Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8198
Gene name
LocationContig_52:7237..8449
Strand+
Gene length (bp)1212
Transcript length (bp)1212
Coding sequence length (bp)1212
Protein length (aa) 404

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05189 RTC_insert RNA 3'-terminal phosphate cyclase (RTC), insert domain 1.1E-29 209 319
PF01137 RTC RNA 3'-terminal phosphate cyclase 8.9E-28 10 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08096|RCL1_YEAST RNA 3'-terminal phosphate cyclase-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCL1 PE=1 SV=1 1 403 1.0E-65
sp|Q9JJT0|RCL1_MOUSE RNA 3'-terminal phosphate cyclase-like protein OS=Mus musculus GN=Rcl1 PE=2 SV=1 1 350 2.0E-55
sp|Q9Y2P8|RCL1_HUMAN RNA 3'-terminal phosphate cyclase-like protein OS=Homo sapiens GN=RCL1 PE=1 SV=3 1 350 5.0E-55
sp|Q2KHX8|RCL1_BOVIN RNA 3'-terminal phosphate cyclase-like protein OS=Bos taurus GN=RCL1 PE=2 SV=1 1 350 2.0E-54
sp|Q09870|RCL1_SCHPO Probable RNA 3'-terminal phosphate cyclase-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12G12.06c PE=3 SV=1 7 402 6.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08096|RCL1_YEAST RNA 3'-terminal phosphate cyclase-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCL1 PE=1 SV=1 1 403 1.0E-65
sp|Q9JJT0|RCL1_MOUSE RNA 3'-terminal phosphate cyclase-like protein OS=Mus musculus GN=Rcl1 PE=2 SV=1 1 350 2.0E-55
sp|Q9Y2P8|RCL1_HUMAN RNA 3'-terminal phosphate cyclase-like protein OS=Homo sapiens GN=RCL1 PE=1 SV=3 1 350 5.0E-55
sp|Q2KHX8|RCL1_BOVIN RNA 3'-terminal phosphate cyclase-like protein OS=Bos taurus GN=RCL1 PE=2 SV=1 1 350 2.0E-54
sp|Q09870|RCL1_SCHPO Probable RNA 3'-terminal phosphate cyclase-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12G12.06c PE=3 SV=1 7 402 6.0E-53
sp|Q54S38|RCL1_DICDI Probable RNA 3'-terminal phosphate cyclase-like protein OS=Dictyostelium discoideum GN=rcl1 PE=1 SV=2 8 400 1.0E-42
sp|Q9C578|RCL1_ARATH Probable RNA 3'-terminal phosphate cyclase-like protein OS=Arabidopsis thaliana GN=At5g22100 PE=2 SV=1 10 403 3.0E-39
sp|Q23400|RCL1_CAEEL Probable RNA 3'-terminal phosphate cyclase-like protein OS=Caenorhabditis elegans GN=ZK1127.5 PE=3 SV=2 7 402 5.0E-38
sp|P56175|RCL1_DROME Probable RNA 3'-terminal phosphate cyclase-like protein OS=Drosophila melanogaster GN=Rtc1 PE=2 SV=3 3 350 9.0E-37
sp|Q4R3J0|RTCA_MACFA RNA 3'-terminal phosphate cyclase OS=Macaca fascicularis GN=RTCA PE=2 SV=1 23 397 1.0E-09
sp|Q2HJ88|RTCA_BOVIN RNA 3'-terminal phosphate cyclase OS=Bos taurus GN=RTCA PE=2 SV=1 23 397 2.0E-09
sp|O00442|RTCA_HUMAN RNA 3'-terminal phosphate cyclase OS=Homo sapiens GN=RTCA PE=1 SV=1 23 397 8.0E-09
sp|Q9D7H3|RTCA_MOUSE RNA 3'-terminal phosphate cyclase OS=Mus musculus GN=RtcA PE=1 SV=2 23 397 3.0E-08
sp|Q5R7P3|RTCA_PONAB RNA 3'-terminal phosphate cyclase OS=Pongo abelii GN=RTCA PE=2 SV=1 23 397 4.0E-08
sp|O77264|RTCA_DROME RNA 3'-terminal phosphate cyclase OS=Drosophila melanogaster GN=CG4061 PE=2 SV=1 13 394 1.0E-07
sp|Q8TZC9|RTCA_METKA RNA 3'-terminal phosphate cyclase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rtcA PE=3 SV=1 23 339 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8198
MSSQAPEFLRFTGHRSFSRRLTIATLTGRPVHISKIRSTSPTNPGLAPHEVSFLRLLEAVTNGSSMQISYTGTTM
TFHPGLITGTIAGQGATEGDVILHNIPDTCTRGVTYFLLPLCLLAPFSKAHMNVRFSGPGVITSATETGDVSVDT
FRTAVLPLFGLFGIPPVRIELRVLQRSCAGPGGRGGGGCVELRFASQVRLPKTLHLNRNPGRIKRIRGVAYCTGV
SASNNARMIHSAREVLNPLSADIHVAAQYDQAPLVPTDKAGNKRRLGIGFGLSLVAESSSAGVLYSADVVVPPSG
GVVPEEIGQRCAYQLLESIAQGGCVSHVSASAVLVLMAMGSEDVGRLRIGREVIGTEDLVGLARDLRIFGASSWG
LRDVDDETGDIIISVKGTGVGNVGRKVA*
Coding >Hirsu2|8198
ATGTCTTCTCAAGCGCCCGAGTTCCTGCGCTTCACGGGCCACCGGAGCTTCAGCCGGCGCCTCACCATCGCGACG
CTCACCGGCCGGCCCGTCCACATCTCCAAGATCCGGAGCACGTCGCCGACCAATCCGGGCCTCGCCCCCCACGAG
GTCTCCTTCCTGCGCCTCCTCGAGGCCGTGACCAACGGCAGCTCGATGCAGATCTCGTACACCGGCACGACCATG
ACCTTCCACCCCGGCTTGATCACGGGCACCATCGCCGGCCAGGGCGCGACCGAGGGCGACGTCATCCTGCACAAC
ATTCCCGATACCTGCACGAGAGGCGTCACATACTTTCTACTGCCGCTGTGCCTGCTGGCGCCCTTCTCTAAAGCA
CACATGAACGTCCGCTTTTCGGGGCCGGGCGTCATAACCTCGGCCACCGAGACGGGGGACGTTTCCGTCGACACC
TTCCGGACCGCCGTCCTCCCCCTCTTCGGCCTCTTCGGCATCCCGCCCGTCAGGATCGAGCTGCGGGTGCTGCAA
AGATCCTGCGCCGGCCCCGGCGGACGAGGCGGCGGCGGCTGCGTCGAGCTGAGGTTTGCCAGCCAAGTGCGCCTG
CCCAAGACGCTGCACCTGAACCGCAATCCCGGCCGGATAAAAAGGATACGGGGCGTCGCTTACTGCACCGGCGTC
TCCGCCTCCAACAATGCTCGCATGATCCATTCCGCCCGCGAGGTTTTGAACCCCCTCAGCGCCGACATCCACGTC
GCGGCGCAGTACGACCAGGCTCCGCTGGTGCCCACGGATAAGGCAGGGAACAAGCGGCGGCTGGGCATCGGCTTC
GGGTTGAGCCTGGTGGCCGAGTCCAGCTCCGCCGGCGTGTTGTACTCGGCAGACGTGGTGGTCCCCCCGTCGGGA
GGCGTGGTTCCGGAGGAGATTGGACAGAGGTGTGCGTACCAGCTGCTGGAGTCGATCGCACAGGGCGGCTGCGTC
AGCCACGTGTCCGCGAGCGCAGTCCTGGTGCTCATGGCCATGGGGTCGGAAGACGTCGGGCGACTGAGGATAGGC
AGGGAGGTCATCGGGACCGAAGACCTGGTCGGGCTGGCGAGAGATCTCAGGATATTCGGCGCCAGTAGCTGGGGG
CTGAGAGACGTGGATGACGAAACGGGGGATATCATTATTTCGGTCAAGGGGACTGGTGTCGGGAACGTGGGTCGG
AAAGTAGCGTGA
Transcript >Hirsu2|8198
ATGTCTTCTCAAGCGCCCGAGTTCCTGCGCTTCACGGGCCACCGGAGCTTCAGCCGGCGCCTCACCATCGCGACG
CTCACCGGCCGGCCCGTCCACATCTCCAAGATCCGGAGCACGTCGCCGACCAATCCGGGCCTCGCCCCCCACGAG
GTCTCCTTCCTGCGCCTCCTCGAGGCCGTGACCAACGGCAGCTCGATGCAGATCTCGTACACCGGCACGACCATG
ACCTTCCACCCCGGCTTGATCACGGGCACCATCGCCGGCCAGGGCGCGACCGAGGGCGACGTCATCCTGCACAAC
ATTCCCGATACCTGCACGAGAGGCGTCACATACTTTCTACTGCCGCTGTGCCTGCTGGCGCCCTTCTCTAAAGCA
CACATGAACGTCCGCTTTTCGGGGCCGGGCGTCATAACCTCGGCCACCGAGACGGGGGACGTTTCCGTCGACACC
TTCCGGACCGCCGTCCTCCCCCTCTTCGGCCTCTTCGGCATCCCGCCCGTCAGGATCGAGCTGCGGGTGCTGCAA
AGATCCTGCGCCGGCCCCGGCGGACGAGGCGGCGGCGGCTGCGTCGAGCTGAGGTTTGCCAGCCAAGTGCGCCTG
CCCAAGACGCTGCACCTGAACCGCAATCCCGGCCGGATAAAAAGGATACGGGGCGTCGCTTACTGCACCGGCGTC
TCCGCCTCCAACAATGCTCGCATGATCCATTCCGCCCGCGAGGTTTTGAACCCCCTCAGCGCCGACATCCACGTC
GCGGCGCAGTACGACCAGGCTCCGCTGGTGCCCACGGATAAGGCAGGGAACAAGCGGCGGCTGGGCATCGGCTTC
GGGTTGAGCCTGGTGGCCGAGTCCAGCTCCGCCGGCGTGTTGTACTCGGCAGACGTGGTGGTCCCCCCGTCGGGA
GGCGTGGTTCCGGAGGAGATTGGACAGAGGTGTGCGTACCAGCTGCTGGAGTCGATCGCACAGGGCGGCTGCGTC
AGCCACGTGTCCGCGAGCGCAGTCCTGGTGCTCATGGCCATGGGGTCGGAAGACGTCGGGCGACTGAGGATAGGC
AGGGAGGTCATCGGGACCGAAGACCTGGTCGGGCTGGCGAGAGATCTCAGGATATTCGGCGCCAGTAGCTGGGGG
CTGAGAGACGTGGATGACGAAACGGGGGATATCATTATTTCGGTCAAGGGGACTGGTGTCGGGAACGTGGGTCGG
AAAGTAGCGTGA
Gene >Hirsu2|8198
ATGTCTTCTCAAGCGCCCGAGTTCCTGCGCTTCACGGGCCACCGGAGCTTCAGCCGGCGCCTCACCATCGCGACG
CTCACCGGCCGGCCCGTCCACATCTCCAAGATCCGGAGCACGTCGCCGACCAATCCGGGCCTCGCCCCCCACGAG
GTCTCCTTCCTGCGCCTCCTCGAGGCCGTGACCAACGGCAGCTCGATGCAGATCTCGTACACCGGCACGACCATG
ACCTTCCACCCCGGCTTGATCACGGGCACCATCGCCGGCCAGGGCGCGACCGAGGGCGACGTCATCCTGCACAAC
ATTCCCGATACCTGCACGAGAGGCGTCACATACTTTCTACTGCCGCTGTGCCTGCTGGCGCCCTTCTCTAAAGCA
CACATGAACGTCCGCTTTTCGGGGCCGGGCGTCATAACCTCGGCCACCGAGACGGGGGACGTTTCCGTCGACACC
TTCCGGACCGCCGTCCTCCCCCTCTTCGGCCTCTTCGGCATCCCGCCCGTCAGGATCGAGCTGCGGGTGCTGCAA
AGATCCTGCGCCGGCCCCGGCGGACGAGGCGGCGGCGGCTGCGTCGAGCTGAGGTTTGCCAGCCAAGTGCGCCTG
CCCAAGACGCTGCACCTGAACCGCAATCCCGGCCGGATAAAAAGGATACGGGGCGTCGCTTACTGCACCGGCGTC
TCCGCCTCCAACAATGCTCGCATGATCCATTCCGCCCGCGAGGTTTTGAACCCCCTCAGCGCCGACATCCACGTC
GCGGCGCAGTACGACCAGGCTCCGCTGGTGCCCACGGATAAGGCAGGGAACAAGCGGCGGCTGGGCATCGGCTTC
GGGTTGAGCCTGGTGGCCGAGTCCAGCTCCGCCGGCGTGTTGTACTCGGCAGACGTGGTGGTCCCCCCGTCGGGA
GGCGTGGTTCCGGAGGAGATTGGACAGAGGTGTGCGTACCAGCTGCTGGAGTCGATCGCACAGGGCGGCTGCGTC
AGCCACGTGTCCGCGAGCGCAGTCCTGGTGCTCATGGCCATGGGGTCGGAAGACGTCGGGCGACTGAGGATAGGC
AGGGAGGTCATCGGGACCGAAGACCTGGTCGGGCTGGCGAGAGATCTCAGGATATTCGGCGCCAGTAGCTGGGGG
CTGAGAGACGTGGATGACGAAACGGGGGATATCATTATTTCGGTCAAGGGGACTGGTGTCGGGAACGTGGGTCGG
AAAGTAGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail