Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8194
Gene name
LocationContig_52:589..2584
Strand-
Gene length (bp)1995
Transcript length (bp)1758
Coding sequence length (bp)1758
Protein length (aa) 586

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04922 DIE2_ALG10 DIE2/ALG10 family 5.7E-127 65 520

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZE0|ALG10_GIBZE Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ALG10 PE=3 SV=1 57 585 0.0E+00
sp|P0C147|ALG10_MAGO7 Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ALG10 PE=3 SV=1 49 585 4.0E-155
sp|Q7SA35|ALG10_NEUCR Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-10 PE=3 SV=3 57 379 2.0E-105
sp|Q5B0M8|ALG10_EMENI Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alg10 PE=3 SV=1 56 585 5.0E-86
sp|Q4X162|ALG10_ASPFU Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg10 PE=3 SV=1 56 449 4.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZE0|ALG10_GIBZE Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ALG10 PE=3 SV=1 57 585 0.0E+00
sp|P0C147|ALG10_MAGO7 Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ALG10 PE=3 SV=1 49 585 4.0E-155
sp|Q7SA35|ALG10_NEUCR Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-10 PE=3 SV=3 57 379 2.0E-105
sp|Q5B0M8|ALG10_EMENI Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alg10 PE=3 SV=1 56 585 5.0E-86
sp|Q4X162|ALG10_ASPFU Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg10 PE=3 SV=1 56 449 4.0E-63
sp|Q6CEA5|ALG10_YARLI Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALG10 PE=3 SV=1 52 585 1.0E-57
sp|Q5BKT4|AG10A_HUMAN Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Homo sapiens GN=ALG10 PE=2 SV=1 45 585 7.0E-57
sp|Q5I7T1|AG10B_HUMAN Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Homo sapiens GN=ALG10B PE=1 SV=2 42 585 6.0E-53
sp|Q3UGP8|AG10B_MOUSE Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Mus musculus GN=Alg10b PE=2 SV=1 45 585 1.0E-52
sp|O88788|AG10B_RAT Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Rattus norvegicus GN=Alg10b PE=1 SV=1 45 585 3.0E-52
sp|Q10254|ALG10_SCHPO Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg10 PE=3 SV=1 58 585 7.0E-50
sp|Q6CN27|ALG10_KLULA Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG10 PE=3 SV=1 47 560 2.0E-45
sp|Q75AQ8|ALG10_ASHGO Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG10 PE=3 SV=2 47 585 8.0E-44
sp|Q59YV2|ALG10_CANAL Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG10 PE=3 SV=1 58 567 3.0E-42
sp|Q6FL34|ALG10_CANGA Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG10 PE=3 SV=1 63 585 4.0E-40
sp|P50076|ALG10_YEAST Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIE2 PE=1 SV=2 62 585 9.0E-40
sp|Q6BW42|ALG10_DEBHA Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG10 PE=3 SV=1 44 585 2.0E-39
sp|Q8T8L8|ALG10_DROME Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Drosophila melanogaster GN=Alg10 PE=2 SV=1 42 569 3.0E-39
sp|Q4P2W6|ALG10_USTMA Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ALG10 PE=3 SV=1 152 585 9.0E-27
sp|Q4X162|ALG10_ASPFU Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg10 PE=3 SV=1 474 585 4.0E-19
sp|Q7SA35|ALG10_NEUCR Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-10 PE=3 SV=3 405 474 2.0E-18
sp|Q7SA35|ALG10_NEUCR Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-10 PE=3 SV=3 503 585 3.0E-17
sp|Q4P2W6|ALG10_USTMA Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ALG10 PE=3 SV=1 35 104 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004583 dolichyl-phosphate-glucose-glycolipid alpha-glucosyltransferase activity Yes
GO:0005789 endoplasmic reticulum membrane Yes
GO:0006488 dolichol-linked oligosaccharide biosynthetic process Yes
GO:0044446 intracellular organelle part No
GO:0009987 cellular process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0044424 intracellular part No
GO:0016758 transferase activity, transferring hexosyl groups No
GO:0006490 oligosaccharide-lipid intermediate biosynthetic process No
GO:0003824 catalytic activity No
GO:1901135 carbohydrate derivative metabolic process No
GO:0044432 endoplasmic reticulum part No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0009058 biosynthetic process No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901576 organic substance biosynthetic process No
GO:0016020 membrane No
GO:0044425 membrane part No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044255 cellular lipid metabolic process No
GO:0046527 glucosyltransferase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0044422 organelle part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.5

Transmembrane Domains

Domain # Start End Length
1 15 32 17
2 39 61 22
3 92 114 22
4 127 144 17
5 159 181 22
6 316 338 22
7 353 375 22
8 399 421 22
9 441 463 22
10 484 506 22
11 540 562 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8194
MDMAAADETPAEPSVYVVCAIPIAILAHAVVFRRASSPASLWTMALPSLVAGACFLWLNAVSRAVPEPYLDEVFH
IPQAQRYCHGDFRQWDAMITTPPGLYLVSNLVPHLFRIIGLRWDQACDARSLRAANAVGLLVLALLFLLCRRQME
GRGRPFSEYAIHGACNVALFPLLFFFSGLYYTDVISTAAVLGALLNHLHRLGRRHRPGSLSSDLATVALGLLALF
MRQTNVFWVVVYMGGLEAVDAIKTLAPARPEKEPAATATSRERLKHFAQRWSVGDIHDLPLDQAWPDDAILTAVS
LAVAAACNPGRVLRRVWPYVAVLGAFVAFVAWNGGVVLGDKSNHVATIHLAQMLYIWPLFAFFSLPLLLPGGLAL
CDSLRRVWTQPWSAAAPPSWRSSVAVVFHVGTALLSCAVVRYNTIIHPFTLADNRHYMFYVFRHSIRRAGWVRYL
LVVPYSLSRWLVWATLAGRDRAGSRRAAGTQRPASTSTGLVFLLATSLSLVTAPLVEPRYFILPWVVWRLLVPAW
GPGEARDGGRLAGSARLLAETAWFVAINLATGYVFLGKPYVWTDADGHVLDGGRLQRFMW*
Coding >Hirsu2|8194
ATGGATATGGCGGCGGCGGACGAGACGCCGGCCGAGCCCAGCGTCTACGTCGTCTGCGCGATCCCGATCGCCATC
CTCGCCCACGCCGTCGTCTTCCGCAGGGCGTCGTCGCCGGCCAGCCTCTGGACCATGGCCCTGCCGTCGTTGGTC
GCCGGCGCCTGCTTCCTGTGGCTCAATGCCGTGTCGAGGGCGGTGCCGGAGCCGTACCTGGACGAGGTCTTCCAC
ATCCCGCAGGCGCAGAGATACTGCCACGGCGACTTCCGGCAGTGGGACGCCATGATCACGACGCCGCCCGGCCTC
TATCTGGTCTCCAACCTCGTGCCGCACCTGTTCAGGATCATCGGCCTTCGCTGGGACCAGGCGTGCGACGCGCGG
AGCCTGCGAGCCGCCAACGCCGTCGGCCTGCTCGTCCTGGCCTTGCTGTTCCTGCTTTGCCGACGGCAGATGGAA
GGGCGCGGCAGGCCCTTCAGCGAGTATGCGATCCATGGCGCCTGCAACGTCGCCCTGTTCCCCCTGCTGTTCTTC
TTCTCCGGCCTCTACTACACCGACGTCATCTCGACCGCCGCCGTGCTCGGCGCCCTTCTCAACCACCTCCACCGC
CTGGGACGCCGCCACCGGCCCGGCTCCCTCTCGAGCGACCTGGCCACGGTGGCCCTGGGCTTGCTCGCGCTCTTC
ATGCGCCAGACCAACGTCTTTTGGGTCGTCGTCTACATGGGCGGCCTGGAGGCTGTCGACGCAATCAAGACGCTT
GCGCCCGCGAGGCCTGAGAAGGAGCCGGCTGCGACGGCCACCTCGCGGGAGCGACTCAAGCACTTCGCCCAGAGA
TGGTCCGTCGGCGACATCCACGACCTGCCGCTGGACCAGGCCTGGCCGGACGACGCCATCCTCACCGCCGTCAGC
TTGGCTGTCGCGGCCGCGTGCAACCCCGGCCGAGTGCTCCGGCGAGTCTGGCCGTACGTCGCGGTGCTCGGAGCC
TTTGTCGCGTTCGTGGCCTGGAACGGCGGTGTTGTCCTGGGGGACAAGTCGAACCACGTCGCCACCATCCACCTG
GCCCAGATGCTCTACATCTGGCCTCTCTTCGCCTTCTTCTCTCTGCCGCTGCTGCTGCCGGGCGGCCTCGCCCTG
TGCGACTCCCTGAGACGGGTCTGGACCCAGCCGTGGTCGGCGGCGGCGCCGCCGTCGTGGAGGAGCTCGGTCGCG
GTCGTCTTCCACGTCGGCACGGCGCTGCTGTCGTGCGCCGTCGTGCGGTACAACACCATCATCCACCCCTTCACG
CTCGCCGACAACCGGCACTACATGTTCTACGTCTTCCGGCACAGCATCCGCCGCGCCGGCTGGGTCCGGTACCTG
CTCGTCGTGCCGTACTCGCTGAGCCGCTGGCTCGTCTGGGCCACGCTGGCCGGGCGGGATCGGGCGGGCTCGCGC
AGGGCGGCGGGGACGCAGCGGCCGGCGTCGACGTCGACGGGCCTCGTCTTCCTGCTCGCGACGTCGCTCTCGCTC
GTGACGGCGCCGCTGGTGGAGCCGCGCTACTTCATCCTGCCCTGGGTCGTGTGGAGGCTGCTGGTGCCGGCCTGG
GGCCCGGGCGAGGCGCGCGACGGCGGCCGGCTGGCCGGGTCGGCGCGGCTCCTGGCCGAGACGGCCTGGTTCGTC
GCCATCAACCTGGCGACCGGCTACGTCTTCCTCGGCAAGCCCTACGTCTGGACGGACGCGGACGGGCACGTGCTG
GACGGGGGGCGTCTGCAGCGGTTCATGTGGTAG
Transcript >Hirsu2|8194
ATGGATATGGCGGCGGCGGACGAGACGCCGGCCGAGCCCAGCGTCTACGTCGTCTGCGCGATCCCGATCGCCATC
CTCGCCCACGCCGTCGTCTTCCGCAGGGCGTCGTCGCCGGCCAGCCTCTGGACCATGGCCCTGCCGTCGTTGGTC
GCCGGCGCCTGCTTCCTGTGGCTCAATGCCGTGTCGAGGGCGGTGCCGGAGCCGTACCTGGACGAGGTCTTCCAC
ATCCCGCAGGCGCAGAGATACTGCCACGGCGACTTCCGGCAGTGGGACGCCATGATCACGACGCCGCCCGGCCTC
TATCTGGTCTCCAACCTCGTGCCGCACCTGTTCAGGATCATCGGCCTTCGCTGGGACCAGGCGTGCGACGCGCGG
AGCCTGCGAGCCGCCAACGCCGTCGGCCTGCTCGTCCTGGCCTTGCTGTTCCTGCTTTGCCGACGGCAGATGGAA
GGGCGCGGCAGGCCCTTCAGCGAGTATGCGATCCATGGCGCCTGCAACGTCGCCCTGTTCCCCCTGCTGTTCTTC
TTCTCCGGCCTCTACTACACCGACGTCATCTCGACCGCCGCCGTGCTCGGCGCCCTTCTCAACCACCTCCACCGC
CTGGGACGCCGCCACCGGCCCGGCTCCCTCTCGAGCGACCTGGCCACGGTGGCCCTGGGCTTGCTCGCGCTCTTC
ATGCGCCAGACCAACGTCTTTTGGGTCGTCGTCTACATGGGCGGCCTGGAGGCTGTCGACGCAATCAAGACGCTT
GCGCCCGCGAGGCCTGAGAAGGAGCCGGCTGCGACGGCCACCTCGCGGGAGCGACTCAAGCACTTCGCCCAGAGA
TGGTCCGTCGGCGACATCCACGACCTGCCGCTGGACCAGGCCTGGCCGGACGACGCCATCCTCACCGCCGTCAGC
TTGGCTGTCGCGGCCGCGTGCAACCCCGGCCGAGTGCTCCGGCGAGTCTGGCCGTACGTCGCGGTGCTCGGAGCC
TTTGTCGCGTTCGTGGCCTGGAACGGCGGTGTTGTCCTGGGGGACAAGTCGAACCACGTCGCCACCATCCACCTG
GCCCAGATGCTCTACATCTGGCCTCTCTTCGCCTTCTTCTCTCTGCCGCTGCTGCTGCCGGGCGGCCTCGCCCTG
TGCGACTCCCTGAGACGGGTCTGGACCCAGCCGTGGTCGGCGGCGGCGCCGCCGTCGTGGAGGAGCTCGGTCGCG
GTCGTCTTCCACGTCGGCACGGCGCTGCTGTCGTGCGCCGTCGTGCGGTACAACACCATCATCCACCCCTTCACG
CTCGCCGACAACCGGCACTACATGTTCTACGTCTTCCGGCACAGCATCCGCCGCGCCGGCTGGGTCCGGTACCTG
CTCGTCGTGCCGTACTCGCTGAGCCGCTGGCTCGTCTGGGCCACGCTGGCCGGGCGGGATCGGGCGGGCTCGCGC
AGGGCGGCGGGGACGCAGCGGCCGGCGTCGACGTCGACGGGCCTCGTCTTCCTGCTCGCGACGTCGCTCTCGCTC
GTGACGGCGCCGCTGGTGGAGCCGCGCTACTTCATCCTGCCCTGGGTCGTGTGGAGGCTGCTGGTGCCGGCCTGG
GGCCCGGGCGAGGCGCGCGACGGCGGCCGGCTGGCCGGGTCGGCGCGGCTCCTGGCCGAGACGGCCTGGTTCGTC
GCCATCAACCTGGCGACCGGCTACGTCTTCCTCGGCAAGCCCTACGTCTGGACGGACGCGGACGGGCACGTGCTG
GACGGGGGGCGTCTGCAGCGGTTCATGTGGTAG
Gene >Hirsu2|8194
ATGGATATGGCGGCGGCGGACGAGACGCCGGCCGAGCCCAGCGTCTACGTCGTCTGCGCGATCCCGATCGCCATC
CTCGCCCACGCCGTCGTCTTCCGCAGGGCGTCGTCGCCGGCCAGCCTCTGGACCATGGCCCTGCCGTCGTTGGTC
GCCGGCGCCTGCTTCCTGTGGCTCAATGCCGTGTCGAGGGCGGTGCCGGAGCCGTACCTGGTAGGCCTGGTCGCC
GTCGGGAGGCACGGCGCTCGTGCGGGCTGACGGGAGGAGCAGGACGAGGTCTTCCACATCCCGCAGGCGCAGAGA
TACTGCCACGGCGACTTCCGGCAGTGGGACGCCATGATCACGACGCCGCCCGGCCTGTGAGCTCGCCGCGATCCC
CCTCGGCTTACACGGGCTGCGCTGACCGACTGCCAGCTATCTGGTCTCCAACCTCGTGCCGCACCTGTTCAGGAT
CATCGGCCTTCGCTGGGACCAGGCGTGCGACGCGCGGAGCCTGCGAGCCGCCAACGCCGTCGGCCTGCTCGTCCT
GGCCTTGCTGTTCCTGCTTTGCCGACGGCAGATGGAAGGGCGCGGCAGGCCCTTCAGCGAGTATGCGATCCATGG
CGCCTGCAACGTCGCCCTGTTCCCCCTGCTGTTCTTCTTCTCCGGCCTCTACTACACCGACGTCATCTCGACCGC
CGCCGTGCTCGGCGCCCTTCTCAACCACCTCCACCGCCTGGGACGCCGCCACCGGCCCGGCTCCCTCTCGAGCGA
CCTGGCCACGGTGGCCCTGGGCTTGCTCGCGCTCTTCATGCGCCAGACCAACGTCTTTTGGGTCGTCGTCTACAT
GGGCGGCCTGGAGGCTGTCGACGCAATCAAGACGCTTGCGCCCGCGAGGCCTGAGAAGGAGCCGGCTGCGACGGC
CACCTCGCGGGAGCGACTCAAGCACTTCGCCCAGAGATGGTCCGTCGGCGACATCCACGACCTGCCGCTGGACCA
GGCCTGGCCGGACGGTGAGCGTGCCCCGACGCTTCGTTTGTCCTCGCGCGCCGACTGATCCCCCGCGACAGACGC
CATCCTCACCGCCGTCAGCTTGGCTGTCGCGGCCGCGTGCAACCCCGGCCGAGTGCTCCGGCGAGTCTGGCCGTA
CGTCGCGGTGCTCGGAGCCTTTGTCGCGTTCGTGGCCTGGAACGGCGGTGTTGTCCTGGGTGAGGGAGAGCGGAC
GGCTCGACGCAAACTTGAGAGCGCTGTCGAAGCTGACTTGGGCGTGCCGCAGGGGACAAGTCGAACCACGTCGCC
ACCATCCACCTGGCCCAGATGCTCTACATCTGGCCTCTCTTCGCCTTCTTCTCTCTGCCGCTGCTGCTGCCGGGC
GGCCTCGCCCTGTGCGACTCCCTGAGACGGGTCTGGACCCAGCCGTGGTCGGCGGCGGCGCCGCCGTCGTGGAGG
AGCTCGGTCGCGGTCGTCTTCCACGTCGGCACGGCGCTGCTGTCGTGCGCCGTCGTGCGGTACAACACCATCATC
CACCCCTTCACGCTCGCCGACAACCGGCACTACATGTTCTACGTCTTCCGGCACAGCATCCGCCGCGCCGGCTGG
GTCCGGTACCTGCTCGTCGTGCCGTACTCGCTGAGCCGCTGGCTCGTCTGGGCCACGCTGGCCGGGCGGGATCGG
GCGGGCTCGCGCAGGGCGGCGGGGACGCAGCGGCCGGCGTCGACGTCGACGGGCCTCGTCTTCCTGCTCGCGACG
TCGCTCTCGCTCGTGACGGCGCCGCTGGTGGAGCCGCGCTACTTCATCCTGCCCTGGGTCGTGTGGAGGCTGCTG
GTGCCGGCCTGGGGCCCGGGCGAGGCGCGCGACGGCGGCCGGCTGGCCGGGTCGGCGCGGCTCCTGGCCGAGACG
GCCTGGTTCGTCGCCATCAACCTGGCGACCGGCTACGTCTTCCTCGGCAAGCCCTACGTCTGGACGGACGCGGAC
GGGCACGTGCTGGACGGGGGGCGTCTGCAGCGGTTCATGTGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail