Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8176
Gene name
LocationContig_517:7181..8785
Strand+
Gene length (bp)1604
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10255 Paf67 RNA polymerase I-associated factor PAF67 5.4E-156 76 473

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7E5J5|EIF3L_SCLS1 Eukaryotic translation initiation factor 3 subunit L OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_00570 PE=3 SV=1 1 475 0.0E+00
sp|A6S1A3|EIF3L_BOTFB Eukaryotic translation initiation factor 3 subunit L OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_06600 PE=3 SV=2 1 475 0.0E+00
sp|Q7SB62|EIF3L_NEUCR Eukaryotic translation initiation factor 3 subunit L OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06279 PE=3 SV=1 1 475 0.0E+00
sp|L7HXG6|EIF3L_MAGOY Eukaryotic translation initiation factor 3 subunit L OS=Magnaporthe oryzae (strain Y34) GN=OOU_Y34scaffold00711g6 PE=2 SV=1 1 475 0.0E+00
sp|P0CT08|EIF3L_MAGO7 Eukaryotic translation initiation factor 3 subunit L OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05266 PE=3 SV=1 1 475 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7E5J5|EIF3L_SCLS1 Eukaryotic translation initiation factor 3 subunit L OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_00570 PE=3 SV=1 1 475 0.0E+00
sp|A6S1A3|EIF3L_BOTFB Eukaryotic translation initiation factor 3 subunit L OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_06600 PE=3 SV=2 1 475 0.0E+00
sp|Q7SB62|EIF3L_NEUCR Eukaryotic translation initiation factor 3 subunit L OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06279 PE=3 SV=1 1 475 0.0E+00
sp|L7HXG6|EIF3L_MAGOY Eukaryotic translation initiation factor 3 subunit L OS=Magnaporthe oryzae (strain Y34) GN=OOU_Y34scaffold00711g6 PE=2 SV=1 1 475 0.0E+00
sp|P0CT08|EIF3L_MAGO7 Eukaryotic translation initiation factor 3 subunit L OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05266 PE=3 SV=1 1 475 0.0E+00
sp|Q2H9N4|EIF3L_CHAGB Eukaryotic translation initiation factor 3 subunit L OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_03070 PE=3 SV=1 3 475 0.0E+00
sp|A1C690|EIF3L_ASPCL Eukaryotic translation initiation factor 3 subunit L OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_069410 PE=3 SV=1 3 475 0.0E+00
sp|Q1DZB0|EIF3L_COCIM Eukaryotic translation initiation factor 3 subunit L OS=Coccidioides immitis (strain RS) GN=CIMG_04353 PE=3 SV=1 7 475 0.0E+00
sp|Q0CPA8|EIF3L_ASPTN Eukaryotic translation initiation factor 3 subunit L OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_04476 PE=3 SV=1 14 475 0.0E+00
sp|A1DGW6|EIF3L_NEOFI Eukaryotic translation initiation factor 3 subunit L OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_085780 PE=3 SV=1 3 475 0.0E+00
sp|Q4X1D2|EIF3L_ASPFU Eukaryotic translation initiation factor 3 subunit L OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G10380 PE=3 SV=1 3 475 0.0E+00
sp|B0XS74|EIF3L_ASPFC Eukaryotic translation initiation factor 3 subunit L OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_026190 PE=3 SV=1 3 475 0.0E+00
sp|A2R7S7|EIF3L_ASPNC Eukaryotic translation initiation factor 3 subunit L OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An16g04580 PE=3 SV=1 14 475 0.0E+00
sp|Q2U041|EIF3L_ASPOR Eukaryotic translation initiation factor 3 subunit L OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090011000599 PE=3 SV=1 17 475 0.0E+00
sp|Q5B0H6|EIF3L_EMENI Eukaryotic translation initiation factor 3 subunit L OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5954 PE=3 SV=1 14 475 0.0E+00
sp|Q0UIU6|EIF3L_PHANO Eukaryotic translation initiation factor 3 subunit L OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_08318 PE=3 SV=2 24 434 0.0E+00
sp|Q6CAE9|EIF3L_YARLI Eukaryotic translation initiation factor 3 subunit L OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D03399g PE=3 SV=1 72 476 9.0E-150
sp|Q4PF85|EIF3L_USTMA Eukaryotic translation initiation factor 3 subunit L OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_01228 PE=3 SV=1 74 476 2.0E-146
sp|Q8QZY1|EIF3L_MOUSE Eukaryotic translation initiation factor 3 subunit L OS=Mus musculus GN=Eif3l PE=1 SV=1 73 473 1.0E-140
sp|Q3ZCK1|EIF3L_BOVIN Eukaryotic translation initiation factor 3 subunit L OS=Bos taurus GN=EIF3L PE=2 SV=1 73 473 2.0E-140
sp|Q9Y262|EIF3L_HUMAN Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens GN=EIF3L PE=1 SV=1 73 473 2.0E-140
sp|Q7T2A5|EIF3L_DANRE Eukaryotic translation initiation factor 3 subunit L OS=Danio rerio GN=eif3l PE=2 SV=1 73 473 3.0E-140
sp|Q6P878|EIF3L_XENTR Eukaryotic translation initiation factor 3 subunit L OS=Xenopus tropicalis GN=eif3l PE=2 SV=1 73 473 4.0E-140
sp|Q5F428|EIF3L_CHICK Eukaryotic translation initiation factor 3 subunit L OS=Gallus gallus GN=EIF3L PE=2 SV=1 73 473 9.0E-140
sp|Q8AVJ0|EIF3L_XENLA Eukaryotic translation initiation factor 3 subunit L OS=Xenopus laevis GN=eif3l PE=2 SV=1 73 473 1.0E-139
sp|A5A6M4|EIF3L_PANTR Eukaryotic translation initiation factor 3 subunit L OS=Pan troglodytes GN=EIF3L PE=2 SV=1 73 473 2.0E-139
sp|A7SDW5|EIF3L_NEMVE Eukaryotic translation initiation factor 3 subunit L OS=Nematostella vectensis GN=v1g169424 PE=3 SV=1 73 473 5.0E-126
sp|B4HFJ3|EIF3L_DROSE Eukaryotic translation initiation factor 3 subunit L OS=Drosophila sechellia GN=GM24677 PE=3 SV=1 73 471 1.0E-110
sp|B4KZ45|EIF3L_DROMO Eukaryotic translation initiation factor 3 subunit L OS=Drosophila mojavensis GN=GI12903 PE=3 SV=1 73 473 1.0E-110
sp|B4PG99|EIF3L_DROYA Eukaryotic translation initiation factor 3 subunit L OS=Drosophila yakuba GN=GE20146 PE=3 SV=1 73 471 1.0E-110
sp|B0WR18|EIF3L_CULQU Eukaryotic translation initiation factor 3 subunit L OS=Culex quinquefasciatus GN=CPIJ009242 PE=3 SV=1 73 471 1.0E-110
sp|Q9VTU4|EIF3L_DROME Eukaryotic translation initiation factor 3 subunit L OS=Drosophila melanogaster GN=CG5642 PE=2 SV=1 73 471 1.0E-110
sp|B4QR64|EIF3L_DROSI Eukaryotic translation initiation factor 3 subunit L OS=Drosophila simulans GN=GD12745 PE=3 SV=1 73 471 1.0E-110
sp|Q16FL6|EIF3L_AEDAE Eukaryotic translation initiation factor 3 subunit L OS=Aedes aegypti GN=AAEL009617 PE=3 SV=1 73 473 3.0E-110
sp|B3NH71|EIF3L_DROER Eukaryotic translation initiation factor 3 subunit L OS=Drosophila erecta GN=GG13851 PE=3 SV=1 73 471 3.0E-110
sp|B4LEJ0|EIF3L_DROVI Eukaryotic translation initiation factor 3 subunit L OS=Drosophila virilis GN=GJ13043 PE=3 SV=1 73 473 7.0E-110
sp|B3M7W0|EIF3L_DROAN Eukaryotic translation initiation factor 3 subunit L OS=Drosophila ananassae GN=GF25000 PE=3 SV=1 73 471 1.0E-109
sp|B4IWN1|EIF3L_DROGR Eukaryotic translation initiation factor 3 subunit L OS=Drosophila grimshawi GN=GH15308 PE=3 SV=1 73 473 3.0E-109
sp|P0CN56|EIF3L_CRYNJ Eukaryotic translation initiation factor 3 subunit L OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNL05160 PE=3 SV=1 76 470 5.0E-109
sp|B4MX71|EIF3L_DROWI Eukaryotic translation initiation factor 3 subunit L OS=Drosophila willistoni GN=GK20774 PE=3 SV=1 73 471 5.0E-109
sp|P0CN57|EIF3L_CRYNB Eukaryotic translation initiation factor 3 subunit L OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBI1650 PE=3 SV=1 76 470 5.0E-109
sp|Q2M0S3|EIF3L_DROPS Eukaryotic translation initiation factor 3 subunit L OS=Drosophila pseudoobscura pseudoobscura GN=GA19025 PE=3 SV=1 73 473 3.0E-108
sp|B4GR63|EIF3L_DROPE Eukaryotic translation initiation factor 3 subunit L OS=Drosophila persimilis GN=GL25016 PE=3 SV=1 73 471 5.0E-107
sp|Q7Q5Y8|EIF3L_ANOGA Eukaryotic translation initiation factor 3 subunit L OS=Anopheles gambiae GN=AGAP006130 PE=3 SV=3 73 473 4.0E-102
sp|A8X419|EIF3L_CAEBR Eukaryotic translation initiation factor 3 subunit L OS=Caenorhabditis briggsae GN=eif-3.L PE=3 SV=1 71 473 1.0E-90
sp|Q95QW0|EIF3L_CAEEL Eukaryotic translation initiation factor 3 subunit L OS=Caenorhabditis elegans GN=eif-3.L PE=3 SV=1 71 473 2.0E-90
sp|A8PHP4|EIF3L_BRUMA Eukaryotic translation initiation factor 3 subunit L OS=Brugia malayi GN=Bm1_25770 PE=3 SV=1 76 473 1.0E-83
sp|Q86LA2|EIF3L_DICDI Eukaryotic translation initiation factor 3 subunit L OS=Dictyostelium discoideum GN=eif3L PE=3 SV=1 67 454 1.0E-81
sp|A9VCY6|EIF3L_MONBE Eukaryotic translation initiation factor 3 subunit L OS=Monosiga brevicollis GN=39212 PE=3 SV=1 73 468 6.0E-74
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0003743 translation initiation factor activity Yes
GO:0005852 eukaryotic translation initiation factor 3 complex Yes
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0005575 cellular_component No
GO:1901363 heterocyclic compound binding No
GO:0044444 cytoplasmic part No
GO:0003723 RNA binding No
GO:0044464 cell part No
GO:0097159 organic cyclic compound binding No
GO:0008135 translation factor activity, RNA binding No
GO:0032991 protein-containing complex No
GO:0003676 nucleic acid binding No
GO:0044424 intracellular part No
GO:0003674 molecular_function No
GO:0045182 translation regulator activity No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 195 217 22
2 230 252 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8176
MATYQNGVAPARALDVDSDVEEEVLVAEYKEHVQYDDGEELSQTTSLTMAQQTDDIQARLVQAAQPLDFSAPLEV
KFQSYDSYCSLFHFILNSEGPVDLEPPSYYWAWDVIDEFIYQFNSFSSYRSRIARQASNEEEMQILRENPNTWGC
YSVLNVLYSLIQRSQITEQMAAMKRNEDPMTVAGEYGSKNLYRMLGYFSIIGLLRVHCLLGDFSLALKTLDDIEL
NKKAMFARVMAAHFTTYYYVGFSYMMMHRYADAIRMFSHILIYVSRTKNFQKNAQYDSITKKNEQMYALIAICVA
FQPTRLDDTIHGALREKYGDQLLKLQRGGPESLPIFEELFRTACPKFISPVPPDFDNAQSNVDPVEHHLAVFMDE
VKTNMWSPTIKSYLRLYTTMDLNKLAGFLEVKPDELRSWLLVTKQRTKQLRWQDQGLLDGELVNVSDLDYALQGD
LIHISEAKVGRKLVDWYLRNLSRTYN*
Coding >Hirsu2|8176
ATGGCGACGTACCAGAATGGCGTGGCCCCGGCCCGCGCCCTCGACGTCGACAGCGATGTGGAGGAGGAGGTGCTG
GTGGCCGAGTACAAGGAGCACGTGCAGTACGACGACGGCGAGGAGCTGAGCCAGACGACGTCGCTGACGATGGCG
CAACAAACGGACGACATCCAGGCGCGGCTGGTGCAGGCGGCGCAGCCGCTGGACTTCTCGGCGCCGCTCGAGGTC
AAGTTCCAGAGCTACGACTCGTACTGCAGCCTGTTCCACTTCATCCTCAACTCGGAGGGGCCCGTCGACCTCGAG
CCACCGTCGTACTACTGGGCGTGGGACGTCATCGACGAATTCATCTACCAGTTCAACTCGTTCAGCTCGTACCGG
TCCCGGATCGCGCGGCAGGCGTCGAACGAGGAGGAGATGCAGATCCTGCGCGAGAACCCCAACACGTGGGGCTGC
TACAGCGTACTCAACGTGCTGTACTCGCTCATCCAGCGGTCGCAGATCACGGAGCAGATGGCGGCGATGAAGCGG
AACGAGGACCCGATGACGGTGGCGGGCGAGTACGGATCGAAGAACCTGTATAGGATGCTGGGCTACTTCTCCATC
ATCGGCCTGCTGCGGGTGCACTGCCTGCTGGGCGACTTCAGCCTGGCGCTCAAGACGCTCGACGACATCGAGCTC
AACAAGAAGGCCATGTTCGCGCGGGTGATGGCGGCGCACTTCACGACGTACTACTACGTCGGCTTCTCGTACATG
ATGATGCACCGGTACGCGGACGCGATCCGGATGTTCAGCCACATCCTGATCTACGTGTCGCGGACCAAGAACTTC
CAGAAGAACGCGCAGTACGACTCGATCACGAAGAAGAACGAGCAGATGTACGCGCTCATCGCCATCTGCGTGGCC
TTCCAGCCGACGCGGCTGGACGACACGATCCACGGGGCGCTGCGGGAGAAGTACGGCGACCAGCTGCTGAAGCTG
CAGCGGGGCGGGCCCGAGTCGCTGCCCATCTTCGAGGAGCTGTTCCGGACGGCGTGCCCCAAGTTCATCTCGCCG
GTGCCGCCGGACTTTGACAACGCGCAGTCGAACGTGGACCCGGTCGAGCACCACCTGGCCGTCTTCATGGACGAG
GTCAAGACGAACATGTGGAGCCCGACGATCAAGTCGTACCTGCGCCTCTACACCACCATGGACCTCAACAAGCTG
GCCGGCTTCCTCGAGGTCAAGCCGGACGAGCTGCGGTCGTGGCTGCTGGTGACGAAGCAGCGGACGAAGCAGCTG
CGGTGGCAGGACCAGGGGCTGCTGGACGGCGAGCTCGTCAACGTGAGCGATCTCGACTACGCCTTGCAAGGGGAC
CTGATTCACATCTCGGAGGCCAAGGTGGGCAGGAAGCTGGTGGACTGGTACCTCCGCAACCTGTCACGCACCTAC
AACTAG
Transcript >Hirsu2|8176
ATGGCGACGTACCAGAATGGCGTGGCCCCGGCCCGCGCCCTCGACGTCGACAGCGATGTGGAGGAGGAGGTGCTG
GTGGCCGAGTACAAGGAGCACGTGCAGTACGACGACGGCGAGGAGCTGAGCCAGACGACGTCGCTGACGATGGCG
CAACAAACGGACGACATCCAGGCGCGGCTGGTGCAGGCGGCGCAGCCGCTGGACTTCTCGGCGCCGCTCGAGGTC
AAGTTCCAGAGCTACGACTCGTACTGCAGCCTGTTCCACTTCATCCTCAACTCGGAGGGGCCCGTCGACCTCGAG
CCACCGTCGTACTACTGGGCGTGGGACGTCATCGACGAATTCATCTACCAGTTCAACTCGTTCAGCTCGTACCGG
TCCCGGATCGCGCGGCAGGCGTCGAACGAGGAGGAGATGCAGATCCTGCGCGAGAACCCCAACACGTGGGGCTGC
TACAGCGTACTCAACGTGCTGTACTCGCTCATCCAGCGGTCGCAGATCACGGAGCAGATGGCGGCGATGAAGCGG
AACGAGGACCCGATGACGGTGGCGGGCGAGTACGGATCGAAGAACCTGTATAGGATGCTGGGCTACTTCTCCATC
ATCGGCCTGCTGCGGGTGCACTGCCTGCTGGGCGACTTCAGCCTGGCGCTCAAGACGCTCGACGACATCGAGCTC
AACAAGAAGGCCATGTTCGCGCGGGTGATGGCGGCGCACTTCACGACGTACTACTACGTCGGCTTCTCGTACATG
ATGATGCACCGGTACGCGGACGCGATCCGGATGTTCAGCCACATCCTGATCTACGTGTCGCGGACCAAGAACTTC
CAGAAGAACGCGCAGTACGACTCGATCACGAAGAAGAACGAGCAGATGTACGCGCTCATCGCCATCTGCGTGGCC
TTCCAGCCGACGCGGCTGGACGACACGATCCACGGGGCGCTGCGGGAGAAGTACGGCGACCAGCTGCTGAAGCTG
CAGCGGGGCGGGCCCGAGTCGCTGCCCATCTTCGAGGAGCTGTTCCGGACGGCGTGCCCCAAGTTCATCTCGCCG
GTGCCGCCGGACTTTGACAACGCGCAGTCGAACGTGGACCCGGTCGAGCACCACCTGGCCGTCTTCATGGACGAG
GTCAAGACGAACATGTGGAGCCCGACGATCAAGTCGTACCTGCGCCTCTACACCACCATGGACCTCAACAAGCTG
GCCGGCTTCCTCGAGGTCAAGCCGGACGAGCTGCGGTCGTGGCTGCTGGTGACGAAGCAGCGGACGAAGCAGCTG
CGGTGGCAGGACCAGGGGCTGCTGGACGGCGAGCTCGTCAACGTGAGCGATCTCGACTACGCCTTGCAAGGGGAC
CTGATTCACATCTCGGAGGCCAAGGTGGGCAGGAAGCTGGTGGACTGGTACCTCCGCAACCTGTCACGCACCTAC
AACTAG
Gene >Hirsu2|8176
ATGGCGACGTACCAGAATGGCGTGGCCCCGGCCCGCGCCCTCGACGTCGACAGCGATGTGGAGGAGGAGGTGCTG
GTGGCCGAGTACAAGGAGCACGTGCAGTACGACGACGGCGAGGAGCTGAGCCAGACGACGTCGCTGACGATGGCG
CAACAAACGGACGACATCCAGGCGCGGCTGGTGCAGGCGGCGCAGCCGCTGGACTTCTCGGCGCCGCTCGAGGTC
AAGTTCCAGAGCTACGACTCGTACTGCAGCCTGTTCCACTTCATCCTCAACTCGGAGGGGCCCGTCGACCTCGAG
CCACCGTCGGTGCGTGCAGACCCGGGATGAGACCGGTGCCGGGTCCCGGCCATTGCTGTTCTCCCTCGCTGACGC
TGCCTTGTTTGGTGGGTATGTGCAGTACTACTGGGCGTGGGACGTCATCGACGAATTCATCTACCAGTTCAACTC
GTTCAGCTCGTACCGGTCCCGGATCGCGCGGCAGGCGTCGAACGAGGAGGAGATGCAGATCCTGCGCGAGAACCC
CAACACGTGGGGCTGCTACAGCGTACTCAACGTGCTGTACTCGCTCATCCAGCGGTCGCAGATCACGGAGCAGAT
GGCGGCGATGAAGCGGAACGAGGACCCGATGACGGTGGCGGGCGAGTACGGATCGAAGAACCTGTATAGGATGCT
GGGCTACTTCTCCATCATCGGCCTGCTGCGGGTGCACTGCCTGCTGGGCGACTTCAGCCTGGCGCTCAAGACGCT
CGACGACATCGAGCTCAACAAGAAGGCCATGTTCGCGCGGGTGATGGCGGCGCACTTCACGACGTACTACTACGT
CGGCTTCTCGTACATGATGATGCACCGGTACGCGGACGCGATCCGGATGTTCAGCCACATCCTGATCTACGTGTC
GCGGACCAAGAACTTCCAGAAGAACGCGCAGTACGACTCGATCACGAAGAAGAACGAGCAGATGTACGCGCTCAT
CGCCATCTGCGTGGCCTTCCAGCCGACGCGGCTGGACGACACGATCCACGGGGCGCTGCGGGAGAAGTACGGCGA
CCAGCTGCTGAAGCTGCAGCGGGGCGGGCCCGAGTCGCTGCCCATCTTCGAGGAGCTGTTCCGGACGGCGTGCCC
CAAGTTCATCTCGCCGGTGCCGCCGGACTTTGACAACGCGCAGTCGAACGTGGACCCGGTCGAGCACCACCTGGC
CGTCTTCATGGACGAGGTCAAGACGAACATGTGGAGCCCGACGATCAAGTCGTACCTGCGCCTCTACACCACCAT
GGACCTCAACAAGCTGGCCGGCTTCCTCGAGGTCAAGCCGGACGAGCTGCGGTCGTGGCTGCTGGTGACGAAGCA
GCGGACGAAGCAGCTGCGGTGGCAGGACCAGGGGCTGCTGGACGGCGAGCTCGTCAACGTGAGCGATCTCGACTA
CGCCTTGCAAGGGGTGAGCTCCTTTTTTTTTTTCTCCCTGTCTTTCTGTGGATGGATGGCCAGGTGACTGACAAA
GGATGCCTCGCGGCACACAGGACCTGATTCACATCTCGGAGGCCAAGGTGGGCAGGAAGCTGGTGGACTGGTACC
TCCGCAACCTGTCACGCACCTACAACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail