Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8190
Gene name
LocationContig_519:6274..8306
Strand+
Gene length (bp)2032
Transcript length (bp)1644
Coding sequence length (bp)1644
Protein length (aa) 548

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 4.0E-41 304 509

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12612|TRI4_FUSSP Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 19 536 2.0E-69
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 24 505 4.0E-22
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 299 506 1.0E-19
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 31 504 2.0E-19
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 308 506 5.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12612|TRI4_FUSSP Trichodiene oxygenase OS=Fusarium sporotrichioides GN=TRI4 PE=3 SV=1 19 536 2.0E-69
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 24 505 4.0E-22
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 299 506 1.0E-19
sp|Q12609|STCF_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcF PE=3 SV=3 31 504 2.0E-19
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 308 506 5.0E-19
sp|Q54DT2|C516A_DICDI Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 348 505 2.0E-18
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 308 506 2.0E-18
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 308 506 2.0E-18
sp|Q12732|AVNA_ASPPA Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 30 504 3.0E-18
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 308 506 3.0E-18
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 292 545 6.0E-18
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 259 506 1.0E-17
sp|O00061|CP67_UROFA Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 28 527 1.0E-17
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 326 506 2.0E-17
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 339 509 2.0E-17
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 293 509 2.0E-17
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 308 506 3.0E-17
sp|Q96SQ9|CP2S1_HUMAN Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 299 509 3.0E-17
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 315 508 4.0E-17
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 19 500 6.0E-17
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 26 496 7.0E-17
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 293 509 9.0E-17
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 308 506 1.0E-16
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 341 506 2.0E-16
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 292 500 2.0E-16
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 19 500 3.0E-16
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 341 506 3.0E-16
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 306 509 4.0E-16
sp|Q9DBX6|CP2S1_MOUSE Cytochrome P450 2S1 OS=Mus musculus GN=Cyp2s1 PE=1 SV=1 348 526 4.0E-16
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 299 508 6.0E-16
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 314 509 7.0E-16
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 326 506 1.0E-15
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 26 496 1.0E-15
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 26 496 1.0E-15
sp|Q9UW95|AFLL_ASPPA Versicolorin B desaturase OS=Aspergillus parasiticus GN=verB PE=3 SV=1 29 526 1.0E-15
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 348 534 2.0E-15
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 341 506 2.0E-15
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 301 507 2.0E-15
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 341 506 2.0E-15
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 272 506 3.0E-15
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 301 507 4.0E-15
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 341 506 4.0E-15
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 341 506 4.0E-15
sp|P00184|CP1A1_MOUSE Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 339 516 5.0E-15
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 273 506 5.0E-15
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 333 509 6.0E-15
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 304 543 6.0E-15
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 283 504 7.0E-15
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 348 509 9.0E-15
sp|P08682|CP2E1_RABIT Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 348 524 9.0E-15
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 341 506 9.0E-15
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 308 509 1.0E-14
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 292 506 1.0E-14
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 293 534 1.0E-14
sp|P00185|CP1A1_RAT Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 339 509 1.0E-14
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 330 536 2.0E-14
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 348 535 2.0E-14
sp|Q9QYG6|CP2DR_MESAU Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 224 509 2.0E-14
sp|Q95078|CP18A_DROME Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 348 505 2.0E-14
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 348 508 3.0E-14
sp|E9Q816|CP2W1_MOUSE Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 328 509 4.0E-14
sp|P11714|CP2D9_MOUSE Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 332 509 4.0E-14
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 344 504 4.0E-14
sp|Q9QUJ1|CP2DS_MESAU Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 332 509 4.0E-14
sp|P00178|CP2B4_RABIT Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 311 509 4.0E-14
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 272 502 4.0E-14
sp|Q9V8M2|C12B2_DROME Probable cytochrome P450 12b2, mitochondrial OS=Drosophila melanogaster GN=Cyp12b2 PE=2 SV=2 348 509 5.0E-14
sp|H2KYS3|DAF9_CAEEL Cytochrome P450 daf-9 OS=Caenorhabditis elegans GN=daf-9 PE=1 SV=1 75 509 6.0E-14
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 142 509 6.0E-14
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 348 524 7.0E-14
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 342 546 8.0E-14
sp|P12789|CP2B5_RABIT Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CYP2B5 PE=2 SV=1 311 509 8.0E-14
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 326 506 9.0E-14
sp|P20853|CP2A7_HUMAN Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 333 537 1.0E-13
sp|P51581|CP2E1_MESAU Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 348 524 1.0E-13
sp|P20813|CP2B6_HUMAN Cytochrome P450 2B6 OS=Homo sapiens GN=CYP2B6 PE=1 SV=1 320 509 1.0E-13
sp|P37120|C75A2_SOLME Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 348 524 1.0E-13
sp|P49430|THAS_RAT Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1 332 538 1.0E-13
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 305 506 1.0E-13
sp|P15540|CP21A_PIG Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 55 509 1.0E-13
sp|Q00707|STCL_EMENI Versicolorin B desaturase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcL PE=1 SV=2 29 508 1.0E-13
sp|Q29488|CP2DH_MACFA Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1 332 509 1.0E-13
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 36 509 1.0E-13
sp|Q8CIM7|CP2DQ_MOUSE Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 332 509 2.0E-13
sp|P11711|CP2A1_RAT Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 345 522 2.0E-13
sp|Q9MZY0|CP2E1_CANLF Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 348 524 2.0E-13
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 264 531 2.0E-13
sp|Q92088|CP2M1_ONCMY Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 302 504 2.0E-13
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 138 504 2.0E-13
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 339 538 2.0E-13
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 344 504 2.0E-13
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 286 509 2.0E-13
sp|P05177|CP1A2_HUMAN Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 348 517 2.0E-13
sp|Q12608|STCB_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase STCB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcB PE=3 SV=2 344 536 3.0E-13
sp|Q8TAV3|CP2W1_HUMAN Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=1 SV=2 299 518 3.0E-13
sp|Q2XNC9|CP2D6_PANPA Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3 SV=1 332 509 3.0E-13
sp|Q2XNC8|CP2D6_PANTR Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 PE=3 SV=1 332 509 3.0E-13
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 342 504 3.0E-13
sp|Q3LFT9|CP1A2_BALAC Cytochrome P450 1A2 OS=Balaenoptera acutorostrata GN=CYP1A2 PE=2 SV=3 348 509 3.0E-13
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 305 506 3.0E-13
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 315 504 3.0E-13
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 344 500 4.0E-13
sp|Q5KQT7|CP1A1_FELCA Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 348 517 4.0E-13
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 344 504 4.0E-13
sp|P05176|CP1A1_RABIT Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 348 509 4.0E-13
sp|Q6GUR1|CP1A1_MACMU Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 321 509 4.0E-13
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 301 542 4.0E-13
sp|Q64680|CP2DI_RAT Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 332 509 4.0E-13
sp|P33616|CP1A1_MACFA Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1 321 509 4.0E-13
sp|P10634|CP2DQ_RAT Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 332 509 4.0E-13
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 344 500 4.0E-13
sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 299 509 4.0E-13
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 306 509 4.0E-13
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 348 508 4.0E-13
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 272 506 4.0E-13
sp|O18635|C12A2_MUSDO Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 345 509 4.0E-13
sp|P79102|CP3AS_BOVIN Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 344 526 5.0E-13
sp|P12790|CP2B9_MOUSE Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 311 509 5.0E-13
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 348 509 5.0E-13
sp|Q3LFU0|CP1A1_BALAC Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 348 509 5.0E-13
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 304 504 5.0E-13
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 315 509 5.0E-13
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 341 505 5.0E-13
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 74 509 5.0E-13
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 301 504 5.0E-13
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 297 509 5.0E-13
sp|P13108|CP2D4_RAT Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 332 509 5.0E-13
sp|Q9V771|C6A23_DROME Probable cytochrome P450 6a23 OS=Drosophila melanogaster GN=Cyp6a23 PE=2 SV=2 344 520 5.0E-13
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 86 504 6.0E-13
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 272 506 6.0E-13
sp|O42430|CP1A1_LIMLI Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 348 509 6.0E-13
sp|Q54NY3|C554A_DICDI Probable cytochrome P450 554A1 OS=Dictyostelium discoideum GN=cyp554A1 PE=3 SV=1 293 519 6.0E-13
sp|P11509|CP2A6_HUMAN Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 333 537 6.0E-13
sp|P10635|CP2D6_HUMAN Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2 332 509 6.0E-13
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 309 509 7.0E-13
sp|P24456|CP2DA_MOUSE Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 333 509 7.0E-13
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 305 506 7.0E-13
sp|Q06367|CP1A1_CAVPO Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 348 509 7.0E-13
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 295 531 8.0E-13
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 341 502 8.0E-13
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 314 508 8.0E-13
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 344 504 8.0E-13
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 339 508 8.0E-13
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 344 547 8.0E-13
sp|Q9V4U7|C6A14_DROME Probable cytochrome P450 6a14 OS=Drosophila melanogaster GN=Cyp6a14 PE=3 SV=2 339 509 8.0E-13
sp|O18963|CP2E1_BOVIN Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 348 524 8.0E-13
sp|P56591|CP1A1_SHEEP Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 348 508 9.0E-13
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 314 520 9.0E-13
sp|P33266|CP2E1_MACFA Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 348 524 9.0E-13
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 339 538 9.0E-13
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 344 509 1.0E-12
sp|Q92116|CP1A1_STECH Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 348 509 1.0E-12
sp|Q9YH64|CP1A1_PLAFE Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 348 509 1.0E-12
sp|P10633|CP2D1_RAT Cytochrome P450 2D1 OS=Rattus norvegicus GN=Cyp2d1 PE=2 SV=1 332 509 1.0E-12
sp|Q92100|CP1A1_PLEPL Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 348 509 1.0E-12
sp|P15149|CP2A2_RAT Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 333 521 1.0E-12
sp|P56590|CP1A1_CANLF Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 348 517 1.0E-12
sp|P05182|CP2E1_RAT Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 348 524 1.0E-12
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 344 504 1.0E-12
sp|P24460|CP2BB_CANLF Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 332 509 1.0E-12
sp|P04798|CP1A1_HUMAN Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 321 509 1.0E-12
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 316 509 2.0E-12
sp|O55071|CP2BJ_MOUSE Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 311 509 2.0E-12
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 300 509 2.0E-12
sp|Q9V770|C6A17_DROME Probable cytochrome P450 6a17 OS=Drosophila melanogaster GN=Cyp6a17 PE=2 SV=1 328 517 2.0E-12
sp|Q6VVX0|CP2R1_HUMAN Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 152 509 2.0E-12
sp|P56654|CP237_MOUSE Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 333 509 2.0E-12
sp|Q00557|CP1A1_MESAU Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 321 509 2.0E-12
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 332 538 2.0E-12
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 147 509 2.0E-12
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 348 509 2.0E-12
sp|P13107|CP2B3_RAT Cytochrome P450 2B3 OS=Rattus norvegicus GN=Cyp2b3 PE=2 SV=1 348 525 2.0E-12
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 342 504 2.0E-12
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 315 524 3.0E-12
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 315 509 3.0E-12
sp|P79383|CP2E1_PIG Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 348 524 3.0E-12
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 344 505 3.0E-12
sp|Q9VB31|C6A18_DROME Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 339 509 3.0E-12
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 348 504 3.0E-12
sp|P20678|CP2H2_CHICK Cytochrome P450 2H2 OS=Gallus gallus GN=CYP2H2 PE=1 SV=1 57 536 3.0E-12
sp|P24457|CP2DB_MOUSE Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 332 509 3.0E-12
sp|Q05421|CP2E1_MOUSE Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 348 536 3.0E-12
sp|P24455|CP2A9_MESAU Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP2A9 PE=2 SV=2 332 509 4.0E-12
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 348 509 4.0E-12
sp|O46658|CP2DP_PIG Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3 332 509 4.0E-12
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 284 509 4.0E-12
sp|Q9V4U9|C6A13_DROME Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 344 509 6.0E-12
sp|P33272|CP2BC_RAT Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 347 509 6.0E-12
sp|O77810|CP1A2_CALJA Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3 311 509 6.0E-12
sp|Q9QYG5|CP2DK_MESAU Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 332 509 6.0E-12
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 257 509 6.0E-12
sp|P00182|CP2C3_RABIT Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 333 535 6.0E-12
sp|O54749|CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 333 517 6.0E-12
sp|P20852|CP2A5_MOUSE Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 332 504 7.0E-12
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 224 521 7.0E-12
sp|P9WPN3|CP132_MYCTU Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 340 507 7.0E-12
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 337 505 7.0E-12
sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 318 505 7.0E-12
sp|P9WPN2|CP132_MYCTO Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 340 507 7.0E-12
sp|P59954|CP132_MYCBO Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 340 507 7.0E-12
sp|P12939|CP2DA_RAT Cytochrome P450 2D10 OS=Rattus norvegicus GN=Cyp2d10 PE=1 SV=1 332 509 7.0E-12
sp|P56656|CP239_MOUSE Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 348 535 7.0E-12
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 304 509 8.0E-12
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 348 532 8.0E-12
sp|Q64458|CP2CT_MOUSE Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 331 535 8.0E-12
sp|Q01361|CP2DE_BOVIN Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 332 509 8.0E-12
sp|P56655|CP238_MOUSE Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 348 535 9.0E-12
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 348 526 9.0E-12
sp|P58049|C71BB_ARATH Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 316 522 9.0E-12
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 344 504 9.0E-12
sp|P24461|CP2G1_RABIT Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 302 502 9.0E-12
sp|Q29473|CP2DF_CANLF Cytochrome P450 2D15 OS=Canis lupus familiaris GN=CYP2D15 PE=1 SV=3 296 509 1.0E-11
sp|Q9VE01|C12A5_DROME Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 345 509 1.0E-11
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 344 504 1.0E-11
sp|P00187|CP1A2_RABIT Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 348 509 1.0E-11
sp|Q64391|CP1A2_CAVPO Cytochrome P450 1A2 OS=Cavia porcellus GN=CYP1A2 PE=2 SV=1 348 517 1.0E-11
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 344 496 1.0E-11
sp|P15123|CP2CG_RABIT Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 345 535 1.0E-11
sp|O77809|CP1A2_MACFA Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 348 509 1.0E-11
sp|P05179|CP2C7_RAT Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 329 537 1.0E-11
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 311 508 1.0E-11
sp|P13527|CP6A1_MUSDO Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 344 509 1.0E-11
sp|P33263|CP2CQ_MESAU Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 333 509 1.0E-11
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 348 504 1.0E-11
sp|P11712|CP2C9_HUMAN Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 334 535 1.0E-11
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 348 496 1.0E-11
sp|Q27516|C13A8_CAEEL Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 160 509 1.0E-11
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 55 509 1.0E-11
sp|Q92095|CP1A1_OPSTA Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 348 509 1.0E-11
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 332 521 1.0E-11
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 344 496 1.0E-11
sp|B6SSW8|C14B3_MAIZE Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 299 507 1.0E-11
sp|Q92039|CP1A1_CHACA Cytochrome P450 1A1 OS=Chaetodon capistratus GN=cyp1a1 PE=2 SV=1 348 509 2.0E-11
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 348 504 2.0E-11
sp|P56593|CP2AC_MOUSE Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 321 509 2.0E-11
sp|P47787|THAS_PIG Thromboxane-A synthase OS=Sus scrofa GN=TBXAS1 PE=2 SV=1 339 538 2.0E-11
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 301 503 2.0E-11
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 341 509 2.0E-11
sp|P00176|CP2B1_RAT Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 311 509 2.0E-11
sp|Q6WNQ9|C81E9_MEDTR Isoflavone 3'-hydroxylase (Fragment) OS=Medicago truncatula GN=CYP81E9 PE=1 SV=1 317 509 2.0E-11
sp|P11371|CP2C4_RABIT Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 345 535 2.0E-11
sp|Q5RBQ1|CP1A2_PONAB Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 348 509 2.0E-11
sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 344 506 3.0E-11
sp|Q05556|CP2AB_RABIT Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 332 537 3.0E-11
sp|O42457|CP1A1_SPAAU Cytochrome P450 1A1 OS=Sparus aurata GN=cyp1a1 PE=2 SV=1 348 509 3.0E-11
sp|O16805|CP4D1_DROSI Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 306 509 3.0E-11
sp|P33269|CP4D1_DROME Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 306 509 3.0E-11
sp|P24454|CP2A8_MESAU Cytochrome P450 2A8 OS=Mesocricetus auratus GN=CYP2A8 PE=1 SV=1 348 535 3.0E-11
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 344 530 3.0E-11
sp|Q16696|CP2AD_HUMAN Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 333 537 3.0E-11
sp|P56594|CP2CL_CANLF Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 333 504 3.0E-11
sp|O42231|CP1A1_LIZAU Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1 348 509 3.0E-11
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 308 498 3.0E-11
sp|O57525|CP17A_RANDY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 296 523 3.0E-11
sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 312 508 3.0E-11
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 333 504 3.0E-11
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 310 508 3.0E-11
sp|P33261|CP2CJ_HUMAN Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 333 535 4.0E-11
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 160 509 4.0E-11
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 348 507 4.0E-11
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 348 509 4.0E-11
sp|Q91W64|CP270_MOUSE Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 333 504 4.0E-11
sp|P12938|CP2D3_RAT Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3 PE=2 SV=2 332 509 4.0E-11
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 348 517 4.0E-11
sp|Q29510|CP2CU_RABIT Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 348 535 4.0E-11
sp|Q1ZXA4|C508D_DICDI Probable cytochrome P450 508D1 OS=Dictyostelium discoideum GN=cyp508D1 PE=3 SV=1 345 508 4.0E-11
sp|P15392|CP2A4_MOUSE Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 332 504 5.0E-11
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 348 508 5.0E-11
sp|Q9VW43|CP305_DROME Probable cytochrome P450 305a1 OS=Drosophila melanogaster GN=Cyp305a1 PE=2 SV=1 351 504 5.0E-11
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 295 506 5.0E-11
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 341 509 5.0E-11
sp|P04167|CP2B2_RAT Cytochrome P450 2B2 OS=Rattus norvegicus GN=Cyp2b2 PE=1 SV=2 311 509 5.0E-11
sp|Q9CA61|C98A8_ARATH Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 345 508 5.0E-11
sp|P37121|C76A1_SOLME Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 338 508 5.0E-11
sp|P58051|C71BE_ARATH Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 348 522 6.0E-11
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 341 506 6.0E-11
sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 348 522 6.0E-11
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 341 534 6.0E-11
sp|P00179|CP2C5_RABIT Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 348 535 6.0E-11
sp|Q9VE00|C12A4_DROME Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 345 506 6.0E-11
sp|P97720|C11B1_MESAU Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1 349 504 6.0E-11
sp|Q91X77|CY250_MOUSE Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 333 509 6.0E-11
sp|Q9VHP4|CP313_DROME Probable cytochrome P450 313b1 OS=Drosophila melanogaster GN=Cyp313b1 PE=2 SV=2 310 509 6.0E-11
sp|Q9VFJ0|CA131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 341 529 6.0E-11
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 348 508 7.0E-11
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 346 536 7.0E-11
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 346 536 7.0E-11
sp|O18992|CP2DJ_CALJA Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2D19 PE=2 SV=1 332 509 7.0E-11
sp|P56592|CP1A2_CANLF Cytochrome P450 1A2 OS=Canis lupus familiaris GN=CYP1A2 PE=1 SV=2 348 517 7.0E-11
sp|P20812|CP2A3_RAT Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 332 504 7.0E-11
sp|O18596|C4D10_DROMT Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 306 509 7.0E-11
sp|Q27593|CP6A8_DROME Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 344 543 7.0E-11
sp|P10610|CP2G1_RAT Cytochrome P450 2G1 OS=Rattus norvegicus GN=Cyp2g1 PE=2 SV=1 301 502 8.0E-11
sp|P79739|CP26A_DANRE Cytochrome P450 26A1 OS=Danio rerio GN=cyp26a1 PE=2 SV=1 302 504 8.0E-11
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 341 509 8.0E-11
sp|P00191|CP21A_BOVIN Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 55 504 8.0E-11
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 299 509 8.0E-11
sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 339 497 8.0E-11
sp|Q05555|CP2AA_RABIT Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 332 537 9.0E-11
sp|Q9V399|CP303_DROME Probable cytochrome P450 303a1 OS=Drosophila melanogaster GN=Cyp303a1 PE=2 SV=1 348 503 9.0E-11
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 311 500 9.0E-11
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 305 507 9.0E-11
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 339 509 1.0E-10
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 348 504 1.0E-10
sp|P05180|CP2H1_CHICK Cytochrome P450 2H1 OS=Gallus gallus GN=CYP2H1 PE=2 SV=1 289 536 1.0E-10
sp|Q27712|CP2L1_PANAR Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 332 526 1.0E-10
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 341 506 1.0E-10
sp|Q8WNE1|CP2F5_GORGO Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 328 509 1.0E-10
sp|Q4H4C3|CP1A2_MACFU Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3 348 509 1.0E-10
sp|Q9SCN2|C71BU_ARATH Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1 341 508 1.0E-10
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 143 503 1.0E-10
sp|P49264|C71B1_THLAR Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 348 514 1.0E-10
sp|Q5KQT6|CP1A2_FELCA Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 348 517 1.0E-10
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 62 507 1.0E-10
sp|P05178|CP2C6_RAT Cytochrome P450 2C6 OS=Rattus norvegicus GN=Cyp2c6 PE=2 SV=2 332 535 1.0E-10
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 68 528 1.0E-10
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 348 496 2.0E-10
sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 348 522 2.0E-10
sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 55 508 2.0E-10
sp|P79202|CP11A_SHEEP Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 307 504 2.0E-10
sp|P79153|CP11A_CAPHI Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 307 504 2.0E-10
sp|P00180|CP2C1_RABIT Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 328 509 2.0E-10
sp|P33264|CP2CR_MESAU Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 333 509 2.0E-10
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 311 508 2.0E-10
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 304 509 2.0E-10
sp|B1NF19|C719D_ARGME (S)-stylopine synthase OS=Argemone mexicana GN=CYP719A13 PE=1 SV=1 320 496 2.0E-10
sp|Q92109|CP1A3_ONCMY Cytochrome P450 1A3 OS=Oncorhynchus mykiss GN=cyp1a3 PE=2 SV=2 348 509 2.0E-10
sp|Q9SWR5|C93C1_SOYBN 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 310 509 2.0E-10
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 339 509 2.0E-10
sp|P82711|C6A19_DROME Probable cytochrome P450 6a19 OS=Drosophila melanogaster GN=Cyp6a19 PE=3 SV=1 333 507 2.0E-10
sp|O18809|CP2F3_CAPHI Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 348 509 2.0E-10
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 348 524 2.0E-10
sp|Q2KIG5|THAS_BOVIN Thromboxane-A synthase OS=Bos taurus GN=TBXAS1 PE=2 SV=1 339 493 2.0E-10
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 341 506 2.0E-10
sp|P79402|CP242_PIG Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 333 535 2.0E-10
sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 348 524 2.0E-10
sp|Q95036|CP6B5_PAPGL Cytochrome P450 6B5 (Fragment) OS=Papilio glaucus GN=CYP6B5 PE=2 SV=1 344 516 2.0E-10
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 187 524 2.0E-10
sp|Q9VMS9|C4AC1_DROME Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 356 509 3.0E-10
sp|Q12586|CP52I_CANMA Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 325 504 3.0E-10
sp|Q50LH4|C7193_ESCCA (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 346 496 3.0E-10
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 341 508 3.0E-10
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 337 505 3.0E-10
sp|Q27902|CP6B4_PAPGL Cytochrome P450 6B4 OS=Papilio glaucus GN=CYP6B4 PE=2 SV=1 344 516 3.0E-10
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 339 528 3.0E-10
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 344 504 3.0E-10
sp|Q9SXS3|C93C2_GLYEC 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 300 509 3.0E-10
sp|Q29527|C11B1_PAPHU Cytochrome P450 11B1, mitochondrial OS=Papio hamadryas ursinus GN=CYP11B1 PE=3 SV=1 320 492 3.0E-10
sp|P24903|CP2F1_HUMAN Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 348 509 3.0E-10
sp|P79716|CP1A1_DICLA Cytochrome P450 1A1 OS=Dicentrarchus labrax GN=cyp1a1 PE=2 SV=1 348 509 3.0E-10
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 344 508 3.0E-10
sp|Q9VYT8|C28C1_DROME Probable cytochrome P450 28c1 OS=Drosophila melanogaster GN=Cyp28c1 PE=2 SV=1 315 493 4.0E-10
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 351 508 4.0E-10
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 348 509 4.0E-10
sp|Q9W683|CP1A1_LIZSA Cytochrome P450 1A1 OS=Liza saliens GN=cyp1a1 PE=2 SV=1 348 509 4.0E-10
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 313 514 4.0E-10
sp|Q0DS59|C14B2_ORYSJ Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 351 540 4.0E-10
sp|Q9QZ82|CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus GN=Cyp11a1 PE=1 SV=1 348 504 4.0E-10
sp|P15539|C11B2_MOUSE Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 349 504 4.0E-10
sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 55 508 4.0E-10
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 348 515 4.0E-10
sp|P70687|CP17A_MESAU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 348 509 4.0E-10
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 55 509 4.0E-10
sp|P15538|C11B1_HUMAN Cytochrome P450 11B1, mitochondrial OS=Homo sapiens GN=CYP11B1 PE=1 SV=5 333 492 4.0E-10
sp|G4XV71|C93C2_GLYUR 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 300 509 4.0E-10
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 328 502 5.0E-10
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 291 496 5.0E-10
sp|P50859|CP51_CANGA Lanosterol 14-alpha demethylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG11 PE=3 SV=1 290 509 5.0E-10
sp|Q04552|CP6B1_PAPPO Cytochrome P450 6B1 OS=Papilio polyxenes GN=CYP6B1 PE=1 SV=1 312 507 5.0E-10
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 345 508 5.0E-10
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 309 498 5.0E-10
sp|Q9FXW4|C80B2_COPJA Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 348 509 5.0E-10
sp|L7X0L7|P6H_PAPSO Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 341 537 6.0E-10
sp|Q64408|C11B1_CAVPO Cytochrome P450 11B1, mitochondrial OS=Cavia porcellus GN=CYP11B1 PE=2 SV=1 338 504 6.0E-10
sp|Q92148|CP1A1_MICTO Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1 348 509 6.0E-10
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 314 495 6.0E-10
sp|B1NF18|C719B_PAPSO Salutaridine synthase OS=Papaver somniferum GN=CYP719B1 PE=1 SV=1 341 496 6.0E-10
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 346 523 6.0E-10
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 317 509 6.0E-10
sp|Q08078|CP2CP_MESAU Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 333 509 6.0E-10
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 348 518 7.0E-10
sp|Q54ZM4|C518A_DICDI Probable cytochrome P450 518A1 OS=Dictyostelium discoideum GN=cyp518A1 PE=3 SV=1 348 507 7.0E-10
sp|Q50EK1|C16B1_PICSI Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1 295 504 7.0E-10
sp|P00181|CP2C2_RABIT Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 333 509 7.0E-10
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 323 498 7.0E-10
sp|Q9V419|C28A5_DROME Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 274 500 7.0E-10
sp|Q9SP06|C80B3_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 284 509 7.0E-10
sp|Q43240|TCMO_ZINVI Trans-cinnamate 4-monooxygenase OS=Zinnia violacea GN=CYP73A12 PE=2 SV=1 295 509 8.0E-10
sp|Q92110|CP1A1_ONCMY Cytochrome P450 1A1 OS=Oncorhynchus mykiss GN=cyp1a1 PE=2 SV=2 348 509 8.0E-10
sp|Q9V9L1|CP6W1_DROME Probable cytochrome P450 6w1 OS=Drosophila melanogaster GN=Cyp6w1 PE=2 SV=1 339 496 8.0E-10
sp|O64900|C80B2_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1 348 496 8.0E-10
sp|Q6VVW9|CP2R1_MOUSE Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 152 509 8.0E-10
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 160 504 8.0E-10
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 318 523 9.0E-10
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 339 538 9.0E-10
sp|P98183|C71DC_CATRO Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1 286 531 9.0E-10
sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 339 538 9.0E-10
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 346 508 9.0E-10
sp|B5BSX1|BAMO_GLYUR Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 346 509 1.0E-09
sp|P33260|CP2CI_HUMAN Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 348 535 1.0E-09
sp|O35293|CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 332 504 1.0E-09
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 160 504 1.0E-09
sp|Q29552|C11B1_PIG Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 349 504 1.0E-09
sp|P56657|CP240_MOUSE Cytochrome P450 2C40 OS=Mus musculus GN=Cyp2c40 PE=1 SV=2 348 535 1.0E-09
sp|Q27756|CP6B3_PAPPO Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 293 507 1.0E-09
sp|O64989|C90B1_ARATH Cytochrome P450 90B1 OS=Arabidopsis thaliana GN=CYP90B1 PE=1 SV=2 346 504 1.0E-09
sp|P17666|CP2CE_RABIT Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=CYP2C14 PE=2 SV=1 333 509 1.0E-09
sp|O04790|C75A7_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 348 534 1.0E-09
sp|Q9LIP4|C71BX_ARATH Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 150 490 1.0E-09
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 138 504 1.0E-09
sp|P20814|CP2CD_RAT Cytochrome P450 2C13, male-specific OS=Rattus norvegicus GN=Cyp2c13 PE=1 SV=1 348 537 1.0E-09
sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 315 496 1.0E-09
sp|I3V6B1|C80BX_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase-like protein OS=Papaver somniferum GN=CYP80BX PE=2 SV=1 284 493 1.0E-09
sp|O23976|C76B1_HELTU 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 348 509 2.0E-09
sp|Q9VCW1|CP6D4_DROME Probable cytochrome P450 6d4 OS=Drosophila melanogaster GN=Cyp6d4 PE=2 SV=1 344 492 2.0E-09
sp|H2DH22|C7A10_PANGI Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 42 496 2.0E-09
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 300 534 2.0E-09
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 341 507 2.0E-09
sp|O62671|CP241_CANLF Cytochrome P450 2C41 OS=Canis lupus familiaris GN=CYP2C41 PE=2 SV=1 339 509 2.0E-09
sp|Q9V675|CP6G2_DROME Probable cytochrome P450 6g2 OS=Drosophila melanogaster GN=Cyp6g2 PE=2 SV=1 339 518 2.0E-09
sp|Q9W130|CP9C1_DROME Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 333 500 2.0E-09
sp|Q27664|CP6B2_HELAM Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 341 493 2.0E-09
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 326 515 2.0E-09
sp|P33265|CP2CS_MESAU Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1 328 535 2.0E-09
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 305 518 2.0E-09
sp|O64899|C80B1_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1 348 496 2.0E-09
sp|Q96418|C75A5_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 348 534 2.0E-09
sp|Q8GSQ1|C85A1_ORYSJ Cytochrome P450 85A1 OS=Oryza sativa subsp. japonica GN=CYP85A1 PE=1 SV=1 335 504 2.0E-09
sp|P05108|CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens GN=CYP11A1 PE=1 SV=2 249 504 2.0E-09
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 339 528 2.0E-09
sp|P11715|CP17A_RAT Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 348 523 2.0E-09
sp|Q43033|TCMO_PETCR Trans-cinnamate 4-monooxygenase OS=Petroselinum crispum GN=CYP73A10 PE=2 SV=1 314 509 2.0E-09
sp|P24453|CP1A2_MESAU Cytochrome P450 1A2 OS=Mesocricetus auratus GN=CYP1A2 PE=1 SV=4 348 517 2.0E-09
sp|Q9AXH9|KAO1_HORVU Ent-kaurenoic acid oxidase 1 OS=Hordeum vulgare GN=KAO1 PE=1 SV=1 349 504 2.0E-09
sp|P79761|CP1A5_CHICK Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 348 509 2.0E-09
sp|O46515|CP11A_HORSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Equus caballus GN=CYP11A1 PE=3 SV=1 321 504 2.0E-09
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 305 509 3.0E-09
sp|Q96581|C75A4_GENTR Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 326 524 3.0E-09
sp|Q43067|TCMO_PEA Trans-cinnamate 4-monooxygenase OS=Pisum sativum GN=CYP73A9 PE=2 SV=2 301 537 3.0E-09
sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 179 509 3.0E-09
sp|P9WPM5|CP137_MYCTU Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp137 PE=1 SV=1 341 546 3.0E-09
sp|P9WPM4|CP137_MYCTO Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp137 PE=3 SV=1 341 546 3.0E-09
sp|P33267|CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 332 502 3.0E-09
sp|P08683|CP2CB_RAT Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 332 523 3.0E-09
sp|Q6JZS3|CP1A1_ORYLA Cytochrome P450 1A1 OS=Oryzias latipes GN=cyp1a1 PE=3 SV=1 348 509 3.0E-09
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 348 517 3.0E-09
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 345 509 3.0E-09
sp|P19225|CP270_RAT Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 333 535 3.0E-09
sp|Q29478|CP2CV_CAPHE Cytochrome P450 2C31 (Fragment) OS=Capra hircus aegagrus GN=CYP2C31 PE=2 SV=1 334 504 3.0E-09
sp|Q6XVG2|CP254_MOUSE Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=1 SV=1 313 509 4.0E-09
sp|Q964Q7|CP6D3_MUSDO Cytochrome P450 6d3 OS=Musca domestica GN=CYP6D3 PE=2 SV=1 339 514 4.0E-09
sp|Q95031|CP6B6_HELAM Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 344 540 4.0E-09
sp|Q43246|C88A1_MAIZE Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1 349 504 4.0E-09
sp|P51663|C11B1_SHEEP Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 349 504 4.0E-09
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 345 509 4.0E-09
sp|Q9VMS7|C4AC3_DROME Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 344 547 4.0E-09
sp|Q2XV99|CP11A_MACFA Cholesterol side-chain cleavage enzyme, mitochondrial OS=Macaca fascicularis GN=CYP11A1 PE=2 SV=1 272 504 4.0E-09
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 341 506 5.0E-09
sp|Q6YV88|C71Z7_ORYSJ Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 396 508 5.0E-09
sp|Q9EPT4|CP11A_MESAU Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mesocricetus auratus GN=CYP11A1 PE=2 SV=1 305 504 5.0E-09
sp|Q9VG17|CP304_DROME Probable cytochrome P450 304a1 OS=Drosophila melanogaster GN=Cyp304a1 PE=2 SV=2 360 507 5.0E-09
sp|Q64658|C11B2_MESAU Cytochrome P450 11B2, mitochondrial OS=Mesocricetus auratus GN=CYP11B2 PE=2 SV=1 339 504 6.0E-09
sp|Q9VWR5|CP306_DROME Cytochrome P450 306a1 OS=Drosophila melanogaster GN=phm PE=1 SV=1 324 509 6.0E-09
sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 326 509 6.0E-09
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 94 509 6.0E-09
sp|O04773|C75A6_CAMME Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1 348 507 6.0E-09
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 341 506 6.0E-09
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 339 509 6.0E-09
sp|Q9LTM2|C71BL_ARATH Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=3 SV=1 346 493 6.0E-09
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 300 518 6.0E-09
sp|P15393|C11B1_RAT Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 313 499 6.0E-09
sp|P9WPM3|CP138_MYCTU Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp138 PE=1 SV=1 309 540 7.0E-09
sp|P9WPM2|CP138_MYCTO Putative cytochrome P450 138 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp138 PE=3 SV=1 309 540 7.0E-09
sp|P63718|CP138_MYCBO Putative cytochrome P450 138 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp138 PE=3 SV=1 309 540 7.0E-09
sp|Q64403|CP2DG_CAVPO Cytochrome P450 2D16 OS=Cavia porcellus GN=CYP2D16 PE=1 SV=1 333 509 7.0E-09
sp|Q50LH3|C7192_ESCCA (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 320 496 7.0E-09
sp|Q27698|CP6D1_MUSDO Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 318 492 7.0E-09
sp|B5UAQ8|C7195_ESCCA Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 352 496 8.0E-09
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 340 509 8.0E-09
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 339 504 8.0E-09
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 341 518 8.0E-09
sp|I7CT85|C7A53_PANGI Protopanaxadiol 6-hydroxylase OS=Panax ginseng PE=1 SV=1 303 504 8.0E-09
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 284 508 9.0E-09
sp|P52786|CP2J1_RABIT Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 348 518 9.0E-09
sp|Q9VGZ0|C12E1_DROME Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 345 509 9.0E-09
sp|Q9V674|CP6G1_DROME Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 332 492 9.0E-09
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 315 509 1.0E-08
sp|Q07217|CP11A_ONCMY Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 349 504 1.0E-08
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 344 509 1.0E-08
sp|P33262|CP2CK_MACFA Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 328 509 1.0E-08
sp|Q64583|CP2BF_RAT Cytochrome P450 2B15 OS=Rattus norvegicus GN=Cyp2b15 PE=3 SV=2 367 509 1.0E-08
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 339 496 1.0E-08
sp|P30437|CP17A_ONCMY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 348 509 1.0E-08
sp|Q9LTM1|C71BM_ARATH Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1 328 527 1.0E-08
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 339 536 1.0E-08
sp|P10632|CP2C8_HUMAN Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 328 535 1.0E-08
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 326 509 1.0E-08
sp|Q759W0|CP51_ASHGO Lanosterol 14-alpha demethylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG11 PE=3 SV=1 347 509 1.0E-08
sp|O23051|KAO1_ARATH Ent-kaurenoic acid oxidase 1 OS=Arabidopsis thaliana GN=KAO1 PE=2 SV=1 349 504 1.0E-08
sp|P15150|C11B1_BOVIN Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 349 504 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 346 368 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8190
MPHFGLELNMKDAARGLLLLFFLYRSCVLLHRLFLSRLAKFPGPRLAAASSWYEAFFDLRSANFPDVLQSLHSRY
GPIVRVNPWELSILDPDFYDSVYVSAAKRRTTLIAGARAGLGMSGRPRILVRPKGTGTTDEPDAISTTSSHEVHR
MRRKAVEGFFSKQSVIRMESRIHDEVSSLEDKLRSLDATGTVVRLDHAFTCVTGDLAGLFAAGENPRLLEAPDFN
PEWHDSVMGILSVVPYVRNFPWINSVLGVIPLWLLQKLNPRAAGFRAFHLVRLPFRLLCVRRLTCISGTQLCGRR
VAEVKADIASKSELKESDKTSIFHHILQSDVPESEKAPDRMRREAFALLAAGTITTASTVSLITFYVLADPAVEK
RLRQELHFVADALPEKLPRWTDLEKLPYLTACIKEGLRLSRFFRRSPRISPDHEIQYKQWTIPKNTPVGMSICHM
LMDPDVYPDPHEFKPERWIGDVDARVHRNFVPFVRGSRNCLGLNLAWAEMYIILGVLFRPGGHKMSLDCDESDMV
LVHDSDVGIPKTGSRGLRVRFE*
Coding >Hirsu2|8190
ATGCCGCACTTTGGCCTCGAGCTCAACATGAAGGATGCCGCTCGCGGGCTCCTGCTCTTGTTCTTCCTGTACCGG
TCCTGCGTTCTGCTTCACCGTCTCTTCCTGTCTCGCCTCGCCAAGTTTCCGGGCCCCAGGCTCGCGGCCGCGAGC
TCGTGGTACGAGGCCTTCTTCGACCTCCGCAGCGCAAACTTTCCCGACGTCCTGCAGAGTCTTCACAGCCGATAC
GGTCCCATCGTCCGCGTCAATCCGTGGGAGCTTTCCATCCTGGACCCAGACTTCTACGACAGCGTCTACGTTTCC
GCAGCCAAGCGACGGACGACCCTGATTGCCGGGGCCCGTGCCGGCCTCGGCATGTCCGGTAGGCCCCGGATCCTC
GTCCGGCCAAAGGGCACCGGCACGACTGACGAGCCAGATGCCATCTCCACGACGAGCAGCCACGAGGTCCACAGG
ATGAGGAGGAAGGCGGTCGAAGGCTTCTTCTCCAAGCAGAGCGTCATCCGCATGGAATCCCGCATCCACGACGAA
GTGAGCAGCTTGGAGGACAAGCTGCGGTCTTTGGATGCTACCGGCACCGTCGTCCGCCTCGACCACGCTTTCACG
TGTGTGACTGGGGATCTCGCCGGCTTGTTCGCAGCCGGCGAGAATCCGCGGCTTCTCGAGGCGCCCGACTTCAAC
CCGGAGTGGCACGACAGCGTCATGGGCATCCTCAGCGTGGTGCCCTATGTGCGAAACTTTCCCTGGATCAACAGC
GTCCTGGGCGTGATCCCCCTGTGGCTTCTCCAGAAGCTCAACCCGCGCGCCGCTGGCTTCAGGGCGTTCCATCTG
GTCAGGCTGCCCTTCCGCCTCCTCTGCGTTCGCCGACTGACTTGCATCTCGGGAACGCAGCTCTGCGGCCGGCGC
GTGGCAGAAGTCAAGGCCGACATTGCGAGTAAGAGCGAGCTCAAGGAGTCGGACAAGACGTCGATTTTTCACCAC
ATCCTCCAGAGCGACGTGCCCGAGTCGGAAAAGGCACCCGACCGCATGCGACGGGAAGCCTTTGCCCTCCTGGCA
GCCGGGACCATCACCACTGCCAGCACCGTGTCGCTGATAACCTTCTACGTCCTTGCCGATCCGGCCGTGGAGAAG
CGGCTTCGACAAGAGCTGCATTTCGTCGCGGATGCCCTGCCGGAGAAGCTTCCCAGATGGACGGATCTGGAGAAG
CTTCCTTACCTGACGGCCTGCATCAAAGAGGGACTGCGCCTGTCAAGATTCTTCCGGCGCAGTCCCCGAATCTCG
CCCGATCACGAGATCCAATACAAGCAGTGGACGATTCCCAAGAATACGCCTGTTGGCATGTCCATTTGCCACATG
CTCATGGATCCAGACGTGTATCCCGACCCTCACGAGTTCAAGCCCGAGCGTTGGATCGGAGACGTCGACGCTCGT
GTACACCGCAATTTCGTGCCCTTTGTCAGAGGATCACGAAACTGCCTCGGCCTCAATTTGGCGTGGGCCGAGATG
TACATCATCCTCGGCGTCCTCTTCCGGCCCGGAGGGCATAAGATGAGTCTGGACTGCGACGAGTCTGACATGGTG
CTCGTCCACGACAGCGACGTCGGGATCCCAAAGACCGGAAGCAGGGGGCTCAGAGTCCGCTTCGAGTAA
Transcript >Hirsu2|8190
ATGCCGCACTTTGGCCTCGAGCTCAACATGAAGGATGCCGCTCGCGGGCTCCTGCTCTTGTTCTTCCTGTACCGG
TCCTGCGTTCTGCTTCACCGTCTCTTCCTGTCTCGCCTCGCCAAGTTTCCGGGCCCCAGGCTCGCGGCCGCGAGC
TCGTGGTACGAGGCCTTCTTCGACCTCCGCAGCGCAAACTTTCCCGACGTCCTGCAGAGTCTTCACAGCCGATAC
GGTCCCATCGTCCGCGTCAATCCGTGGGAGCTTTCCATCCTGGACCCAGACTTCTACGACAGCGTCTACGTTTCC
GCAGCCAAGCGACGGACGACCCTGATTGCCGGGGCCCGTGCCGGCCTCGGCATGTCCGGTAGGCCCCGGATCCTC
GTCCGGCCAAAGGGCACCGGCACGACTGACGAGCCAGATGCCATCTCCACGACGAGCAGCCACGAGGTCCACAGG
ATGAGGAGGAAGGCGGTCGAAGGCTTCTTCTCCAAGCAGAGCGTCATCCGCATGGAATCCCGCATCCACGACGAA
GTGAGCAGCTTGGAGGACAAGCTGCGGTCTTTGGATGCTACCGGCACCGTCGTCCGCCTCGACCACGCTTTCACG
TGTGTGACTGGGGATCTCGCCGGCTTGTTCGCAGCCGGCGAGAATCCGCGGCTTCTCGAGGCGCCCGACTTCAAC
CCGGAGTGGCACGACAGCGTCATGGGCATCCTCAGCGTGGTGCCCTATGTGCGAAACTTTCCCTGGATCAACAGC
GTCCTGGGCGTGATCCCCCTGTGGCTTCTCCAGAAGCTCAACCCGCGCGCCGCTGGCTTCAGGGCGTTCCATCTG
GTCAGGCTGCCCTTCCGCCTCCTCTGCGTTCGCCGACTGACTTGCATCTCGGGAACGCAGCTCTGCGGCCGGCGC
GTGGCAGAAGTCAAGGCCGACATTGCGAGTAAGAGCGAGCTCAAGGAGTCGGACAAGACGTCGATTTTTCACCAC
ATCCTCCAGAGCGACGTGCCCGAGTCGGAAAAGGCACCCGACCGCATGCGACGGGAAGCCTTTGCCCTCCTGGCA
GCCGGGACCATCACCACTGCCAGCACCGTGTCGCTGATAACCTTCTACGTCCTTGCCGATCCGGCCGTGGAGAAG
CGGCTTCGACAAGAGCTGCATTTCGTCGCGGATGCCCTGCCGGAGAAGCTTCCCAGATGGACGGATCTGGAGAAG
CTTCCTTACCTGACGGCCTGCATCAAAGAGGGACTGCGCCTGTCAAGATTCTTCCGGCGCAGTCCCCGAATCTCG
CCCGATCACGAGATCCAATACAAGCAGTGGACGATTCCCAAGAATACGCCTGTTGGCATGTCCATTTGCCACATG
CTCATGGATCCAGACGTGTATCCCGACCCTCACGAGTTCAAGCCCGAGCGTTGGATCGGAGACGTCGACGCTCGT
GTACACCGCAATTTCGTGCCCTTTGTCAGAGGATCACGAAACTGCCTCGGCCTCAATTTGGCGTGGGCCGAGATG
TACATCATCCTCGGCGTCCTCTTCCGGCCCGGAGGGCATAAGATGAGTCTGGACTGCGACGAGTCTGACATGGTG
CTCGTCCACGACAGCGACGTCGGGATCCCAAAGACCGGAAGCAGGGGGCTCAGAGTCCGCTTCGAGTAA
Gene >Hirsu2|8190
ATGCCGCACTTTGGCCTCGAGCTCAACATGAAGGATGCCGCTCGCGGGCTCCTGCTCTTGTTCTTCCTGTACCGG
TCCTGCGTTCTGCTTCACCGTCTCTTCCTGTCTCGCCTCGCCAAGTTTCCGGGCCCCAGGCTCGCGGCCGCGAGC
TCGTGGTACGAGGCCTTCTTCGACCTCCGCAGCGCAAACTTTCCCGACGTCCTGCAGAGTCTTCACAGCCGATAC
GGTCAGTCGAGGTTCGCGCCTGAGACCATTGAAGTTCATGCCGACTGACGAAGTCACAAGGTCCCATCGTCCGCG
TCAATCCGTGGGAGCTTTCCATCCTGGACCCAGACTTCTACGACAGCGTCTACGTTTCCGCAGCCAAGCGACGGA
CGACCCTGATTGCCGGGGCCCGTGCCGGCCTCGGCATGTCCGGTAGGCCCCGGATCCTCGTCCGGCCAAAGGGCA
CCGGCACGACTGACGAGCCAGATGCCATCTCCACGACGAGCAGCCACGAGGTCCACAGGATGAGGAGGAAGGCGG
TCGAAGGCTTCTTCTCCAAGCAGAGCGTCATCCGCATGGAATCCCGCATCCACGACGAAGTGAGCAGCTTGGAGG
ACAAGCTGCGGTCTTTGGATGCTACCGGCACCGTCGTCCGCCTCGACCACGCTTTCACGTGTGTGACTGGGGATC
TCGCCGGCTTGTTCGCAGCCGGCGAGAATCCGCGGCTTCTCGAGGCGCCCGACTTCAACCCGGAGTGGTGCGCTG
CCCTGCACAGAGGCCCCCTCTTGGATACCGTGCAGCTTACCATTCTTTACTGCCTAGGCACGACAGCGTCATGGG
CATCCTCAGCGTGGTGCCCTATGTGCGAAACTTTCCCTGGATCAACAGGTATTCGCACCGGCTGCGCCTGAACTC
GACCAGTCCTCGACACTGACCCTTGTACGCAGCGTCCTGGGCGTGATCCCCCTGTGGCTTCTCCAGAAGCTCAAC
CCGCGCGCCGCTGGCTTCAGGGCGTTCCATCTGGTCAGGCTGCCCTTCCGCCTCCTCTGCGTTCGCCGACTGACT
TGCATCTCGGGAACGCAGCTCTGCGGCCGGCGCGTGGCAGAAGTCAAGGCCGACATTGCGAGTAAGAGCGAGCTC
AAGGAGTCGGACAAGACGTCGATTTTTCACCACATCCTCCAGAGCGACGTGCCCGAGTCGGAAAAGGCACCCGAC
CGCATGCGACGGGAAGCCTTTGCCCTCCTGGCAGCCGGGACCATCACCACTGCCAGCACCGTGTCGCTGATAACC
TTCTACGTCCTTGCCGATCCGGCCGTGGAGAAGCGGCTTCGACAAGAGCTGCATTTCGTCGCGGATGCCCTGCCG
GAGAAGCTTCCCAGATGGACGGATCTGGAGAAGCTTCCTTACCTGACGGCCTGCATCAAAGAGGGACTGCGGTTC
GTGACCAACCGACGCCTGCCTATGAATCTCGGCATCAGCTGACAGTGGCCCTCAAACGTACATCTCTAGCCTGTC
AAGATTCTTCCGGCGCAGTCCCCGAATCTCGCCCGATCACGAGATCCAATACAAGCAGTGGACGATTCCCAAGAA
TGTAGGTGGCTGGTGCCTGTGACGAACACAGCTCTTGAAGTCTTTCTAACCGGCATAACAGACGCCTGTTGGCAT
GTCCATTTGCCACATGCTCATGGATCCAGACGTGTATCCCGACCCTCACGAGTTCAAGCCCGAGCGTTGGATCGG
AGACGTCGACGCTCGTGTACACCGCAATTTCGTGCCCTTTGTCAGAGGATCACGAAACTGCCTCGGCCTCAAGTG
AGTTTCTGGAATCTACAGGCCACCGCCACAGCCCATGTTCCGTCCGACTGACCGTGGCTCCCCATCCAGTTTGGC
GTGGGCCGAGATGTACATCATCCTCGGCGTCCTCTTCCGGCCCGGAGGGCATAAGATGAGTCTGGACTGCGACGA
GTCTGACATGGTGCTCGTCCACGACAGCGACGTCGGGATCCCAAAGACCGGAAGCAGGGGGCTCAGAGTCCGCTT
CGAGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail