Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|818
Gene name
LocationContig_117:26060..28063
Strand-
Gene length (bp)2003
Transcript length (bp)1887
Coding sequence length (bp)1887
Protein length (aa) 629

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y) 2.8E-72 89 409
PF16714 TyrRSs_C Tyrosyl-tRNA synthetase C-terminal domain 1.6E-40 430 545

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28669|SYYM_PODAS Tyrosine--tRNA ligase, mitochondrial OS=Podospora anserina GN=YTS1 PE=3 SV=1 39 583 0.0E+00
sp|P12063|SYYM_NEUCR Tyrosine--tRNA ligase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-18 PE=1 SV=2 22 588 0.0E+00
sp|P48527|SYYM_YEAST Tyrosine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSY1 PE=1 SV=1 32 528 2.0E-78
sp|Q9W107|SYYM_DROME Tyrosine--tRNA ligase, mitochondrial OS=Drosophila melanogaster GN=Aats-tyr-m PE=2 SV=1 65 476 3.0E-76
sp|Q5I0L3|SYYM_RAT Tyrosine--tRNA ligase, mitochondrial OS=Rattus norvegicus GN=Yars2 PE=2 SV=1 47 396 3.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28669|SYYM_PODAS Tyrosine--tRNA ligase, mitochondrial OS=Podospora anserina GN=YTS1 PE=3 SV=1 39 583 0.0E+00
sp|P12063|SYYM_NEUCR Tyrosine--tRNA ligase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-18 PE=1 SV=2 22 588 0.0E+00
sp|P48527|SYYM_YEAST Tyrosine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSY1 PE=1 SV=1 32 528 2.0E-78
sp|Q9W107|SYYM_DROME Tyrosine--tRNA ligase, mitochondrial OS=Drosophila melanogaster GN=Aats-tyr-m PE=2 SV=1 65 476 3.0E-76
sp|Q5I0L3|SYYM_RAT Tyrosine--tRNA ligase, mitochondrial OS=Rattus norvegicus GN=Yars2 PE=2 SV=1 47 396 3.0E-73
sp|Q8BYL4|SYYM_MOUSE Tyrosine--tRNA ligase, mitochondrial OS=Mus musculus GN=Yars2 PE=1 SV=2 47 396 4.0E-73
sp|Q6MC06|SYY_PARUW Tyrosine--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=tyrS PE=3 SV=1 61 531 3.0E-70
sp|Q4L774|SYY_STAHJ Tyrosine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=tyrS PE=3 SV=1 64 526 2.0E-69
sp|Q72Y10|SYY2_BACC1 Tyrosine--tRNA ligase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=tyrS2 PE=3 SV=1 61 528 8.0E-69
sp|A2RIB1|SYY_LACLM Tyrosine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=tyrS PE=3 SV=1 61 520 1.0E-68
sp|Q6HBJ0|SYY2_BACHK Tyrosine--tRNA ligase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=tyrS2 PE=3 SV=1 61 528 2.0E-68
sp|Q815S0|SYY2_BACCR Tyrosine--tRNA ligase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=tyrS2 PE=3 SV=1 61 528 2.0E-68
sp|Q031T7|SYY_LACLS Tyrosine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=tyrS PE=3 SV=1 61 520 2.0E-68
sp|Q81XC6|SYY2_BACAN Tyrosine--tRNA ligase 2 OS=Bacillus anthracis GN=tyrS2 PE=3 SV=1 61 528 2.0E-68
sp|Q631P9|SYY2_BACCZ Tyrosine--tRNA ligase 2 OS=Bacillus cereus (strain ZK / E33L) GN=tyrS2 PE=3 SV=1 61 528 3.0E-68
sp|Q9CIH5|SYY_LACLA Tyrosine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=tyrS PE=3 SV=1 61 520 3.0E-68
sp|A4VYU1|SYY_STRS2 Tyrosine--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=tyrS PE=3 SV=1 61 526 9.0E-68
sp|Q8CS48|SYY_STAES Tyrosine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tyrS PE=3 SV=1 59 530 1.0E-67
sp|Q5HNH6|SYY_STAEQ Tyrosine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=tyrS PE=3 SV=1 59 530 1.0E-67
sp|Q92BB1|SYY_LISIN Tyrosine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tyrS PE=3 SV=1 61 483 3.0E-67
sp|B8DHE4|SYY_LISMH Tyrosine--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=tyrS PE=3 SV=1 61 482 4.0E-67
sp|P22326|SYY1_BACSU Tyrosine--tRNA ligase 1 OS=Bacillus subtilis (strain 168) GN=tyrS1 PE=2 SV=2 61 526 4.0E-67
sp|Q5M2F3|SYY1_STRT2 Tyrosine--tRNA ligase 1 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=tyrS1 PE=3 SV=2 62 520 5.0E-67
sp|Q5LXV1|SYY1_STRT1 Tyrosine--tRNA ligase 1 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=tyrS1 PE=3 SV=2 62 520 5.0E-67
sp|A0AJ48|SYY_LISW6 Tyrosine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=tyrS PE=3 SV=1 61 483 5.0E-67
sp|Q8Y6T4|SYY_LISMO Tyrosine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=tyrS PE=3 SV=1 61 482 8.0E-67
sp|Q71Z70|SYY_LISMF Tyrosine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=tyrS PE=3 SV=1 61 482 1.0E-66
sp|Q03IK0|SYY_STRTD Tyrosine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=tyrS PE=3 SV=1 62 520 1.0E-66
sp|C1KVP5|SYY_LISMC Tyrosine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=tyrS PE=3 SV=1 61 482 1.0E-66
sp|B5XJ70|SYY_STRPZ Tyrosine--tRNA ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=tyrS PE=3 SV=1 61 520 2.0E-66
sp|Q1J8X3|SYY_STRPF Tyrosine--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=tyrS PE=3 SV=1 61 520 2.0E-66
sp|Q9A1U3|SYY_STRP1 Tyrosine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=tyrS PE=3 SV=1 61 520 2.0E-66
sp|Q8P2Y5|SYY_STRP8 Tyrosine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=tyrS PE=3 SV=1 61 526 3.0E-66
sp|Q54WD9|SYYM_DICDI Probable tyrosine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=mtyrS PE=3 SV=1 43 484 5.0E-66
sp|B2GF15|SYY_LACF3 Tyrosine--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=tyrS PE=3 SV=1 61 528 6.0E-66
sp|Q1JJ25|SYY_STRPD Tyrosine--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=tyrS PE=3 SV=1 61 526 8.0E-66
sp|Q1JNY0|SYY_STRPC Tyrosine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=tyrS PE=3 SV=1 61 526 8.0E-66
sp|Q1JE22|SYY_STRPB Tyrosine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=tyrS PE=3 SV=1 61 526 8.0E-66
sp|P0DG63|SYY_STRPQ Tyrosine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=tyrS PE=3 SV=1 61 526 1.0E-65
sp|P0DG62|SYY_STRP3 Tyrosine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=tyrS PE=3 SV=1 61 526 1.0E-65
sp|Q5XE99|SYY_STRP6 Tyrosine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=tyrS PE=3 SV=1 61 526 1.0E-65
sp|A8AZI5|SYY_STRGC Tyrosine--tRNA ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=tyrS PE=3 SV=1 61 476 1.0E-65
sp|C3KUT7|SYY_CLOB6 Tyrosine--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=tyrS PE=3 SV=1 61 476 1.0E-65
sp|Q48VR3|SYY_STRPM Tyrosine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=tyrS PE=3 SV=1 61 526 3.0E-65
sp|B1L203|SYY_CLOBM Tyrosine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=tyrS PE=3 SV=1 61 526 3.0E-65
sp|Q891D3|SYY_CLOTE Tyrosine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=tyrS PE=3 SV=2 59 419 4.0E-65
sp|Q7B9Y9|SYY_LACBR Tyrosine--tRNA ligase OS=Lactobacillus brevis GN=tyrS PE=3 SV=1 61 522 5.0E-65
sp|A5UUZ9|SYY_ROSS1 Tyrosine--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=tyrS PE=3 SV=1 62 528 5.0E-65
sp|Q9Y2Z4|SYYM_HUMAN Tyrosine--tRNA ligase, mitochondrial OS=Homo sapiens GN=YARS2 PE=1 SV=2 71 428 5.0E-65
sp|Q9M876|SYYM_ARATH Tyrosine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=EMB2768 PE=2 SV=1 61 476 6.0E-65
sp|O74890|SYYM_SCHPO Tyrosine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msy1 PE=3 SV=1 92 412 9.0E-65
sp|Q65G35|SYY1_BACLD Tyrosine--tRNA ligase 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tyrS1 PE=3 SV=2 61 479 1.0E-64
sp|B9DSZ3|SYY_STRU0 Tyrosine--tRNA ligase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=tyrS PE=3 SV=1 61 526 1.0E-64
sp|A2RC49|SYY_STRPG Tyrosine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=tyrS PE=3 SV=1 61 526 2.0E-64
sp|Q2IPT7|SYY_ANADE Tyrosine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=tyrS PE=3 SV=1 91 473 2.0E-64
sp|Q49YG2|SYY_STAS1 Tyrosine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=tyrS PE=3 SV=1 82 526 2.0E-64
sp|Q7A0M7|SYY_STAAW Tyrosine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=tyrS PE=3 SV=1 80 526 2.0E-64
sp|A8Z2P6|SYY_STAAT Tyrosine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=tyrS PE=3 SV=1 80 526 2.0E-64
sp|Q6G8J9|SYY_STAAS Tyrosine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=tyrS PE=3 SV=1 80 526 2.0E-64
sp|Q6GFX9|SYY_STAAR Tyrosine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=tyrS PE=3 SV=1 80 526 2.0E-64
sp|Q7A537|SYY_STAAN Tyrosine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=tyrS PE=1 SV=1 80 526 2.0E-64
sp|Q99TD5|SYY_STAAM Tyrosine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=tyrS PE=3 SV=1 80 526 2.0E-64
sp|A6QHR2|SYY_STAAE Tyrosine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=tyrS PE=1 SV=1 80 526 2.0E-64
sp|Q2YTG1|SYY_STAAB Tyrosine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=tyrS PE=3 SV=1 80 526 2.0E-64
sp|A5ITQ1|SYY_STAA9 Tyrosine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=tyrS PE=3 SV=1 80 526 2.0E-64
sp|Q2FXJ5|SYY_STAA8 Tyrosine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=tyrS PE=3 SV=1 80 526 2.0E-64
sp|Q2FG09|SYY_STAA3 Tyrosine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=tyrS PE=3 SV=1 80 526 2.0E-64
sp|A6U2J5|SYY_STAA2 Tyrosine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=tyrS PE=3 SV=1 80 526 2.0E-64
sp|A7X3G2|SYY_STAA1 Tyrosine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=tyrS PE=3 SV=1 80 526 2.0E-64
sp|Q5HF45|SYY_STAAC Tyrosine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=tyrS PE=3 SV=1 80 526 3.0E-64
sp|B8JFS8|SYY_ANAD2 Tyrosine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=tyrS PE=3 SV=1 91 473 3.0E-64
sp|A6KZL8|SYY_BACV8 Tyrosine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=tyrS PE=3 SV=1 64 526 3.0E-64
sp|A7NK64|SYY_ROSCS Tyrosine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=tyrS PE=3 SV=1 62 529 5.0E-64
sp|Q8A2S5|SYY_BACTN Tyrosine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=tyrS PE=3 SV=1 64 522 7.0E-64
sp|B4UGQ8|SYY_ANASK Tyrosine--tRNA ligase OS=Anaeromyxobacter sp. (strain K) GN=tyrS PE=3 SV=1 91 473 1.0E-63
sp|Q5LJ19|SYY_BACFN Tyrosine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=tyrS PE=3 SV=1 64 526 2.0E-63
sp|A5FMI1|SYY_FLAJ1 Tyrosine--tRNA ligase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=tyrS PE=3 SV=1 60 529 2.0E-63
sp|A1A1W2|SYY_BIFAA Tyrosine--tRNA ligase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=tyrS PE=3 SV=1 62 527 2.0E-63
sp|A5I748|SYY_CLOBH Tyrosine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=tyrS PE=3 SV=1 61 419 4.0E-63
sp|A7FYR9|SYY_CLOB1 Tyrosine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=tyrS PE=3 SV=1 61 419 4.0E-63
sp|Q834C7|SYY2_ENTFA Tyrosine--tRNA ligase 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=tyrS2 PE=3 SV=1 63 520 4.0E-63
sp|A7Z7R1|SYY_BACMF Tyrosine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=tyrS PE=3 SV=1 61 526 4.0E-63
sp|A7GIQ9|SYY_CLOBL Tyrosine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=tyrS PE=3 SV=1 61 419 4.0E-63
sp|C1FLY1|SYY_CLOBJ Tyrosine--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=tyrS PE=3 SV=1 61 419 4.0E-63
sp|B1IFG0|SYY_CLOBK Tyrosine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=tyrS PE=3 SV=1 61 419 5.0E-63
sp|Q650K7|SYY_BACFR Tyrosine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=tyrS PE=3 SV=1 64 526 1.0E-62
sp|C1CN46|SYY_STRZP Tyrosine--tRNA ligase OS=Streptococcus pneumoniae (strain P1031) GN=tyrS PE=3 SV=1 61 476 2.0E-62
sp|C1CH28|SYY_STRZJ Tyrosine--tRNA ligase OS=Streptococcus pneumoniae (strain JJA) GN=tyrS PE=3 SV=1 61 476 2.0E-62
sp|Q8DN52|SYY_STRR6 Tyrosine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=tyrS PE=3 SV=1 61 476 2.0E-62
sp|Q97NE3|SYY_STRPN Tyrosine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=tyrS PE=1 SV=1 61 476 2.0E-62
sp|B8ZPM2|SYY_STRPJ Tyrosine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=tyrS PE=3 SV=1 61 476 2.0E-62
sp|Q04I74|SYY_STRP2 Tyrosine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=tyrS PE=3 SV=1 61 476 2.0E-62
sp|A5N680|SYY_CLOK5 Tyrosine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=tyrS PE=3 SV=1 61 479 2.0E-62
sp|B9DZQ6|SYY_CLOK1 Tyrosine--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=tyrS PE=3 SV=1 61 479 2.0E-62
sp|Q72Z73|SYY1_BACC1 Tyrosine--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=tyrS1 PE=3 SV=1 62 526 2.0E-62
sp|B5E3A7|SYY_STRP4 Tyrosine--tRNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=tyrS PE=3 SV=1 61 476 2.0E-62
sp|Q03UK8|SYY_LEUMM Tyrosine--tRNA ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=tyrS PE=3 SV=1 64 404 3.0E-62
sp|Q6HCM0|SYY1_BACHK Tyrosine--tRNA ligase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=tyrS1 PE=3 SV=1 62 526 3.0E-62
sp|Q633D2|SYY1_BACCZ Tyrosine--tRNA ligase 1 OS=Bacillus cereus (strain ZK / E33L) GN=tyrS1 PE=3 SV=1 62 526 3.0E-62
sp|Q81KS9|SYY1_BACAN Tyrosine--tRNA ligase 1 OS=Bacillus anthracis GN=tyrS1 PE=3 SV=1 62 526 3.0E-62
sp|B2IN18|SYY_STRPS Tyrosine--tRNA ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=tyrS PE=3 SV=1 61 476 3.0E-62
sp|C1CU03|SYY_STRZT Tyrosine--tRNA ligase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=tyrS PE=3 SV=1 61 476 3.0E-62
sp|B1I9G6|SYY_STRPI Tyrosine--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=tyrS PE=3 SV=1 61 476 3.0E-62
sp|C0M6G7|SYY_STRE4 Tyrosine--tRNA ligase OS=Streptococcus equi subsp. equi (strain 4047) GN=tyrS PE=3 SV=1 61 411 4.0E-62
sp|Q8XMN6|SYY_CLOPE Tyrosine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=tyrS PE=3 SV=1 61 410 4.0E-62
sp|Q0TTF4|SYY_CLOP1 Tyrosine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=tyrS PE=3 SV=1 61 410 4.0E-62
sp|B4U045|SYY_STREM Tyrosine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=tyrS PE=3 SV=1 61 411 4.0E-62
sp|C0MEE0|SYY_STRS7 Tyrosine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=tyrS PE=3 SV=1 61 411 4.0E-62
sp|Q251G4|SYY_DESHY Tyrosine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=tyrS PE=3 SV=1 61 529 6.0E-62
sp|Q38XK7|SYY_LACSS Tyrosine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=tyrS PE=3 SV=1 60 471 7.0E-62
sp|Q97LC5|SYY1_CLOAB Tyrosine--tRNA ligase 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=tyrS1 PE=3 SV=1 61 520 7.0E-62
sp|Q9JXY5|SYY_NEIMB Tyrosine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=tyrS PE=3 SV=1 62 522 8.0E-62
sp|Q74LL0|SYY_LACJO Tyrosine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=tyrS PE=3 SV=2 91 479 1.0E-61
sp|C1CAS7|SYY_STRP7 Tyrosine--tRNA ligase OS=Streptococcus pneumoniae (strain 70585) GN=tyrS PE=3 SV=1 61 476 1.0E-61
sp|A8ZUK6|SYY_DESOH Tyrosine--tRNA ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=tyrS PE=3 SV=1 62 476 1.0E-61
sp|A1KS60|SYY_NEIMF Tyrosine--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=tyrS PE=3 SV=1 62 522 1.0E-61
sp|Q2LR98|SYY_SYNAS Tyrosine--tRNA ligase OS=Syntrophus aciditrophicus (strain SB) GN=tyrS PE=3 SV=1 60 480 2.0E-61
sp|Q0SVA4|SYY_CLOPS Tyrosine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=tyrS PE=3 SV=1 61 410 2.0E-61
sp|Q03HI6|SYY_PEDPA Tyrosine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=tyrS PE=3 SV=1 61 412 2.0E-61
sp|A6GW04|SYY_FLAPJ Tyrosine--tRNA ligase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=tyrS PE=3 SV=1 60 528 3.0E-61
sp|Q2SRK6|SYY_MYCCT Tyrosine--tRNA ligase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=tyrS PE=3 SV=1 60 526 3.0E-61
sp|B8G0N6|SYY_DESHD Tyrosine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=tyrS PE=3 SV=1 61 529 3.0E-61
sp|Q8E241|SYY_STRA5 Tyrosine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=tyrS PE=3 SV=1 61 476 4.0E-61
sp|Q8E7K0|SYY_STRA3 Tyrosine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=tyrS PE=3 SV=1 61 476 4.0E-61
sp|Q9JVY6|SYY_NEIMA Tyrosine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=tyrS PE=3 SV=1 62 522 5.0E-61
sp|Q4A5E2|SYY_MYCS5 Tyrosine--tRNA ligase OS=Mycoplasma synoviae (strain 53) GN=tyrS PE=3 SV=1 62 410 6.0E-61
sp|B4RP13|SYY_NEIG2 Tyrosine--tRNA ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=tyrS PE=3 SV=1 62 522 7.0E-61
sp|Q5FAF7|SYY_NEIG1 Tyrosine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=tyrS PE=3 SV=1 62 522 7.0E-61
sp|B1MW54|SYY_LEUCK Tyrosine--tRNA ligase OS=Leuconostoc citreum (strain KM20) GN=tyrS PE=3 SV=1 72 403 7.0E-61
sp|Q3K3L4|SYY_STRA1 Tyrosine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=tyrS PE=3 SV=1 61 476 8.0E-61
sp|B1ZUZ4|SYY_OPITP Tyrosine--tRNA ligase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=tyrS PE=3 SV=1 62 529 1.0E-60
sp|Q817A2|SYY1_BACCR Tyrosine--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=tyrS1 PE=3 SV=1 62 526 1.0E-60
sp|B7GTN2|SYY_BIFLS Tyrosine--tRNA ligase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=tyrS PE=3 SV=1 64 476 3.0E-60
sp|B3DSX9|SYY_BIFLD Tyrosine--tRNA ligase OS=Bifidobacterium longum (strain DJO10A) GN=tyrS PE=3 SV=1 64 476 3.0E-60
sp|A1QZF9|SYY_BORT9 Tyrosine--tRNA ligase OS=Borrelia turicatae (strain 91E135) GN=tyrS PE=3 SV=1 66 476 3.0E-60
sp|B8FGS9|SYY_DESAA Tyrosine--tRNA ligase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=tyrS PE=3 SV=1 61 476 3.0E-60
sp|Q8CXA5|SYY_OCEIH Tyrosine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=tyrS PE=3 SV=1 62 530 4.0E-60
sp|P00952|SYY_GEOSE Tyrosine--tRNA ligase OS=Geobacillus stearothermophilus GN=tyrS PE=1 SV=1 65 526 4.0E-60
sp|A9M1J5|SYY_NEIM0 Tyrosine--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=tyrS PE=3 SV=1 62 522 5.0E-60
sp|Q8G5G1|SYY_BIFLO Tyrosine--tRNA ligase OS=Bifidobacterium longum (strain NCC 2705) GN=tyrS PE=3 SV=1 64 476 7.0E-60
sp|A6M293|SYY_CLOB8 Tyrosine--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=tyrS PE=3 SV=1 61 411 8.0E-60
sp|B2UYM8|SYY_CLOBA Tyrosine--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=tyrS PE=3 SV=1 61 411 8.0E-60
sp|Q04D20|SYY_OENOB Tyrosine--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=tyrS PE=3 SV=1 62 411 8.0E-60
sp|B5RRH9|SYY_BORRA Tyrosine--tRNA ligase OS=Borrelia recurrentis (strain A1) GN=tyrS PE=3 SV=1 66 476 8.0E-60
sp|Q8DS44|SYY_STRMU Tyrosine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=tyrS PE=3 SV=2 62 520 9.0E-60
sp|Q6MST3|SYY_MYCMS Tyrosine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=tyrS PE=3 SV=1 62 526 9.0E-60
sp|B2TQ95|SYY_CLOBB Tyrosine--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=tyrS PE=3 SV=1 61 411 1.0E-59
sp|Q6AGC2|SYY_LEIXX Tyrosine--tRNA ligase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=tyrS PE=3 SV=1 61 473 3.0E-59
sp|C4K4B6|SYY_HAMD5 Tyrosine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=tyrS PE=3 SV=1 59 520 4.0E-59
sp|B9DN75|SYY_STACT Tyrosine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=tyrS PE=3 SV=1 65 527 5.0E-59
sp|Q6F0M8|SYY_MESFL Tyrosine--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=tyrS PE=3 SV=1 61 402 6.0E-59
sp|B9E7E5|SYY_MACCJ Tyrosine--tRNA ligase OS=Macrococcus caseolyticus (strain JCSC5402) GN=tyrS PE=3 SV=1 79 402 6.0E-59
sp|B5RLQ9|SYY_BORDL Tyrosine--tRNA ligase OS=Borrelia duttonii (strain Ly) GN=tyrS PE=3 SV=1 66 476 7.0E-59
sp|B2VEN3|SYY_ERWT9 Tyrosine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=tyrS PE=3 SV=1 65 526 8.0E-59
sp|P04077|SYY_BACCA Tyrosine--tRNA ligase OS=Bacillus caldotenax GN=tyrS PE=3 SV=1 65 526 1.0E-58
sp|A3DDC9|SYY_CLOTH Tyrosine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=tyrS PE=3 SV=1 62 409 1.0E-58
sp|Q5FMI6|SYY_LACAC Tyrosine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=tyrS PE=3 SV=1 91 528 1.0E-58
sp|Q5KW48|SYY_GEOKA Tyrosine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=tyrS PE=3 SV=1 65 526 2.0E-58
sp|C1DCW5|SYY_LARHH Tyrosine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=tyrS PE=3 SV=1 60 404 2.0E-58
sp|A8YX30|SYY_LACH4 Tyrosine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=tyrS PE=3 SV=1 91 528 3.0E-58
sp|A8GDY0|SYY_SERP5 Tyrosine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=tyrS PE=3 SV=1 65 411 3.0E-58
sp|Q6D5V2|SYY_PECAS Tyrosine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tyrS PE=3 SV=1 65 394 3.0E-58
sp|C6DK25|SYY_PECCP Tyrosine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=tyrS PE=3 SV=1 65 394 5.0E-58
sp|Q9PR27|SYY_UREPA Tyrosine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=tyrS PE=3 SV=1 65 526 8.0E-58
sp|B1AIA6|SYY_UREP2 Tyrosine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=tyrS PE=3 SV=1 65 526 8.0E-58
sp|A5VHU6|SYY_LACRD Tyrosine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=tyrS PE=3 SV=1 62 411 8.0E-58
sp|E6ELF6|SYY1_ENTFT Tyrosine--tRNA ligase 1 OS=Enterococcus faecalis (strain TX4000 / JH2-2) GN=tyrS1 PE=3 SV=2 61 412 9.0E-58
sp|P0DM33|SYY1_ENTFA Tyrosine--tRNA ligase 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=tyrS1 PE=3 SV=1 61 412 9.0E-58
sp|Q8R6V5|SYY_CALS4 Tyrosine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tyrS PE=3 SV=1 94 411 1.0E-57
sp|Q8FH88|SYY_ECOL6 Tyrosine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tyrS PE=3 SV=3 65 526 1.0E-57
sp|B7MVB5|SYY_ECO81 Tyrosine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=tyrS PE=3 SV=1 65 526 1.0E-57
sp|B7L5J0|SYY_ECO55 Tyrosine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=tyrS PE=3 SV=1 65 526 1.0E-57
sp|B7M9Z1|SYY_ECO45 Tyrosine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=tyrS PE=3 SV=1 65 526 1.0E-57
sp|B7URX8|SYY_ECO27 Tyrosine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=tyrS PE=3 SV=1 65 526 1.0E-57
sp|Q8RH57|SYY_FUSNN Tyrosine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=tyrS PE=3 SV=1 57 410 2.0E-57
sp|B1VAA7|SYY_PHYAS Tyrosine--tRNA ligase OS=Phytoplasma australiense GN=tyrS PE=3 SV=1 63 528 2.0E-57
sp|Q1RBF8|SYY_ECOUT Tyrosine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=tyrS PE=3 SV=1 65 526 2.0E-57
sp|A1ABI2|SYY_ECOK1 Tyrosine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=tyrS PE=3 SV=1 65 526 2.0E-57
sp|B1JJR1|SYY_YERPY Tyrosine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=tyrS PE=3 SV=1 65 411 3.0E-57
sp|Q66A49|SYY_YERPS Tyrosine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tyrS PE=3 SV=1 65 411 3.0E-57
sp|B2K5H0|SYY_YERPB Tyrosine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=tyrS PE=3 SV=1 65 411 3.0E-57
sp|A7FHM0|SYY_YERP3 Tyrosine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tyrS PE=3 SV=1 65 411 3.0E-57
sp|Q83GS7|SYY_TROWT Tyrosine--tRNA ligase OS=Tropheryma whipplei (strain Twist) GN=tyrS PE=3 SV=1 58 410 3.0E-57
sp|Q83HH5|SYY_TROW8 Tyrosine--tRNA ligase OS=Tropheryma whipplei (strain TW08/27) GN=tyrS PE=3 SV=1 58 410 3.0E-57
sp|A4TIS1|SYY_YERPP Tyrosine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=tyrS PE=3 SV=1 65 396 4.0E-57
sp|Q1CIM5|SYY_YERPN Tyrosine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tyrS PE=3 SV=1 65 396 4.0E-57
sp|A9QZ95|SYY_YERPG Tyrosine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=tyrS PE=3 SV=1 65 396 4.0E-57
sp|Q8ZE20|SYY_YERPE Tyrosine--tRNA ligase OS=Yersinia pestis GN=tyrS PE=3 SV=1 65 396 4.0E-57
sp|Q1C791|SYY_YERPA Tyrosine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tyrS PE=3 SV=1 65 396 4.0E-57
sp|B7M0J4|SYY_ECO8A Tyrosine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=tyrS PE=3 SV=1 65 526 5.0E-57
sp|Q3Z1Z3|SYY_SHISS Tyrosine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=tyrS PE=3 SV=3 65 526 5.0E-57
sp|B2U2D7|SYY_SHIB3 Tyrosine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=tyrS PE=3 SV=1 65 526 5.0E-57
sp|B1LEP9|SYY_ECOSM Tyrosine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=tyrS PE=3 SV=1 65 526 5.0E-57
sp|B6IB76|SYY_ECOSE Tyrosine--tRNA ligase OS=Escherichia coli (strain SE11) GN=tyrS PE=3 SV=1 65 526 5.0E-57
sp|B7NB91|SYY_ECOLU Tyrosine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=tyrS PE=3 SV=1 65 526 5.0E-57
sp|P0AGJ9|SYY_ECOLI Tyrosine--tRNA ligase OS=Escherichia coli (strain K12) GN=tyrS PE=1 SV=2 65 526 5.0E-57
sp|B1IQB7|SYY_ECOLC Tyrosine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tyrS PE=3 SV=1 65 526 5.0E-57
sp|A8A0I0|SYY_ECOHS Tyrosine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=tyrS PE=3 SV=1 65 526 5.0E-57
sp|B1XFU9|SYY_ECODH Tyrosine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=tyrS PE=3 SV=1 65 526 5.0E-57
sp|C4ZYA0|SYY_ECOBW Tyrosine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=tyrS PE=3 SV=1 65 526 5.0E-57
sp|B7NTZ5|SYY_ECO7I Tyrosine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=tyrS PE=3 SV=1 65 526 5.0E-57
sp|B5Z471|SYY_ECO5E Tyrosine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=tyrS PE=3 SV=1 65 526 5.0E-57
sp|P0AGK0|SYY_ECO57 Tyrosine--tRNA ligase OS=Escherichia coli O157:H7 GN=tyrS PE=3 SV=2 65 526 5.0E-57
sp|A7ZM99|SYY_ECO24 Tyrosine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tyrS PE=3 SV=1 65 526 5.0E-57
sp|B7LQN3|SYY_ESCF3 Tyrosine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=tyrS PE=3 SV=1 65 526 7.0E-57
sp|Q2NT02|SYY_SODGM Tyrosine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=tyrS PE=3 SV=1 65 394 7.0E-57
sp|Q47B76|SYY_DECAR Tyrosine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=tyrS PE=3 SV=1 65 526 9.0E-57
sp|A5IZH1|SYY_MYCAP Tyrosine--tRNA ligase OS=Mycoplasma agalactiae (strain PG2) GN=tyrS PE=3 SV=1 61 470 1.0E-56
sp|Q6YQA6|SYY_ONYPE Tyrosine--tRNA ligase OS=Onion yellows phytoplasma (strain OY-M) GN=tyrS PE=3 SV=1 63 526 1.0E-56
sp|A7MMK1|SYY_CROS8 Tyrosine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=tyrS PE=3 SV=1 55 415 1.0E-56
sp|Q32FD6|SYY_SHIDS Tyrosine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tyrS PE=3 SV=3 65 526 2.0E-56
sp|Q7N3W6|SYY1_PHOLL Tyrosine--tRNA ligase 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tyrS1 PE=3 SV=1 59 411 2.0E-56
sp|B9KQU0|SYY_RHOSK Tyrosine--tRNA ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=tyrS PE=3 SV=1 66 480 2.0E-56
sp|B5ZAU9|SYY_UREU1 Tyrosine--tRNA ligase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=tyrS PE=3 SV=1 65 526 2.0E-56
sp|Q3J3I3|SYY_RHOS4 Tyrosine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=tyrS PE=3 SV=1 66 509 3.0E-56
sp|Q04CC7|SYY_LACDB Tyrosine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=tyrS PE=3 SV=1 85 528 4.0E-56
sp|Q88TV5|SYY_LACPL Tyrosine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=tyrS PE=3 SV=1 61 471 4.0E-56
sp|A0KFT8|SYY_AERHH Tyrosine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=tyrS PE=3 SV=1 61 412 6.0E-56
sp|B7J1U2|SYY_BORBZ Tyrosine--tRNA ligase OS=Borrelia burgdorferi (strain ZS7) GN=tyrS PE=3 SV=1 66 508 6.0E-56
sp|O51343|SYY_BORBU Tyrosine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=tyrS PE=3 SV=1 66 508 6.0E-56
sp|A9KMS8|SYY_CLOPH Tyrosine--tRNA ligase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=tyrS PE=3 SV=1 59 411 6.0E-56
sp|Q3II62|SYY1_PSEHT Tyrosine--tRNA ligase 1 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tyrS1 PE=3 SV=1 61 528 6.0E-56
sp|Q73PD8|SYY_TREDE Tyrosine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=tyrS PE=3 SV=1 66 476 6.0E-56
sp|A3PIU9|SYY_RHOS1 Tyrosine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=tyrS PE=3 SV=1 66 480 7.0E-56
sp|A8FGA6|SYY_BACP2 Tyrosine--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=tyrS PE=3 SV=1 61 471 7.0E-56
sp|A8AH18|SYY_CITK8 Tyrosine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=tyrS PE=3 SV=1 65 411 1.0E-55
sp|Q7CQK7|SYY_SALTY Tyrosine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tyrS PE=3 SV=1 65 526 1.0E-55
sp|Q8XG70|SYY_SALTI Tyrosine--tRNA ligase OS=Salmonella typhi GN=tyrS PE=3 SV=1 65 526 1.0E-55
sp|B4TV08|SYY_SALSV Tyrosine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=tyrS PE=3 SV=1 65 526 1.0E-55
sp|B5BKC0|SYY_SALPK Tyrosine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=tyrS PE=3 SV=1 65 526 1.0E-55
sp|A9N034|SYY_SALPB Tyrosine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=tyrS PE=3 SV=1 65 526 1.0E-55
sp|Q5PIK7|SYY_SALPA Tyrosine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tyrS PE=3 SV=1 65 526 1.0E-55
sp|B4T586|SYY_SALNS Tyrosine--tRNA ligase OS=Salmonella newport (strain SL254) GN=tyrS PE=3 SV=1 65 526 1.0E-55
sp|B4THC6|SYY_SALHS Tyrosine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=tyrS PE=3 SV=1 65 526 1.0E-55
sp|B5RAL0|SYY_SALG2 Tyrosine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=tyrS PE=3 SV=1 65 526 1.0E-55
sp|B5FIF4|SYY_SALDC Tyrosine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=tyrS PE=3 SV=1 65 526 1.0E-55
sp|Q57PI8|SYY_SALCH Tyrosine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=tyrS PE=3 SV=1 65 526 1.0E-55
sp|B5F6J8|SYY_SALA4 Tyrosine--tRNA ligase OS=Salmonella agona (strain SL483) GN=tyrS PE=3 SV=1 65 526 1.0E-55
sp|C0Q5T3|SYY_SALPC Tyrosine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=tyrS PE=3 SV=1 65 526 1.0E-55
sp|A1JNV3|SYY_YERE8 Tyrosine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tyrS PE=3 SV=1 65 396 1.0E-55
sp|B5QV10|SYY_SALEP Tyrosine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=tyrS PE=3 SV=1 65 526 2.0E-55
sp|Q0SNE3|SYY_BORAP Tyrosine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=tyrS PE=3 SV=1 66 508 2.0E-55
sp|B8DU64|SYY_BIFA0 Tyrosine--tRNA ligase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=tyrS PE=3 SV=1 62 476 3.0E-55
sp|Q1GBW9|SYY_LACDA Tyrosine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=tyrS PE=3 SV=1 85 528 4.0E-55
sp|Q823H9|SYY_CHLCV Tyrosine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=tyrS PE=3 SV=1 60 480 4.0E-55
sp|Q4FMN5|SYY_PELUB Tyrosine--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=tyrS PE=3 SV=1 65 480 5.0E-55
sp|A9MEH2|SYY_SALAR Tyrosine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=tyrS PE=3 SV=1 65 411 6.0E-55
sp|Q47N93|SYY_THEFY Tyrosine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=tyrS PE=3 SV=2 62 523 6.0E-55
sp|Q2NJG7|SYY_AYWBP Tyrosine--tRNA ligase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=tyrS PE=3 SV=2 63 526 6.0E-55
sp|B5XWP0|SYY_KLEP3 Tyrosine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=tyrS PE=3 SV=1 65 497 6.0E-55
sp|Q9PKX8|SYY_CHLMU Tyrosine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=tyrS PE=3 SV=1 60 528 7.0E-55
sp|Q3KMV9|SYY_CHLTA Tyrosine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=tyrS PE=3 SV=1 60 528 8.0E-55
sp|O84065|SYY_CHLTR Tyrosine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=tyrS PE=3 SV=1 60 528 8.0E-55
sp|B0BB49|SYY_CHLTB Tyrosine--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=tyrS PE=3 SV=1 60 528 8.0E-55
sp|B0B9H0|SYY_CHLT2 Tyrosine--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=tyrS PE=3 SV=1 60 528 8.0E-55
sp|A8LQM0|SYY_DINSH Tyrosine--tRNA ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=tyrS PE=3 SV=1 68 487 1.0E-54
sp|A6T9Y5|SYY_KLEP7 Tyrosine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=tyrS PE=3 SV=1 65 396 1.0E-54
sp|Q8KA14|SYY_BUCAP Tyrosine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=tyrS PE=3 SV=1 64 469 1.0E-54
sp|A4WR15|SYY_RHOS5 Tyrosine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=tyrS PE=3 SV=1 66 480 2.0E-54
sp|Q7VR52|SYY_BLOFL Tyrosine--tRNA ligase OS=Blochmannia floridanus GN=tyrS PE=3 SV=1 61 479 3.0E-54
sp|Q1GI60|SYY_RUEST Tyrosine--tRNA ligase OS=Ruegeria sp. (strain TM1040) GN=tyrS PE=3 SV=1 68 498 3.0E-54
sp|Q87J85|SYY1_VIBPA Tyrosine--tRNA ligase 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=tyrS1 PE=3 SV=1 65 476 8.0E-54
sp|B2S074|SYY_BORHD Tyrosine--tRNA ligase OS=Borrelia hermsii (strain HS1 / DAH) GN=tyrS PE=3 SV=1 66 476 1.0E-53
sp|B8D8S2|SYY_BUCA5 Tyrosine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=tyrS PE=3 SV=1 66 469 1.0E-53
sp|Q6NHG2|SYY_CORDI Tyrosine--tRNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=tyrS PE=3 SV=1 61 522 2.0E-53
sp|Q2GIN1|SYY_ANAPZ Tyrosine--tRNA ligase OS=Anaplasma phagocytophilum (strain HZ) GN=tyrS PE=3 SV=1 85 409 2.0E-53
sp|A4W9W0|SYY_ENT38 Tyrosine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=tyrS PE=3 SV=1 65 396 2.0E-53
sp|Q7MXD8|SYY_PORGI Tyrosine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=tyrS PE=3 SV=1 64 526 2.0E-53
sp|Q492T7|SYY_BLOPB Tyrosine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=tyrS PE=3 SV=1 56 479 2.0E-53
sp|B2RHN4|SYY_PORG3 Tyrosine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=tyrS PE=3 SV=1 64 526 3.0E-53
sp|Q661P9|SYY_BORBP Tyrosine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=tyrS PE=3 SV=1 66 479 3.0E-53
sp|Q7UM14|SYY_RHOBA Tyrosine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=tyrS PE=3 SV=1 64 528 3.0E-53
sp|P57221|SYY_BUCAI Tyrosine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=tyrS PE=3 SV=1 66 469 4.0E-53
sp|Q9KUQ0|SYY1_VIBCH Tyrosine--tRNA ligase 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tyrS1 PE=3 SV=2 59 437 4.0E-53
sp|O83806|SYY_TREPA Tyrosine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=tyrS PE=3 SV=2 66 531 4.0E-53
sp|Q9Z8I2|SYY_CHLPN Tyrosine--tRNA ligase OS=Chlamydia pneumoniae GN=tyrS PE=3 SV=2 66 402 6.0E-53
sp|Q5L661|SYY_CHLAB Tyrosine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tyrS PE=3 SV=1 60 480 6.0E-53
sp|Q7NTI2|SYY_CHRVO Tyrosine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=tyrS PE=3 SV=1 65 404 1.0E-52
sp|Q5GT37|SYY_WOLTR Tyrosine--tRNA ligase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tyrS PE=3 SV=1 66 403 1.0E-52
sp|Q9EUU8|SYY_MYCFO Tyrosine--tRNA ligase OS=Mycobacterium fortuitum GN=tyrS PE=3 SV=1 62 529 1.0E-52
sp|Q320Z4|SYY_SHIBS Tyrosine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=tyrS PE=3 SV=3 65 526 1.0E-52
sp|B3ERY6|SYY_AMOA5 Tyrosine--tRNA ligase OS=Amoebophilus asiaticus (strain 5a2) GN=tyrS PE=3 SV=1 69 525 1.0E-52
sp|Q4JVY5|SYY_CORJK Tyrosine--tRNA ligase OS=Corynebacterium jeikeium (strain K411) GN=tyrS PE=3 SV=1 61 520 2.0E-52
sp|B1W1W0|SYY_STRGG Tyrosine--tRNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=tyrS PE=3 SV=1 62 528 3.0E-52
sp|Q9RJ50|SYY_STRCO Tyrosine--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tyrS PE=3 SV=1 62 529 4.0E-52
sp|Q8D5N2|SYY1_VIBVU Tyrosine--tRNA ligase 1 OS=Vibrio vulnificus (strain CMCP6) GN=tyrS1 PE=3 SV=1 62 528 4.0E-52
sp|Q8YGV8|SYY_BRUME Tyrosine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=tyrS PE=3 SV=1 66 396 5.0E-52
sp|Q57DI5|SYY_BRUAB Tyrosine--tRNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=tyrS PE=3 SV=1 66 396 5.0E-52
sp|Q2YNR0|SYY_BRUA2 Tyrosine--tRNA ligase OS=Brucella abortus (strain 2308) GN=tyrS PE=3 SV=1 66 396 5.0E-52
sp|Q8G105|SYY_BRUSU Tyrosine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=tyrS PE=3 SV=1 66 396 5.0E-52
sp|Q1WSF8|SYY_LACS1 Tyrosine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=tyrS PE=3 SV=1 61 471 6.0E-52
sp|Q11UV9|SYY_CYTH3 Tyrosine--tRNA ligase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=tyrS PE=3 SV=1 60 410 7.0E-52
sp|B8D726|SYY_BUCAT Tyrosine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=tyrS PE=3 SV=1 66 469 8.0E-52
sp|Q5YYA4|SYY_NOCFA Tyrosine--tRNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=tyrS PE=3 SV=1 94 523 1.0E-51
sp|Q164D9|SYY_ROSDO Tyrosine--tRNA ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tyrS PE=3 SV=1 69 498 1.0E-51
sp|Q8NQM8|SYY_CORGL Tyrosine--tRNA ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=tyrS PE=3 SV=1 61 529 1.0E-51
sp|Q7MCN7|SYY1_VIBVY Tyrosine--tRNA ligase 1 OS=Vibrio vulnificus (strain YJ016) GN=tyrS1 PE=3 SV=1 62 528 2.0E-51
sp|Q6FZW4|SYY_BARQU Tyrosine--tRNA ligase OS=Bartonella quintana (strain Toulouse) GN=tyrS PE=3 SV=1 66 491 3.0E-51
sp|Q5LQK5|SYY_RUEPO Tyrosine--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tyrS PE=3 SV=1 68 498 3.0E-51
sp|Q6G3B6|SYY_BARHE Tyrosine--tRNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=tyrS PE=3 SV=1 66 476 3.0E-51
sp|P9WFT1|SYY_MYCTU Tyrosine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tyrS PE=1 SV=1 62 529 5.0E-51
sp|P9WFT0|SYY_MYCTO Tyrosine--tRNA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=tyrS PE=3 SV=1 62 529 5.0E-51
sp|P67612|SYY_MYCBO Tyrosine--tRNA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=tyrS PE=3 SV=1 62 529 5.0E-51
sp|Q83KY0|SYY_SHIFL Tyrosine--tRNA ligase OS=Shigella flexneri GN=tyrS PE=3 SV=6 65 526 7.0E-51
sp|Q0T4E0|SYY_SHIF8 Tyrosine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=tyrS PE=3 SV=1 65 526 7.0E-51
sp|Q89AW3|SYY_BUCBP Tyrosine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=tyrS PE=3 SV=1 65 367 8.0E-51
sp|A0LUB6|SYY_ACIC1 Tyrosine--tRNA ligase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=tyrS PE=3 SV=1 61 476 8.0E-51
sp|Q68WH9|SYY_RICTY Tyrosine--tRNA ligase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=tyrS PE=3 SV=1 64 520 9.0E-51
sp|Q8FTM1|SYY_COREF Tyrosine--tRNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=tyrS PE=3 SV=1 61 528 1.0E-50
sp|A7INU9|SYY_XANP2 Tyrosine--tRNA ligase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=tyrS PE=3 SV=1 66 476 2.0E-50
sp|Q8UED2|SYY_AGRFC Tyrosine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=tyrS PE=3 SV=1 66 394 2.0E-50
sp|B2IAX9|SYY_BEII9 Tyrosine--tRNA ligase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=tyrS PE=3 SV=1 66 409 2.0E-50
sp|A9NHF4|SYY_ACHLI Tyrosine--tRNA ligase OS=Acholeplasma laidlawii (strain PG-8A) GN=tyrS PE=3 SV=1 62 526 3.0E-50
sp|Q6N703|SYY_RHOPA Tyrosine--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=tyrS PE=3 SV=1 66 398 4.0E-50
sp|A3Q0S2|SYY_MYCSJ Tyrosine--tRNA ligase OS=Mycobacterium sp. (strain JLS) GN=tyrS PE=3 SV=1 62 529 4.0E-50
sp|Q1B7S2|SYY_MYCSS Tyrosine--tRNA ligase OS=Mycobacterium sp. (strain MCS) GN=tyrS PE=3 SV=1 62 529 4.0E-50
sp|A1UH85|SYY_MYCSK Tyrosine--tRNA ligase OS=Mycobacterium sp. (strain KMS) GN=tyrS PE=3 SV=1 62 529 4.0E-50
sp|Q829F2|SYY_STRAW Tyrosine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tyrS PE=3 SV=1 62 529 5.0E-50
sp|C0R4X5|SYY_WOLWR Tyrosine--tRNA ligase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=tyrS PE=3 SV=1 59 403 6.0E-50
sp|Q73G50|SYY_WOLPM Tyrosine--tRNA ligase OS=Wolbachia pipientis wMel GN=tyrS PE=3 SV=1 59 403 6.0E-50
sp|Q2RSR3|SYY_RHORT Tyrosine--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=tyrS PE=3 SV=1 66 498 7.0E-50
sp|A6LGF1|SYY_PARD8 Tyrosine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=tyrS PE=3 SV=1 64 526 9.0E-50
sp|A1B3B3|SYY_PARDP Tyrosine--tRNA ligase OS=Paracoccus denitrificans (strain Pd 1222) GN=tyrS PE=3 SV=1 68 473 1.0E-49
sp|Q3SS12|SYY_NITWN Tyrosine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=tyrS PE=3 SV=1 64 476 2.0E-49
sp|A5CC73|SYY_ORITB Tyrosine--tRNA ligase OS=Orientia tsutsugamushi (strain Boryong) GN=tyrS PE=3 SV=1 61 473 3.0E-49
sp|B3CM50|SYY_WOLPP Tyrosine--tRNA ligase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=tyrS PE=3 SV=1 66 398 3.0E-49
sp|Q92PK5|SYY_RHIME Tyrosine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=tyrS PE=3 SV=1 66 470 3.0E-49
sp|Q89M63|SYY_BRADU Tyrosine--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=tyrS PE=3 SV=1 66 509 4.0E-49
sp|Q2GI13|SYY_EHRCR Tyrosine--tRNA ligase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=tyrS PE=3 SV=1 66 476 4.0E-49
sp|Q740F5|SYY_MYCPA Tyrosine--tRNA ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=tyrS PE=3 SV=1 62 527 5.0E-49
sp|Q3YT49|SYY_EHRCJ Tyrosine--tRNA ligase OS=Ehrlichia canis (strain Jake) GN=tyrS PE=3 SV=1 66 476 7.0E-49
sp|Q49900|SYY_MYCLE Tyrosine--tRNA ligase OS=Mycobacterium leprae (strain TN) GN=tyrS PE=3 SV=3 62 529 7.0E-49
sp|Q1RI22|SYY_RICBR Tyrosine--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=tyrS PE=3 SV=1 80 520 7.0E-49
sp|B3CV32|SYY_ORITI Tyrosine--tRNA ligase OS=Orientia tsutsugamushi (strain Ikeda) GN=tyrS PE=3 SV=1 61 473 9.0E-49
sp|B5FFR9|SYY_VIBFM Tyrosine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=tyrS PE=3 SV=1 65 479 1.0E-48
sp|Q5E424|SYY_VIBF1 Tyrosine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=tyrS PE=3 SV=1 65 479 1.0E-48
sp|Q5M4D1|SYY2_STRT2 Tyrosine--tRNA ligase 2 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=tyrS2 PE=3 SV=1 62 371 2.0E-48
sp|Q5LZR6|SYY2_STRT1 Tyrosine--tRNA ligase 2 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=tyrS2 PE=3 SV=1 62 371 2.0E-48
sp|A8F228|SYY_RICM5 Tyrosine--tRNA ligase OS=Rickettsia massiliae (strain Mtu5) GN=tyrS PE=3 SV=1 90 520 2.0E-48
sp|B3R0D7|SYY_PHYMT Tyrosine--tRNA ligase OS=Phytoplasma mali (strain AT) GN=tyrS PE=3 SV=1 62 479 3.0E-48
sp|A8EYE9|SYY_RICCK Tyrosine--tRNA ligase OS=Rickettsia canadensis (strain McKiel) GN=tyrS PE=3 SV=1 65 520 3.0E-48
sp|Q92HE8|SYY_RICCN Tyrosine--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tyrS PE=3 SV=1 90 520 3.0E-48
sp|Q4UL45|SYY_RICFE Tyrosine--tRNA ligase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=tyrS PE=3 SV=1 90 520 3.0E-48
sp|A8GSQ1|SYY_RICRS Tyrosine--tRNA ligase OS=Rickettsia rickettsii (strain Sheila Smith) GN=tyrS PE=3 SV=1 90 520 3.0E-48
sp|B0BY69|SYY_RICRO Tyrosine--tRNA ligase OS=Rickettsia rickettsii (strain Iowa) GN=tyrS PE=3 SV=1 90 520 3.0E-48
sp|Q7NBH9|SYY_MYCGA Tyrosine--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=tyrS PE=3 SV=2 65 526 3.0E-48
sp|A8GNW7|SYY_RICAH Tyrosine--tRNA ligase OS=Rickettsia akari (strain Hartford) GN=tyrS PE=3 SV=1 90 476 4.0E-48
sp|B6EHW3|SYY_ALISL Tyrosine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=tyrS PE=3 SV=1 65 476 5.0E-48
sp|C4K0N9|SYY_RICPU Tyrosine--tRNA ligase OS=Rickettsia peacockii (strain Rustic) GN=tyrS PE=3 SV=1 90 520 7.0E-48
sp|Q6KH97|SYY_MYCMO Tyrosine--tRNA ligase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=tyrS PE=3 SV=1 65 404 8.0E-48
sp|C3PNX7|SYY_RICAE Tyrosine--tRNA ligase OS=Rickettsia africae (strain ESF-5) GN=tyrS PE=3 SV=1 90 520 1.0E-47
sp|Q4AAX3|SYY_MYCHJ Tyrosine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=tyrS PE=3 SV=1 58 529 3.0E-47
sp|Q601Y5|SYY_MYCH2 Tyrosine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 232) GN=tyrS PE=3 SV=1 58 529 3.0E-47
sp|Q9ZCZ4|SYY_RICPR Tyrosine--tRNA ligase OS=Rickettsia prowazekii (strain Madrid E) GN=tyrS PE=3 SV=1 90 479 4.0E-47
sp|Q4A8U9|SYY_MYCH7 Tyrosine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=tyrS PE=3 SV=1 58 409 4.0E-47
sp|Q02SV2|SYY_PSEAB Tyrosine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tyrS PE=3 SV=1 66 379 5.0E-47
sp|Q5NLZ3|SYY_ZYMMO Tyrosine--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=tyrS PE=3 SV=1 66 479 6.0E-47
sp|B7V6L2|SYY_PSEA8 Tyrosine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=tyrS PE=3 SV=1 66 379 7.0E-47
sp|Q9HWP3|SYY1_PSEAE Tyrosine--tRNA ligase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tyrS1 PE=3 SV=1 66 379 8.0E-47
sp|Q98NS5|SYY_RHILO Tyrosine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=tyrS PE=3 SV=1 66 409 2.0E-46
sp|Q5FF40|SYY_EHRRG Tyrosine--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=tyrS PE=3 SV=1 66 476 4.0E-46
sp|A6WCS8|SYY_KINRD Tyrosine--tRNA ligase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=tyrS PE=3 SV=1 62 528 4.0E-46
sp|A6UZV3|SYY_PSEA7 Tyrosine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=tyrS PE=3 SV=1 66 480 9.0E-46
sp|Q9A756|SYY_CAUCR Tyrosine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=tyrS PE=3 SV=1 66 398 2.0E-45
sp|B8GWL9|SYY_CAUCN Tyrosine--tRNA ligase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=tyrS PE=3 SV=1 66 398 2.0E-45
sp|Q5HCB5|SYY_EHRRW Tyrosine--tRNA ligase OS=Ehrlichia ruminantium (strain Welgevonden) GN=tyrS PE=3 SV=1 66 476 4.0E-45
sp|Q98Q81|SYY_MYCPU Tyrosine--tRNA ligase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=tyrS PE=3 SV=1 92 520 7.0E-45
sp|Q5FR80|SYY_GLUOX Tyrosine--tRNA ligase OS=Gluconobacter oxydans (strain 621H) GN=tyrS PE=3 SV=1 65 379 1.0E-44
sp|B0SXC3|SYY_CAUSK Tyrosine--tRNA ligase OS=Caulobacter sp. (strain K31) GN=tyrS PE=3 SV=1 66 398 2.0E-44
sp|Q2W2T6|SYY_MAGSA Tyrosine--tRNA ligase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=tyrS PE=3 SV=1 93 497 5.0E-44
sp|Q8EUX2|SYY_MYCPE Tyrosine--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=tyrS PE=3 SV=1 60 476 6.0E-43
sp|Q8D2L6|SYY_WIGBR Tyrosine--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=tyrS PE=3 SV=2 94 487 8.0E-43
sp|P75122|SYY_MYCPN Tyrosine--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=tyrS PE=3 SV=1 66 413 2.0E-42
sp|Q5P9K5|SYY_ANAMM Tyrosine--tRNA ligase OS=Anaplasma marginale (strain St. Maries) GN=tyrS PE=3 SV=1 64 476 2.0E-42
sp|P47693|SYY_MYCGE Tyrosine--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=tyrS PE=3 SV=2 86 425 3.0E-42
sp|Q2G6I4|SYY_NOVAD Tyrosine--tRNA ligase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=tyrS PE=3 SV=1 66 486 4.0E-42
sp|B8EI82|SYY_METSB Tyrosine--tRNA ligase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=tyrS PE=3 SV=1 93 480 7.0E-42
sp|Q6A7W0|SYY_PROAC Tyrosine--tRNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tyrS PE=3 SV=1 64 410 4.0E-41
sp|Q9WYU8|SYY_THEMA Tyrosine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tyrS PE=3 SV=1 85 507 2.0E-33
sp|Q87LY8|SYY2_VIBPA Tyrosine--tRNA ligase 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=tyrS2 PE=3 SV=1 96 479 2.0E-32
sp|Q72DH6|SYY_DESVH Tyrosine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=tyrS PE=3 SV=1 50 411 9.0E-32
sp|Q316W7|SYY_DESAG Tyrosine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=tyrS PE=3 SV=2 86 474 2.0E-31
sp|Q3ABU4|SYY_CARHZ Tyrosine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tyrS PE=3 SV=1 47 367 1.0E-30
sp|Q3JCM3|SYY_NITOC Tyrosine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=tyrS PE=3 SV=1 85 489 2.0E-30
sp|Q47V01|SYY_COLP3 Tyrosine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=tyrS PE=3 SV=1 95 487 3.0E-30
sp|Q5WEB8|SYY_BACSK Tyrosine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=tyrS PE=3 SV=1 49 409 5.0E-30
sp|Q6LUR9|SYY_PHOPR Tyrosine--tRNA ligase OS=Photobacterium profundum GN=tyrS PE=3 SV=1 96 490 5.0E-30
sp|Q2RHS8|SYY_MOOTA Tyrosine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=tyrS PE=3 SV=1 96 474 7.0E-30
sp|Q2KV13|SYY_BORA1 Tyrosine--tRNA ligase OS=Bordetella avium (strain 197N) GN=tyrS PE=3 SV=1 96 486 5.0E-29
sp|Q7VN81|SYY_HAEDU Tyrosine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=tyrS PE=3 SV=1 96 479 1.0E-28
sp|Q65T71|SYY_MANSM Tyrosine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=tyrS PE=3 SV=1 96 479 1.0E-28
sp|Q9CMQ8|SYY_PASMU Tyrosine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=tyrS PE=3 SV=1 96 479 2.0E-28
sp|Q2S8Y9|SYY_HAHCH Tyrosine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=tyrS PE=3 SV=1 82 398 2.0E-28
sp|Q30SN2|SYY_SULDN Tyrosine--tRNA ligase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=tyrS PE=3 SV=1 95 474 3.0E-28
sp|Q8F411|SYY_LEPIN Tyrosine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=tyrS PE=3 SV=1 65 365 3.0E-28
sp|Q72RP6|SYY_LEPIC Tyrosine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=tyrS PE=3 SV=1 65 365 3.0E-28
sp|Q3ARF2|SYY_CHLCH Tyrosine--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=tyrS PE=3 SV=1 64 421 6.0E-28
sp|Q9K7X9|SYY_BACHD Tyrosine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=tyrS PE=3 SV=1 96 369 9.0E-28
sp|Q7MHZ4|SYY2_VIBVY Tyrosine--tRNA ligase 2 OS=Vibrio vulnificus (strain YJ016) GN=tyrS2 PE=3 SV=1 96 474 9.0E-28
sp|Q8DBX3|SYY2_VIBVU Tyrosine--tRNA ligase 2 OS=Vibrio vulnificus (strain CMCP6) GN=tyrS2 PE=3 SV=2 96 474 9.0E-28
sp|Q9I5Q3|SYY2_PSEAE Tyrosine--tRNA ligase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tyrS2 PE=3 SV=1 95 406 1.0E-27
sp|Q2YBR1|SYY_NITMU Tyrosine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=tyrS PE=3 SV=1 95 474 2.0E-27
sp|Q6AJ82|SYY_DESPS Tyrosine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tyrS PE=3 SV=1 65 367 2.0E-27
sp|P43836|SYY_HAEIN Tyrosine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tyrS PE=3 SV=1 96 390 2.0E-27
sp|Q3ILJ9|SYY2_PSEHT Tyrosine--tRNA ligase 2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tyrS2 PE=3 SV=1 82 383 3.0E-27
sp|Q87F06|SYY_XYLFT Tyrosine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=tyrS PE=3 SV=1 63 513 3.0E-27
sp|Q9KU92|SYY2_VIBCH Tyrosine--tRNA ligase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tyrS2 PE=3 SV=1 96 390 3.0E-27
sp|Q4QL45|SYY_HAEI8 Tyrosine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=tyrS PE=3 SV=1 82 390 3.0E-27
sp|Q8Y240|SYY_RALSO Tyrosine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=tyrS PE=3 SV=1 96 390 4.0E-27
sp|Q5QVP5|SYY_IDILO Tyrosine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tyrS PE=3 SV=1 95 404 5.0E-27
sp|Q31E84|SYY_THICR Tyrosine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=tyrS PE=3 SV=1 82 364 7.0E-27
sp|Q475S5|SYY_CUPPJ Tyrosine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tyrS PE=3 SV=1 96 390 8.0E-27
sp|Q2S238|SYY_SALRD Tyrosine--tRNA ligase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=tyrS PE=3 SV=1 96 413 9.0E-27
sp|Q7WFD0|SYY_BORBR Tyrosine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=tyrS PE=3 SV=1 96 395 2.0E-26
sp|Q7VUW5|SYY_BORPE Tyrosine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=tyrS PE=3 SV=1 96 395 2.0E-26
sp|Q39JJ6|SYY_BURL3 Tyrosine--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tyrS PE=3 SV=1 60 390 2.0E-26
sp|Q5NGY5|SYY_FRATT Tyrosine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=tyrS PE=3 SV=1 82 474 3.0E-26
sp|Q60AU5|SYY_METCA Tyrosine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tyrS PE=3 SV=1 95 398 3.0E-26
sp|Q7W3Z8|SYY_BORPA Tyrosine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=tyrS PE=3 SV=1 96 395 3.0E-26
sp|Q6FG10|SYY_ACIAD Tyrosine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=tyrS PE=3 SV=1 95 389 4.0E-26
sp|Q3AZE2|SYY_SYNS9 Tyrosine--tRNA ligase OS=Synechococcus sp. (strain CC9902) GN=tyrS PE=3 SV=1 96 423 4.0E-26
sp|Q9PGX7|SYY_XYLFA Tyrosine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=tyrS PE=3 SV=1 63 507 5.0E-26
sp|Q3JNS0|SYY_BURP1 Tyrosine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=tyrS PE=3 SV=2 96 390 5.0E-26
sp|Q2SZ62|SYY_BURTA Tyrosine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tyrS PE=3 SV=2 96 390 6.0E-26
sp|Q3SLJ8|SYY_THIDA Tyrosine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=tyrS PE=3 SV=1 95 364 7.0E-26
sp|Q39WF4|SYY_GEOMG Tyrosine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=tyrS PE=3 SV=1 95 385 7.0E-26
sp|Q9RR63|SYY_DEIRA Tyrosine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tyrS PE=3 SV=1 49 473 7.0E-26
sp|O67632|SYY_AQUAE Tyrosine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=tyrS PE=3 SV=1 86 385 8.0E-26
sp|Q4FQ91|SYY_PSYA2 Tyrosine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=tyrS PE=3 SV=1 95 389 8.0E-26
sp|Q62HB4|SYY_BURMA Tyrosine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=tyrS PE=3 SV=1 96 390 8.0E-26
sp|Q63QX0|SYY_BURPS Tyrosine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=tyrS PE=3 SV=1 96 390 9.0E-26
sp|Q88QQ2|SYY_PSEPK Tyrosine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=tyrS PE=3 SV=1 82 367 1.0E-25
sp|Q82UQ1|SYY_NITEU Tyrosine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=tyrS PE=3 SV=1 86 474 1.0E-25
sp|Q4K517|SYY_PSEF5 Tyrosine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tyrS PE=3 SV=1 82 390 1.0E-25
sp|Q5P7U2|SYY_AROAE Tyrosine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=tyrS PE=3 SV=1 86 390 2.0E-25
sp|Q3AHU0|SYY_SYNSC Tyrosine--tRNA ligase OS=Synechococcus sp. (strain CC9605) GN=tyrS PE=3 SV=1 96 423 2.0E-25
sp|Q7VAP7|SYY_PROMA Tyrosine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tyrS PE=3 SV=1 96 357 2.0E-25
sp|Q5X7H7|SYY_LEGPA Tyrosine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=tyrS PE=3 SV=1 95 474 3.0E-25
sp|Q889Y8|SYY_PSESM Tyrosine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tyrS PE=3 SV=1 82 398 3.0E-25
sp|Q8KEW9|SYY_CHLTE Tyrosine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=tyrS PE=3 SV=1 48 477 4.0E-25
sp|Q5ZY07|SYY_LEGPH Tyrosine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tyrS PE=3 SV=2 95 474 4.0E-25
sp|Q319F8|SYY_PROM9 Tyrosine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=tyrS PE=3 SV=1 75 423 4.0E-25
sp|Q8DMR1|SYY_THEEB Tyrosine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=tyrS PE=3 SV=1 82 423 5.0E-25
sp|Q48NN3|SYY_PSE14 Tyrosine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tyrS PE=3 SV=1 82 398 5.0E-25
sp|Q3K5W9|SYY_PSEPF Tyrosine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=tyrS PE=3 SV=1 82 398 8.0E-25
sp|Q3MEN7|SYY_ANAVT Tyrosine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=tyrS PE=3 SV=1 96 364 8.0E-25
sp|Q4ZMM7|SYY_PSEU2 Tyrosine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=tyrS PE=3 SV=1 82 398 1.0E-24
sp|Q7ND21|SYY_GLOVI Tyrosine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=tyrS PE=3 SV=1 96 380 1.0E-24
sp|Q8EHB3|SYY_SHEON Tyrosine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=tyrS PE=3 SV=1 96 390 2.0E-24
sp|Q7VHY1|SYY_HELHP Tyrosine--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=tyrS PE=3 SV=1 46 470 2.0E-24
sp|Q83EX7|SYY_COXBU Tyrosine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tyrS PE=3 SV=1 96 405 3.0E-24
sp|Q65MW0|SYY2_BACLD Tyrosine--tRNA ligase 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tyrS2 PE=3 SV=1 96 483 3.0E-24
sp|Q97KY6|SYY2_CLOAB Tyrosine--tRNA ligase 2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=tyrS2 PE=3 SV=1 49 409 3.0E-24
sp|Q9ZL69|SYY_HELPJ Tyrosine--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=tyrS PE=3 SV=1 89 409 3.0E-24
sp|Q6MNQ2|SYY_BDEBA Tyrosine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=tyrS PE=3 SV=1 48 476 4.0E-24
sp|P56417|SYY_HELPY Tyrosine--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=tyrS PE=3 SV=1 89 411 4.0E-24
sp|Q5WYX4|SYY_LEGPL Tyrosine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=tyrS PE=3 SV=1 95 474 4.0E-24
sp|Q8YSU9|SYY_NOSS1 Tyrosine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tyrS PE=3 SV=1 96 404 6.0E-24
sp|Q7V0D7|SYY_PROMP Tyrosine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tyrS PE=3 SV=1 96 478 8.0E-24
sp|Q67QD6|SYY_SYMTH Tyrosine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tyrS PE=3 SV=1 96 491 2.0E-23
sp|Q3B5D0|SYY_CHLL7 Tyrosine--tRNA ligase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=tyrS PE=3 SV=1 96 361 2.0E-23
sp|Q7TTW9|SYY_SYNPX Tyrosine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=tyrS PE=3 SV=1 96 338 2.0E-23
sp|Q3A220|SYY_PELCD Tyrosine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=tyrS PE=3 SV=1 95 385 3.0E-23
sp|P25151|SYY2_BACSU Tyrosine--tRNA ligase 2 OS=Bacillus subtilis (strain 168) GN=tyrS2 PE=3 SV=2 71 370 5.0E-23
sp|Q3Z8V6|SYY_DEHM1 Tyrosine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=tyrS PE=3 SV=1 96 367 5.0E-23
sp|Q7MAH6|SYY_WOLSU Tyrosine--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=tyrS PE=3 SV=1 95 410 7.0E-23
sp|Q7N9W0|SYY2_PHOLL Tyrosine--tRNA ligase 2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tyrS2 PE=3 SV=1 89 405 1.0E-22
sp|Q2JIV0|SYY_SYNJB Tyrosine--tRNA ligase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=tyrS PE=3 SV=1 96 381 1.0E-22
sp|Q3ZX03|SYY_DEHMC Tyrosine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=tyrS PE=3 SV=1 85 367 1.0E-22
sp|Q74E25|SYY_GEOSL Tyrosine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tyrS PE=3 SV=1 95 364 1.0E-22
sp|Q46JD7|SYY_PROMT Tyrosine--tRNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=tyrS PE=3 SV=1 96 410 3.0E-22
sp|Q8P475|SYY_XANCP Tyrosine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tyrS PE=3 SV=1 86 329 8.0E-22
sp|Q4UPQ9|SYY_XANC8 Tyrosine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tyrS PE=3 SV=1 86 329 8.0E-22
sp|P73141|SYY_SYNY3 Tyrosine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=tyrS PE=3 SV=1 96 470 9.0E-22
sp|Q2JSX8|SYY_SYNJA Tyrosine--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=tyrS PE=3 SV=1 96 360 1.0E-21
sp|Q3BNC2|SYY_XANC5 Tyrosine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tyrS PE=3 SV=1 86 358 3.0E-21
sp|Q7TUT0|SYY_PROMM Tyrosine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=tyrS PE=3 SV=2 96 359 4.0E-21
sp|Q5H5K1|SYY_XANOR Tyrosine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tyrS PE=3 SV=2 86 329 5.0E-21
sp|Q2P892|SYY_XANOM Tyrosine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tyrS PE=3 SV=1 86 329 5.0E-21
sp|Q5HTJ2|SYY_CAMJR Tyrosine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=tyrS PE=3 SV=1 95 388 5.0E-21
sp|Q8PFT1|SYY_XANAC Tyrosine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tyrS PE=3 SV=1 86 329 6.0E-21
sp|Q5SIH0|SYY_THET8 Tyrosine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tyrS PE=3 SV=1 96 357 6.0E-21
sp|P83453|SYY_THET2 Tyrosine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tyrS PE=1 SV=1 96 357 6.0E-21
sp|Q9PN27|SYY_CAMJE Tyrosine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=tyrS PE=3 SV=1 95 388 2.0E-20
sp|Q5N1U0|SYY_SYNP6 Tyrosine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=tyrS PE=3 SV=1 96 394 6.0E-20
sp|Q31K19|SYY_SYNE7 Tyrosine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=tyrS PE=3 SV=1 96 394 6.0E-20
sp|P41256|SYY_ACIFR Tyrosine--tRNA ligase OS=Acidithiobacillus ferrooxidans GN=tyrS PE=1 SV=1 96 360 1.0E-18
sp|O29482|SYY_ARCFU Tyrosine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tyrS PE=1 SV=1 78 325 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0000166 nucleotide binding Yes
GO:0003723 RNA binding Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0005488 binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0003676 nucleic acid binding No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0008152 metabolic process No
GO:0016874 ligase activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0046483 heterocycle metabolic process No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0006399 tRNA metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0043039 tRNA aminoacylation No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0043038 amino acid activation No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006520 cellular amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|818
MAPQAVQGLYRATCRARKPTWSLFELHRGRAISQSWLRKVADGEARWKEQAEKIKNGEARHVWDELEERGFIKDV
AGTPQNIRELMRVKRIGAYAGVDPTADSLHLGHLLPLMALFWLWFYGHPVVTLIGGSTARIGDPSGRETTREIMS
NADISKNITKVHYQLMRLWQNVKHLRSKYEFEDDWAAKHHVLNNSMWLQGLSVYDFTKRIARQTRMGPMLSRDSA
QARLNGGSGMSVSEFIYPLFQGWDFWHLYNKLGVQMQVGGSDQYGNIVAGLDAVRTIRESEEAPDQKIPSGFHHD
PIGFTVPLLTDSAGNKFGKSEGNAIWLDEFKTSPFDLYGYFMRRPDDEMEKMLKLFTFLPLDKIHELLREHNLDQ
SKRVAQHTLAFEVLSLVCGPDRALQEAQQHKMIFGGQPPATINIKERSPDGPFDCNTAPRSDMTLPRSVMELAPA
KLLVATSLAASTTQAQQIVKDQGAYVAAQPGQSRGLMPGSLNWTPVKMWFPGETKKFLIDDRLLILRKGKHNVRI
VELVSDEEWKESGKIYPGQPYTGAVRRVREELKKELEEKGAELSPKMTKKEVRRRVSELQSVSVANNPHIQLPNK
SEVRDRLKKGGFDAPWMQRGRVAGRKRP*
Coding >Hirsu2|818
ATGGCCCCTCAAGCGGTGCAGGGGCTTTATCGAGCAACATGCCGTGCCAGGAAACCGACTTGGTCGCTCTTCGAA
CTTCATCGGGGACGCGCCATCTCGCAATCTTGGCTCAGGAAGGTCGCCGACGGCGAAGCGCGCTGGAAGGAGCAG
GCGGAAAAAATAAAGAACGGCGAGGCGCGCCATGTGTGGGATGAGCTTGAGGAGCGAGGCTTCATCAAGGATGTC
GCCGGCACCCCCCAAAATATCCGCGAACTTATGCGTGTAAAGCGAATAGGCGCCTATGCCGGAGTGGACCCGACC
GCCGACTCGCTACACCTCGGACACCTCCTCCCCCTCATGGCCCTGTTCTGGCTGTGGTTTTACGGCCATCCGGTT
GTGACGCTGATCGGTGGATCGACGGCTCGAATTGGCGACCCCAGCGGCCGCGAGACGACTCGCGAGATCATGTCC
AATGCCGACATCTCCAAGAACATTACCAAGGTGCACTACCAGCTTATGAGGCTGTGGCAGAACGTGAAGCACCTC
AGGAGCAAGTACGAGTTTGAAGACGACTGGGCTGCCAAGCACCACGTCTTGAATAACAGCATGTGGTTGCAGGGA
CTGTCCGTCTATGATTTCACCAAGAGGATAGCAAGGCAGACAAGGATGGGCCCCATGCTGAGTCGAGATTCAGCT
CAGGCGAGACTGAACGGGGGCTCGGGCATGTCCGTCAGCGAATTCATCTACCCGCTATTCCAGGGTTGGGACTTC
TGGCACCTGTACAACAAGCTCGGCGTGCAGATGCAAGTCGGCGGCTCCGACCAGTACGGCAACATCGTCGCCGGC
CTCGACGCCGTGAGGACTATCAGAGAGTCCGAGGAAGCCCCCGACCAAAAAATACCTTCAGGATTCCATCACGAT
CCGATAGGGTTTACCGTTCCGTTGCTGACGGATTCGGCCGGAAATAAGTTCGGCAAGAGTGAAGGAAACGCTATA
TGGCTCGACGAGTTCAAGACGTCACCATTTGATCTGTACGGCTACTTCATGCGCCGACCAGATGACGAAATGGAA
AAGATGCTCAAGCTCTTCACCTTCCTCCCACTCGACAAGATCCACGAGCTCCTGCGTGAGCACAACCTGGACCAG
TCCAAGAGGGTTGCGCAGCATACGCTGGCCTTCGAGGTCCTGTCCCTCGTATGTGGCCCTGACAGGGCGCTGCAA
GAGGCGCAGCAACACAAAATGATATTCGGTGGACAGCCCCCCGCCACCATCAACATTAAGGAACGGTCACCGGAC
GGCCCCTTCGACTGCAACACGGCGCCGCGAAGCGACATGACGCTCCCTCGCTCCGTCATGGAACTCGCGCCTGCC
AAGCTCCTCGTCGCGACCAGCCTGGCCGCGAGCACCACCCAGGCACAGCAAATTGTCAAGGATCAGGGCGCCTAC
GTGGCGGCTCAACCCGGACAAAGTCGAGGTCTCATGCCGGGCAGCCTCAACTGGACGCCCGTAAAGATGTGGTTC
CCGGGAGAGACAAAGAAGTTTCTCATCGATGACCGCCTCCTCATCCTGCGAAAGGGAAAGCACAACGTCCGTATC
GTCGAGCTGGTCTCTGACGAGGAGTGGAAAGAGAGCGGCAAAATCTACCCAGGCCAGCCGTACACGGGTGCTGTG
AGGCGAGTCCGGGAAGAACTGAAGAAGGAGTTGGAAGAGAAGGGAGCGGAGCTGTCGCCTAAGATGACCAAAAAG
GAGGTGCGAAGGAGGGTGTCGGAACTGCAGTCCGTGTCGGTGGCCAACAACCCGCATATCCAGCTGCCGAACAAA
TCAGAGGTGCGCGACAGGCTGAAAAAGGGGGGCTTTGACGCCCCGTGGATGCAGCGTGGGCGAGTCGCTGGGAGA
AAGAGGCCGTAG
Transcript >Hirsu2|818
ATGGCCCCTCAAGCGGTGCAGGGGCTTTATCGAGCAACATGCCGTGCCAGGAAACCGACTTGGTCGCTCTTCGAA
CTTCATCGGGGACGCGCCATCTCGCAATCTTGGCTCAGGAAGGTCGCCGACGGCGAAGCGCGCTGGAAGGAGCAG
GCGGAAAAAATAAAGAACGGCGAGGCGCGCCATGTGTGGGATGAGCTTGAGGAGCGAGGCTTCATCAAGGATGTC
GCCGGCACCCCCCAAAATATCCGCGAACTTATGCGTGTAAAGCGAATAGGCGCCTATGCCGGAGTGGACCCGACC
GCCGACTCGCTACACCTCGGACACCTCCTCCCCCTCATGGCCCTGTTCTGGCTGTGGTTTTACGGCCATCCGGTT
GTGACGCTGATCGGTGGATCGACGGCTCGAATTGGCGACCCCAGCGGCCGCGAGACGACTCGCGAGATCATGTCC
AATGCCGACATCTCCAAGAACATTACCAAGGTGCACTACCAGCTTATGAGGCTGTGGCAGAACGTGAAGCACCTC
AGGAGCAAGTACGAGTTTGAAGACGACTGGGCTGCCAAGCACCACGTCTTGAATAACAGCATGTGGTTGCAGGGA
CTGTCCGTCTATGATTTCACCAAGAGGATAGCAAGGCAGACAAGGATGGGCCCCATGCTGAGTCGAGATTCAGCT
CAGGCGAGACTGAACGGGGGCTCGGGCATGTCCGTCAGCGAATTCATCTACCCGCTATTCCAGGGTTGGGACTTC
TGGCACCTGTACAACAAGCTCGGCGTGCAGATGCAAGTCGGCGGCTCCGACCAGTACGGCAACATCGTCGCCGGC
CTCGACGCCGTGAGGACTATCAGAGAGTCCGAGGAAGCCCCCGACCAAAAAATACCTTCAGGATTCCATCACGAT
CCGATAGGGTTTACCGTTCCGTTGCTGACGGATTCGGCCGGAAATAAGTTCGGCAAGAGTGAAGGAAACGCTATA
TGGCTCGACGAGTTCAAGACGTCACCATTTGATCTGTACGGCTACTTCATGCGCCGACCAGATGACGAAATGGAA
AAGATGCTCAAGCTCTTCACCTTCCTCCCACTCGACAAGATCCACGAGCTCCTGCGTGAGCACAACCTGGACCAG
TCCAAGAGGGTTGCGCAGCATACGCTGGCCTTCGAGGTCCTGTCCCTCGTATGTGGCCCTGACAGGGCGCTGCAA
GAGGCGCAGCAACACAAAATGATATTCGGTGGACAGCCCCCCGCCACCATCAACATTAAGGAACGGTCACCGGAC
GGCCCCTTCGACTGCAACACGGCGCCGCGAAGCGACATGACGCTCCCTCGCTCCGTCATGGAACTCGCGCCTGCC
AAGCTCCTCGTCGCGACCAGCCTGGCCGCGAGCACCACCCAGGCACAGCAAATTGTCAAGGATCAGGGCGCCTAC
GTGGCGGCTCAACCCGGACAAAGTCGAGGTCTCATGCCGGGCAGCCTCAACTGGACGCCCGTAAAGATGTGGTTC
CCGGGAGAGACAAAGAAGTTTCTCATCGATGACCGCCTCCTCATCCTGCGAAAGGGAAAGCACAACGTCCGTATC
GTCGAGCTGGTCTCTGACGAGGAGTGGAAAGAGAGCGGCAAAATCTACCCAGGCCAGCCGTACACGGGTGCTGTG
AGGCGAGTCCGGGAAGAACTGAAGAAGGAGTTGGAAGAGAAGGGAGCGGAGCTGTCGCCTAAGATGACCAAAAAG
GAGGTGCGAAGGAGGGTGTCGGAACTGCAGTCCGTGTCGGTGGCCAACAACCCGCATATCCAGCTGCCGAACAAA
TCAGAGGTGCGCGACAGGCTGAAAAAGGGGGGCTTTGACGCCCCGTGGATGCAGCGTGGGCGAGTCGCTGGGAGA
AAGAGGCCGTAG
Gene >Hirsu2|818
ATGGCCCCTCAAGCGGTGCAGGGGCTTTATCGAGCAACATGCCGTGCCAGGAAACCGACTTGGTCGCTCTTCGAA
CTTCATCGGGGACGCGCCATCTCGCAATCTTGGCTCAGGAAGGTCGCCGACGGCGAAGCGCGCTGGAAGGAGCAG
GCGGAAAAAATAAAGAACGGCGAGGCGCGCCATGTGTGGGATGAGCTTGAGGAGCGAGGCTTCATCAAGGATGTC
GCCGGGTGAGTGTCGCCGTACCGCCTCCCTTAGACCACTCTCTGACGCCCGCGACGACGCATCAAGCACCCCCCA
AAATATCCGCGAACTTATGCGTGTAAAGCGAATAGGCGCCTATGCCGGAGTGGACCCGACCGCCGACTCGCTACA
CCTCGGACACCTCCTCCCCCTCATGGCCCTGTTCTGGCTGTGGTTTTACGGCCATCCGGTTGTGACGCTGATCGG
TGGATCGACGGCTCGAATTGGCGACCCCAGCGGCCGCGAGACGACTCGCGAGATCATGTCCAATGCCGACATCTC
CAAGAACATTACCAAGGTGCACTACCAGCTTATGAGGCTGTGGCAGAACGTGAAGCACCTCAGGAGCAAGTACGA
GTTTGAAGACGACTGGGCTGCCAAGCACCACGTCTTGAATAACAGCATGTGGTTGCAGGGACTGTCCGTCTATGA
TTTCACCAAGAGGATAGCAAGGCAGACAAGGATGGGCCCCATGCTGAGTCGAGATTCGTGAGTATCGTCGCTCCC
GATTCGAGCCGAGTTCGCATGCTGATCCAGGAAACAGAGCTCAGGCGAGACTGAACGGGGGCTCGGGCATGTCCG
TCAGCGAATTCATCTACCCGCTATTCCAGGGTTGGGACTTCTGGCACCTGTACAACAAGCTCGGCGTGCAGATGC
AAGTCGGCGGCTCCGACCAGTACGGCAACATCGTCGCCGGCCTCGACGCCGTGAGGACTATCAGAGAGTCCGAGG
AAGCCCCCGACCAAAAAATACCTTCAGGATTCCATCACGATCCGATAGGGTTTACCGTTCCGTTGCTGACGGATT
CGGCCGGAAATAAGTTCGGCAAGAGTGAAGGAAACGCTATATGGCTCGACGAGTTCAAGACGTCACCATTTGATC
TGTACGGCTACTTCATGCGCCGACCAGATGACGAAATGGAAAAGATGCTCAAGCTCTTCACCTTCCTCCCACTCG
ACAAGATCCACGAGCTCCTGCGTGAGCACAACCTGGACCAGTCCAAGAGGGTTGCGCAGCATACGCTGGCCTTCG
AGGTCCTGTCCCTCGTATGTGGCCCTGACAGGGCGCTGCAAGAGGCGCAGCAACACAAAATGATATTCGGTGGAC
AGCCCCCCGCCACCATCAACATTAAGGAACGGTCACCGGACGGCCCCTTCGACTGCAACACGGCGCCGCGAAGCG
ACATGACGCTCCCTCGCTCCGTCATGGAACTCGCGCCTGCCAAGCTCCTCGTCGCGACCAGCCTGGCCGCGAGCA
CCACCCAGGCACAGCAAATTGTCAAGGATCAGGGCGCCTACGTGGCGGCTCAACCCGGACAAAGTCGAGGTCTCA
TGCCGGGCAGCCTCAACTGGACGCCCGTAAAGATGTGGTTCCCGGGAGAGACAAAGAAGTTTCTCATCGATGACC
GCCTCCTCATCCTGCGAAAGGGAAAGCACAACGTCCGTATCGTCGAGCTGGTCTCTGACGAGGAGTGGAAAGAGA
GCGGCAAAATCTACCCAGGCCAGCCGTACACGGGTGCTGTGAGGCGAGTCCGGGAAGAACTGAAGAAGGAGTTGG
AAGAGAAGGGAGCGGAGCTGTCGCCTAAGATGACCAAAAAGGAGGTGCGAAGGAGGGTGTCGGAACTGCAGTCCG
TGTCGGTGGCCAACAACCCGCATATCCAGCTGCCGAACAAATCAGAGGTGCGCGACAGGCTGAAAAAGGGGGGCT
TTGACGCCCCGTGGATGCAGCGTGGGCGAGTCGCTGGGAGAAAGAGGCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail