Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8188
Gene name
LocationContig_519:1223..2881
Strand-
Gene length (bp)1658
Transcript length (bp)1458
Coding sequence length (bp)1458
Protein length (aa) 486

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.0E-20 55 185
PF08031 BBE Berberine and berberine like 1.7E-04 434 478

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 39 471 5.0E-17
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 22 215 1.0E-13
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 61 290 4.0E-10
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 28 290 4.0E-09
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 55 216 5.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 39 471 5.0E-17
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 22 215 1.0E-13
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 61 290 4.0E-10
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 28 290 4.0E-09
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 55 216 5.0E-09
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 81 478 5.0E-09
sp|P93479|RETO_PAPSO Reticuline oxidase OS=Papaver somniferum GN=BBE1 PE=2 SV=1 46 198 7.0E-09
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 35 260 1.0E-08
sp|P30986|RETO_ESCCA Reticuline oxidase OS=Eschscholzia californica GN=BBE1 PE=1 SV=1 55 478 6.0E-08
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 55 478 2.0E-07
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 1 245 2.0E-06
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 57 198 2.0E-06
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 81 208 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8188
MLAPVSALLLLASAASGQNGWPGSIANEVNGPSWPQFANATQRWSTYAAPTFNEVFIPRTEADLSTGLKYLSRAN
KTWLAKSGGHGYSVTLESVQDAVLINMGNFNRIAMNGSKVTVGTGATFAELVDAVAAAGRELTVGACPCVGAMGA
MLGGGLGRLEGLHGLTSDALLSARVALWDGSIVEASKKKNADLFWGIRGAGQNFGIVFEAVFDTYPATNGGMQYS
ADLTFGRDKLEAVVNVTNTLLAPELDPALALAISLANDPETLEPVVTVNIVYPGPPDKGRRFRQLYSALSSNYTE
QMTAWAKLADVALPGVVLAGCPKGKPHDQYSILTENLSASALASAHDSLSAFARQHPAANGSSIFIETFGQRALK
AIPQDSSAFPHRSYFRNAVVFTMTYTDDAVAEAADGWARRMRNTFAQPSVSGYGEWHVYQNYGHGDEPPSALYGY
EGWRHERLTRLKNRYDPHGFFDGFHAIPRNLADWS*
Coding >Hirsu2|8188
ATGCTCGCACCCGTTTCTGCCCTGCTGCTCTTGGCGAGCGCAGCGTCCGGCCAGAACGGCTGGCCCGGCTCCATC
GCCAACGAGGTGAATGGGCCGTCGTGGCCGCAGTTCGCCAACGCCACCCAGCGCTGGTCGACGTACGCGGCCCCG
ACCTTCAACGAGGTCTTCATCCCTCGAACAGAGGCGGACCTGTCGACCGGGCTCAAGTATCTTTCGCGTGCCAAC
AAGACGTGGCTGGCCAAGTCGGGCGGCCACGGATATTCCGTCACGCTCGAGTCGGTGCAGGATGCGGTCCTCATC
AACATGGGCAACTTCAACCGCATAGCCATGAACGGCTCCAAGGTGACGGTGGGAACGGGCGCGACCTTCGCCGAA
CTGGTCGACGCCGTCGCCGCCGCCGGCCGAGAGCTGACCGTCGGCGCGTGTCCATGCGTCGGCGCCATGGGCGCC
ATGCTCGGCGGCGGGCTCGGCCGTCTCGAGGGCCTGCACGGGCTGACGAGCGATGCGCTGCTGAGCGCCCGCGTC
GCGCTGTGGGACGGCAGCATCGTCGAGGCCTCGAAGAAGAAGAACGCGGACCTCTTCTGGGGCATCCGCGGCGCC
GGCCAGAACTTCGGCATCGTCTTCGAGGCCGTCTTCGACACGTACCCGGCCACCAACGGCGGCATGCAGTACAGC
GCAGACCTGACCTTCGGCCGCGACAAGCTCGAGGCCGTCGTCAACGTGACCAACACGCTGCTGGCTCCTGAGCTC
GACCCGGCCCTGGCCCTGGCCATCTCGCTGGCCAACGACCCGGAGACGCTCGAGCCCGTCGTGACGGTCAACATC
GTCTACCCCGGCCCGCCGGACAAGGGCCGGCGGTTCCGGCAGCTGTACTCGGCCCTGAGCTCCAACTACACGGAG
CAGATGACGGCGTGGGCCAAGCTGGCCGACGTTGCCCTGCCGGGCGTCGTCTTGGCCGGGTGCCCCAAGGGCAAG
CCGCACGACCAGTACAGCATCCTGACGGAGAACCTGTCGGCCTCGGCCCTGGCCTCGGCCCACGACTCGCTCTCG
GCCTTTGCGCGGCAGCACCCGGCCGCCAACGGGAGCAGCATCTTCATCGAGACGTTCGGCCAGCGGGCCCTCAAG
GCGATCCCGCAGGACAGCTCCGCCTTCCCGCACCGCAGCTACTTCCGCAACGCCGTCGTCTTCACCATGACGTAC
ACCGACGATGCCGTGGCCGAGGCCGCCGACGGCTGGGCCCGCCGCATGCGCAACACCTTTGCCCAGCCCAGCGTT
TCCGGCTACGGCGAGTGGCACGTCTACCAGAACTACGGACACGGGGACGAGCCGCCGTCGGCCTTGTACGGCTAC
GAGGGCTGGCGCCACGAGAGACTGACGAGGCTGAAGAACCGCTATGATCCGCACGGCTTCTTCGACGGATTCCAC
GCCATCCCGAGGAATCTCGCAGACTGGTCTTGA
Transcript >Hirsu2|8188
ATGCTCGCACCCGTTTCTGCCCTGCTGCTCTTGGCGAGCGCAGCGTCCGGCCAGAACGGCTGGCCCGGCTCCATC
GCCAACGAGGTGAATGGGCCGTCGTGGCCGCAGTTCGCCAACGCCACCCAGCGCTGGTCGACGTACGCGGCCCCG
ACCTTCAACGAGGTCTTCATCCCTCGAACAGAGGCGGACCTGTCGACCGGGCTCAAGTATCTTTCGCGTGCCAAC
AAGACGTGGCTGGCCAAGTCGGGCGGCCACGGATATTCCGTCACGCTCGAGTCGGTGCAGGATGCGGTCCTCATC
AACATGGGCAACTTCAACCGCATAGCCATGAACGGCTCCAAGGTGACGGTGGGAACGGGCGCGACCTTCGCCGAA
CTGGTCGACGCCGTCGCCGCCGCCGGCCGAGAGCTGACCGTCGGCGCGTGTCCATGCGTCGGCGCCATGGGCGCC
ATGCTCGGCGGCGGGCTCGGCCGTCTCGAGGGCCTGCACGGGCTGACGAGCGATGCGCTGCTGAGCGCCCGCGTC
GCGCTGTGGGACGGCAGCATCGTCGAGGCCTCGAAGAAGAAGAACGCGGACCTCTTCTGGGGCATCCGCGGCGCC
GGCCAGAACTTCGGCATCGTCTTCGAGGCCGTCTTCGACACGTACCCGGCCACCAACGGCGGCATGCAGTACAGC
GCAGACCTGACCTTCGGCCGCGACAAGCTCGAGGCCGTCGTCAACGTGACCAACACGCTGCTGGCTCCTGAGCTC
GACCCGGCCCTGGCCCTGGCCATCTCGCTGGCCAACGACCCGGAGACGCTCGAGCCCGTCGTGACGGTCAACATC
GTCTACCCCGGCCCGCCGGACAAGGGCCGGCGGTTCCGGCAGCTGTACTCGGCCCTGAGCTCCAACTACACGGAG
CAGATGACGGCGTGGGCCAAGCTGGCCGACGTTGCCCTGCCGGGCGTCGTCTTGGCCGGGTGCCCCAAGGGCAAG
CCGCACGACCAGTACAGCATCCTGACGGAGAACCTGTCGGCCTCGGCCCTGGCCTCGGCCCACGACTCGCTCTCG
GCCTTTGCGCGGCAGCACCCGGCCGCCAACGGGAGCAGCATCTTCATCGAGACGTTCGGCCAGCGGGCCCTCAAG
GCGATCCCGCAGGACAGCTCCGCCTTCCCGCACCGCAGCTACTTCCGCAACGCCGTCGTCTTCACCATGACGTAC
ACCGACGATGCCGTGGCCGAGGCCGCCGACGGCTGGGCCCGCCGCATGCGCAACACCTTTGCCCAGCCCAGCGTT
TCCGGCTACGGCGAGTGGCACGTCTACCAGAACTACGGACACGGGGACGAGCCGCCGTCGGCCTTGTACGGCTAC
GAGGGCTGGCGCCACGAGAGACTGACGAGGCTGAAGAACCGCTATGATCCGCACGGCTTCTTCGACGGATTCCAC
GCCATCCCGAGGAATCTCGCAGACTGGTCTTGA
Gene >Hirsu2|8188
ATGCTCGCACCCGTTTCTGCCCTGCTGCTCTTGGCGAGCGCAGCGTCCGGCCAGAACGGCTGGCCCGGCTCCATC
GCCAACGAGGTGAATGGGCCGTCGTGGCCGCAGTTCGCCAACGCCACCCAGCGCTGGTCGACGTACGCGGCCCCG
ACCTTCAACGAGGTCTTCATCCCTCGAACAGAGGCGGACCTGTCGACCGGGGTAAGTCCTGCAGCAAGAGACGGC
TCCAGGGACTCGAGGGTAACGGACGGCGCCTATGTTTGCAGCTCAAGTATCTTTCGCGTGCCAACAAGACGTGGC
TGGCCAAGTCGGGCGGCCACGGATATTCCGTCACGCTCGAGTCGGTGCAGGATGCGGTCCTCATCAACATGGGCA
ACTTCAACCGCATAGCCATGAACGGCTCCAAGGTGACGGTGGGAACGGGCGCGACCTTCGCCGAACTGGTCGACG
CCGTCGCCGCCGCCGGCCGAGAGCTGAGTGCGTCAGGCCGGTCCGGTCATGAGAAGGGGTCGAGGACGGGCAGCG
AGACTGACGGAGACGAACGGACACAGCCGTCGGCGCGTGTCCATGCGTCGGCGCCATGGGCGCCATGCTCGGCGG
CGGGCTCGGCCGTCTCGAGGGCCTGCACGGGCTGACGAGCGATGCGCTGCTGAGCGCCCGCGTCGCGCTGTGGGA
CGGCAGCATCGTCGAGGCCTCGAAGAAGAAGAACGCGGACCTCTTCTGGGGCATCCGCGGCGCCGGCCAGAACTT
CGGCATCGTCTTCGAGGCCGTCTTCGACACGTACCCGGCCACCAACGGCGGCATGCAGTACAGCGCAGACCTGAC
CTTCGGCCGCGACAAGCTCGAGGCCGTCGTCAACGTGACCAACACGCTGCTGGCTCCTGAGCTCGACCCGGCCCT
GGCCCTGGCCATCTCGCTGGCCAACGACCCGGAGACGCTCGAGGTGAGTCGAGGCTCGACCCCCGCGGCGCCGGA
CTGCGCGGCCAGAACTGACCGGAAGCCAGCCCGTCGTGACGGTCAACATCGTCTACCCCGGCCCGCCGGACAAGG
GCCGGCGGTTCCGGCAGCTGTACTCGGCCCTGAGCTCCAACTACACGGAGCAGATGACGGCGTGGGCCAAGCTGG
CCGACGTTGCCCTGCCGGGCGTCGTCTTGGCCGGGTGCCCCAAGGGCAAGCCGCACGACCAGTACAGCATCCTGA
CGGAGAACCTGTCGGCCTCGGCCCTGGCCTCGGCCCACGACTCGCTCTCGGCCTTTGCGCGGCAGCACCCGGCCG
CCAACGGGAGCAGCATCTTCATCGAGACGTTCGGCCAGCGGGCCCTCAAGGCGATCCCGCAGGACAGCTCCGCCT
TCCCGCACCGCAGCTACTTCCGCAACGCCGTCGTCTTCACCATGACGTACACCGACGATGCCGTGGCCGAGGCCG
CCGACGGCTGGGCCCGCCGCATGCGCAACACCTTTGCCCAGCCCAGCGTTTCCGGCTACGGCGAGTGGCACGTCT
ACCAGAACTACGGACACGGGGACGAGCCGCCGTCGGCCTTGTACGGCTACGAGGGCTGGCGCCACGAGAGACTGA
CGAGGCTGAAGAACCGCTATGATCCGCACGGCTTCTTCGACGGATTCCACGCCATCCCGAGGAATCTCGCAGACT
GGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail