCGCCAAGAAGCTCGCCTTCCTCACCCACCTGCTC
AAGACGCTCGACCTCGTCGTCTTTGCCGAGCTGAGCGCCCTGTACTACATGGAGTGCTCTCTCTTTCGTTTCCTC
GTGCGCGCGGCCGGCCAGTACATGTACCTGACGCCCAAGGACGAGTCGTTTCCATTCCTCATGCCCGCCACCCGG
GTCCACGTCTTGCTCATCGTCGTGCCCAACATCATCTGCATCATGTCGCATCTCTTCAGCGCCTTGCCCGTCGGA
CCCGACTTTCATCGAGGCTACCAGCACGGCGGCCTCATCGTCGATTTCATCGGTCAGCGACCTCCAGCCTACCGA
CTGTACTATCTCCTCGCCGATGTCATAATTCTCGCCGTCCAGTGCTTGATGTTGACGATTCACACGGAGCGCGAG
AACTTGCGCGCCACCCTCAAGACCTTCCGTCCCATATTCCCCCTCGTCCCAGAGACGGTGGCCGCCCGCTCCCCG
GAGGATCTGGACGCCGAGGAGCGCGGCGTCTCGAGGAGCCCGCCAGAGATTCTTCGGGACGAAGTCGACGGCATC
GAGCTCCAACCCCTCGGCCGACTCAGGGCCGCGGGCGAAGGCGGCCAAGCGTCTCAAGACTCGGCGCCCTTGTTA
CCGGACGCCTCCTCCGGCGTCGCGCCCGGGACACCATTGTCCGACATCATGACGTCGGGCAACGCGATTCTCGGC
GAGTATCACGTCCTGCACTCGCTGCTGTCGGCGACGATAGGCTTGGAACGGACCGCCGCGCACTCCCTCCAGACC
ATCAGCTACGGCGCTACCTTGGCCGCTCTGCAGGCTCGACGACGGGCCGACTCCACGCAGGCCTGA
Gene >Hirsu2|8199
ATGAGCCATGATCCTCCGCCTCCCGCGACGGCGCGAGACCAGCCGGCGTCCGCAGATGCTACCCAGGACGACACC
CCCGCCGCCGCCGAGCCGCTCGACGACCATGCCGCCTCCGCCTCCGCCTCGGGCTCGCGCTCTGCTTCGCGCCAC
CATCGCAAGAGGAAGAGCAAGAAGAAGCGGAACCCCGGGCTCGCCAAGAAGCTCGCCTTCCTCACCCACCTGCTC
AAGACGCTCGACCTCGTCGTCTTTGCCGAGCTGAGCGCCCTGTACTACATGGAGTGAGTGCTGCCTCCGTCGTGC
CTCCGCCGGCCCCCACGCCACCACGCTGACCGTCGCCGTCCGTCCACAAGGTGCTCTCTCTTTCGTTTCCTCGTG
CGCGCGGCCGGCCAGTACATGTACCTGACGCCCAAGGACGAGTCGTTTCCATTCCTCATGCCCGCCACCCGGGTC
CACGTCTTGCTCATCGTCGTGCCCAACATCATCTGCATCATGTCGCATCTCTTCAGCGCCTTGCCCGTCGGACCC
GACTTTCATCGAGGCTACCAGCACGGCGGCCTCATCGTCGATTTCATCGGTCAGCGACCTCCAGCCTACCGACTG
TACTATCTCCTCGCCGATGTCATAATTCTCGCCGTCCAGTGCTTGATGTTGACGATTCACACGGAGCGCGAGAAC
TTGCGCGCCACCCTCAAGACCTTCCGTCCCATATTCCCCCTCGTCCCAGAGACGGTGGCCGCCCGCTCCCCGGAG
GATCTGGACGCCGAGGAGCGCGGCGTCTCGAGGAGCCCGCCAGAGATTCTTCGGGACGAAGTCGACGGCATCGAG
CTCCAACCCCTCGGCCGACTCAGGGCCGCGGGCGAAGGCGGCCAAGCGTCTCAAGACTCGGCGCCCTTGTTACCG
GACGCCTCCTCCGGCGTCGCGCCCGGGACACCATTGTCCGACATCATGACGTCGGGCAACGCGATTCTCGGCGAG
TATCACGTCCTGCACTCGCTGCTGTCGGCGACGATAGGCTTGGAACGGACCGCCGCGCACTCCCTCCAGACCATC
AGCTACGGCGCTACCTTGGCCGCTCTGCAGGCTCGACGACGGGCCGACTCCACGCAGGCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail