Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8175
Gene name
LocationContig_517:3158..6425
Strand-
Gene length (bp)3267
Transcript length (bp)3210
Coding sequence length (bp)3210
Protein length (aa) 1070

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 2.2E-58 18 311
PF00679 EFG_C Elongation factor G C-terminus 1.0E-15 933 1014
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 8.5E-09 517 593
PF14492 EFG_II Elongation Factor G, domain II 1.2E-07 610 673

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74945|RIA1_SCHPO Ribosome assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ria1 PE=3 SV=1 1 1069 0.0E+00
sp|Q7Z2Z2|ETUD1_HUMAN Elongation factor Tu GTP-binding domain-containing protein 1 OS=Homo sapiens GN=EFTUD1 PE=1 SV=2 1 1069 0.0E+00
sp|Q8C0D5|ETUD1_MOUSE Elongation factor Tu GTP-binding domain-containing protein 1 OS=Mus musculus GN=Eftud1 PE=1 SV=1 7 1069 0.0E+00
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 1 476 7.0E-154
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 512 1069 9.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74945|RIA1_SCHPO Ribosome assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ria1 PE=3 SV=1 1 1069 0.0E+00
sp|Q7Z2Z2|ETUD1_HUMAN Elongation factor Tu GTP-binding domain-containing protein 1 OS=Homo sapiens GN=EFTUD1 PE=1 SV=2 1 1069 0.0E+00
sp|Q8C0D5|ETUD1_MOUSE Elongation factor Tu GTP-binding domain-containing protein 1 OS=Mus musculus GN=Eftud1 PE=1 SV=1 7 1069 0.0E+00
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 1 476 7.0E-154
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 512 1069 9.0E-138
sp|Q06193|EF2_ENTHI Elongation factor 2 OS=Entamoeba histolytica GN=EF-2 PE=2 SV=1 18 1050 9.0E-132
sp|P15112|EF2_DICDI Elongation factor 2 OS=Dictyostelium discoideum GN=efbA PE=1 SV=2 7 439 9.0E-81
sp|Q96X45|EF2_NEUCR Elongation factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-3 PE=3 SV=3 7 439 1.0E-78
sp|O23755|EF2_BETVU Elongation factor 2 OS=Beta vulgaris PE=2 SV=1 1 439 2.0E-77
sp|Q874B9|EF2_PICPA Elongation factor 2 OS=Komagataella pastoris GN=EFT1 PE=3 SV=1 7 439 1.0E-75
sp|Q875Z2|EF2_NAUCC Elongation factor 2 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=EFT1 PE=3 SV=1 1 439 2.0E-75
sp|Q754C8|EF2_ASHGO Elongation factor 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EFT1 PE=3 SV=1 1 439 6.0E-75
sp|O14460|EF2_SCHPO Elongation factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eft201 PE=1 SV=2 1 439 7.0E-75
sp|A5DI11|EF2_PICGU Elongation factor 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EFT2 PE=3 SV=1 1 439 8.0E-75
sp|Q5A0M4|EF2_CANAL Elongation factor 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EFT2 PE=1 SV=2 1 439 1.0E-74
sp|Q6BJ25|EF2_DEBHA Elongation factor 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EFT1 PE=3 SV=1 1 439 2.0E-74
sp|C4YJQ8|EF2_CANAW Elongation factor 2 OS=Candida albicans (strain WO-1) GN=EFT2 PE=3 SV=1 1 439 4.0E-74
sp|Q6FYA7|EF2_CANGA Elongation factor 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EFT1 PE=3 SV=1 1 439 2.0E-73
sp|Q6CPQ9|EF2_KLULA Elongation factor 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EFT1 PE=3 SV=1 1 439 2.0E-72
sp|Q875S0|EF2_LACK1 Elongation factor 2 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=EFT2 PE=3 SV=1 1 439 2.0E-72
sp|P13060|EF2_DROME Elongation factor 2 OS=Drosophila melanogaster GN=EF2 PE=1 SV=4 7 439 3.0E-72
sp|P32324|EF2_YEAST Elongation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFT1 PE=1 SV=1 1 439 9.0E-72
sp|Q17152|EF2_BLAHO Elongation factor 2 OS=Blastocystis hominis PE=2 SV=1 7 439 2.0E-71
sp|Q23716|EF2_CRYPV Elongation factor 2 OS=Cryptosporidium parvum PE=3 SV=1 7 439 5.0E-71
sp|P28996|EF2_PARKE Elongation factor 2 OS=Parachlorella kessleri PE=2 SV=1 7 439 7.0E-69
sp|Q1HPK6|EF2_BOMMO Translation elongation factor 2 OS=Bombyx mori GN=tef2 PE=1 SV=1 7 439 8.0E-69
sp|P29691|EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans GN=eef-2 PE=2 SV=4 7 439 3.0E-67
sp|Q90705|EF2_CHICK Elongation factor 2 OS=Gallus gallus GN=EEF2 PE=1 SV=3 7 439 9.0E-66
sp|Q3SYU2|EF2_BOVIN Elongation factor 2 OS=Bos taurus GN=EEF2 PE=2 SV=3 509 1015 6.0E-65
sp|P05197|EF2_RAT Elongation factor 2 OS=Rattus norvegicus GN=Eef2 PE=1 SV=4 509 1015 8.0E-65
sp|P58252|EF2_MOUSE Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 SV=2 509 1015 8.0E-65
sp|Q5R8Z3|EF2_PONAB Elongation factor 2 OS=Pongo abelii GN=EEF2 PE=2 SV=3 509 1015 9.0E-65
sp|P13639|EF2_HUMAN Elongation factor 2 OS=Homo sapiens GN=EEF2 PE=1 SV=4 509 1015 9.0E-65
sp|P09445|EF2_CRIGR Elongation factor 2 OS=Cricetulus griseus GN=EEF2 PE=1 SV=4 509 1015 1.0E-64
sp|A0SXL6|EF2_CALJA Elongation factor 2 OS=Callithrix jacchus GN=EEF2 PE=2 SV=1 509 1015 1.0E-64
sp|Q90705|EF2_CHICK Elongation factor 2 OS=Gallus gallus GN=EEF2 PE=1 SV=3 509 1015 2.0E-64
sp|Q23716|EF2_CRYPV Elongation factor 2 OS=Cryptosporidium parvum PE=3 SV=1 458 1015 8.0E-63
sp|Q3SYU2|EF2_BOVIN Elongation factor 2 OS=Bos taurus GN=EEF2 PE=2 SV=3 7 439 2.0E-62
sp|A0SXL6|EF2_CALJA Elongation factor 2 OS=Callithrix jacchus GN=EEF2 PE=2 SV=1 7 439 2.0E-62
sp|Q5R8Z3|EF2_PONAB Elongation factor 2 OS=Pongo abelii GN=EEF2 PE=2 SV=3 7 439 5.0E-62
sp|P13639|EF2_HUMAN Elongation factor 2 OS=Homo sapiens GN=EEF2 PE=1 SV=4 7 439 5.0E-62
sp|Q874B9|EF2_PICPA Elongation factor 2 OS=Komagataella pastoris GN=EFT1 PE=3 SV=1 429 1015 1.0E-61
sp|P05197|EF2_RAT Elongation factor 2 OS=Rattus norvegicus GN=Eef2 PE=1 SV=4 7 439 1.0E-61
sp|P58252|EF2_MOUSE Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 SV=2 7 439 1.0E-61
sp|Q1HPK6|EF2_BOMMO Translation elongation factor 2 OS=Bombyx mori GN=tef2 PE=1 SV=1 509 1014 2.0E-61
sp|P09445|EF2_CRIGR Elongation factor 2 OS=Cricetulus griseus GN=EEF2 PE=1 SV=4 7 439 5.0E-61
sp|P13060|EF2_DROME Elongation factor 2 OS=Drosophila melanogaster GN=EF2 PE=1 SV=4 509 1014 4.0E-60
sp|A5DI11|EF2_PICGU Elongation factor 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EFT2 PE=3 SV=1 509 1013 1.0E-59
sp|Q6BJ25|EF2_DEBHA Elongation factor 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EFT1 PE=3 SV=1 429 1014 4.0E-58
sp|Q6CPQ9|EF2_KLULA Elongation factor 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EFT1 PE=3 SV=1 509 1015 7.0E-58
sp|P32324|EF2_YEAST Elongation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFT1 PE=1 SV=1 476 1015 7.0E-58
sp|Q6FYA7|EF2_CANGA Elongation factor 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EFT1 PE=3 SV=1 509 1015 2.0E-57
sp|Q875S0|EF2_LACK1 Elongation factor 2 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=EFT2 PE=3 SV=1 509 1015 4.0E-57
sp|P29691|EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans GN=eef-2 PE=2 SV=4 509 1015 8.0E-57
sp|Q5A0M4|EF2_CANAL Elongation factor 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EFT2 PE=1 SV=2 429 1013 2.0E-56
sp|C4YJQ8|EF2_CANAW Elongation factor 2 OS=Candida albicans (strain WO-1) GN=EFT2 PE=3 SV=1 509 1013 2.0E-56
sp|Q875Z2|EF2_NAUCC Elongation factor 2 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=EFT1 PE=3 SV=1 509 1015 6.0E-56
sp|Q754C8|EF2_ASHGO Elongation factor 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EFT1 PE=3 SV=1 509 1015 6.0E-56
sp|Q8SQT7|EF2_ENCCU Elongation factor 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=EFT1 PE=1 SV=1 8 457 7.0E-56
sp|P28996|EF2_PARKE Elongation factor 2 OS=Parachlorella kessleri PE=2 SV=1 509 1014 5.0E-55
sp|P15112|EF2_DICDI Elongation factor 2 OS=Dictyostelium discoideum GN=efbA PE=1 SV=2 509 1013 1.0E-54
sp|Q96X45|EF2_NEUCR Elongation factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-3 PE=3 SV=3 509 1053 4.0E-54
sp|O14460|EF2_SCHPO Elongation factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eft201 PE=1 SV=2 509 1015 9.0E-52
sp|O23755|EF2_BETVU Elongation factor 2 OS=Beta vulgaris PE=2 SV=1 509 1015 4.0E-50
sp|Q17152|EF2_BLAHO Elongation factor 2 OS=Blastocystis hominis PE=2 SV=1 509 1011 9.0E-48
sp|C3NED6|EF2_SULIY Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1 7 263 6.0E-47
sp|C3NHB6|EF2_SULIN Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1 7 263 6.0E-47
sp|C3MVH1|EF2_SULIM Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1 7 263 6.0E-47
sp|C3MQ53|EF2_SULIL Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1 7 263 6.0E-47
sp|C4KHE9|EF2_SULIK Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1 7 263 6.0E-47
sp|C3N5S0|EF2_SULIA Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1 7 263 6.0E-47
sp|P30925|EF2_SULSO Elongation factor 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fusA PE=1 SV=3 7 263 8.0E-47
sp|A7I4X4|EF2_METB6 Elongation factor 2 OS=Methanoregula boonei (strain 6A8) GN=fusA PE=3 SV=1 7 203 8.0E-47
sp|A8ACA7|EF2_IGNH4 Elongation factor 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fusA PE=3 SV=1 7 190 3.0E-45
sp|O93632|EF2_METBU Elongation factor 2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fusA PE=3 SV=1 7 203 7.0E-45
sp|O93637|EF2_METMT Elongation factor 2 OS=Methanococcoides methylutens GN=fusA PE=3 SV=1 7 203 5.0E-44
sp|B1L7Q0|EF2_KORCO Elongation factor 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=fusA PE=3 SV=1 7 242 7.0E-44
sp|A4YCV9|EF2_METS5 Elongation factor 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=fusA PE=3 SV=1 5 296 7.0E-44
sp|Q975H5|EF2_SULTO Elongation factor 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fusA PE=3 SV=3 7 263 9.0E-44
sp|P23112|EF2_SULAC Elongation factor 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fusA PE=1 SV=3 7 263 1.0E-43
sp|A4FUD3|U5S1_BOVIN 116 kDa U5 small nuclear ribonucleoprotein component OS=Bos taurus GN=EFTUD2 PE=2 SV=1 507 1050 7.0E-43
sp|Q5F3X4|U5S1_CHICK 116 kDa U5 small nuclear ribonucleoprotein component OS=Gallus gallus GN=EFTUD2 PE=2 SV=1 507 1050 9.0E-43
sp|O08810|U5S1_MOUSE 116 kDa U5 small nuclear ribonucleoprotein component OS=Mus musculus GN=Eftud2 PE=1 SV=1 507 1050 9.0E-43
sp|Q15029|U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens GN=EFTUD2 PE=1 SV=1 507 1050 9.0E-43
sp|Q5R6E0|U5S1_PONAB 116 kDa U5 small nuclear ribonucleoprotein component OS=Pongo abelii GN=EFTUD2 PE=2 SV=1 507 1050 2.0E-42
sp|B6YVG5|EF2_THEON Elongation factor 2 OS=Thermococcus onnurineus (strain NA1) GN=fusA PE=3 SV=1 8 190 3.0E-42
sp|O27131|EF2_METTH Elongation factor 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fusA PE=3 SV=2 8 248 8.0E-42
sp|A3DMV6|EF2_STAMF Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fusA PE=3 SV=1 8 194 2.0E-41
sp|O28385|EF2_ARCFU Elongation factor 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fusA PE=3 SV=1 7 190 3.0E-41
sp|C5A6N7|EF2_THEGJ Elongation factor 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fusA PE=3 SV=1 8 190 3.0E-41
sp|P61878|EF2_PYRWO Elongation factor 2 OS=Pyrococcus woesei GN=fusA PE=3 SV=1 8 208 3.0E-41
sp|P61877|EF2_PYRFU Elongation factor 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fusA PE=3 SV=1 8 208 3.0E-41
sp|Q9YC19|EF2_AERPE Elongation factor 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fusA PE=3 SV=1 12 194 4.0E-41
sp|A3MSN3|EF2_PYRCJ Elongation factor 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fusA PE=3 SV=1 7 190 4.0E-41
sp|A5ULM6|EF2_METS3 Elongation factor 2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fusA PE=3 SV=1 8 198 4.0E-41
sp|O59521|EF2_PYRHO Elongation factor 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fusA PE=1 SV=2 8 190 5.0E-41
sp|Q9V1Z8|EF2_PYRAB Elongation factor 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fusA PE=3 SV=1 8 190 5.0E-41
sp|A1RVX2|EF2_PYRIL Elongation factor 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fusA PE=3 SV=1 7 190 7.0E-41
sp|P26752|EF2_THEAC Elongation factor 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fusA PE=3 SV=2 7 190 1.0E-40
sp|B1YE08|EF2_PYRNV Elongation factor 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fusA PE=3 SV=1 7 190 1.0E-40
sp|Q6LXI2|EF2_METMP Elongation factor 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=fusA PE=3 SV=1 7 187 2.0E-40
sp|A9A9U4|EF2_METM6 Elongation factor 2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=fusA PE=3 SV=1 7 187 2.0E-40
sp|Q5JFZ3|EF2_THEKO Elongation factor 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fusA PE=3 SV=1 8 190 2.0E-40
sp|P09604|EF2_METVS Elongation factor 2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=fusA PE=3 SV=2 7 187 3.0E-40
sp|Q8ZZC1|EF2_PYRAE Elongation factor 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fusA PE=3 SV=1 7 190 3.0E-40
sp|A6VGV5|EF2_METM7 Elongation factor 2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=fusA PE=3 SV=1 7 187 3.0E-40
sp|Q979T3|EF2_THEVO Elongation factor 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fusA PE=3 SV=1 7 190 4.0E-40
sp|A4FWF0|EF2_METM5 Elongation factor 2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=fusA PE=3 SV=1 7 187 6.0E-40
sp|O94316|SN114_SCHPO Pre-mRNA-splicing factor cwf10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf10 PE=1 SV=2 507 1051 7.0E-40
sp|Q5UZS7|EF2_HALMA Elongation factor 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=fusA PE=3 SV=1 19 208 2.0E-39
sp|A4WMR8|EF2_PYRAR Elongation factor 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fusA PE=3 SV=1 7 190 3.0E-39
sp|O94316|SN114_SCHPO Pre-mRNA-splicing factor cwf10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf10 PE=1 SV=2 3 472 4.0E-39
sp|C6A4M0|EF2_THESM Elongation factor 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fusA PE=3 SV=1 12 194 4.0E-39
sp|A6UV44|EF2_META3 Elongation factor 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fusA PE=3 SV=1 7 187 4.0E-39
sp|Q3IUM4|EF2_NATPD Elongation factor 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fusA PE=3 SV=1 12 187 8.0E-39
sp|Q58448|EF2_METJA Elongation factor 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fusA PE=3 SV=1 8 187 8.0E-39
sp|C7NYH7|EF2_HALMD Elongation factor 2 OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=fusA PE=3 SV=1 11 208 1.0E-38
sp|A0RW30|EF2_CENSY Elongation factor 2 OS=Cenarchaeum symbiosum (strain A) GN=fusA PE=3 SV=1 5 194 1.0E-38
sp|Q6L200|EF2_PICTO Elongation factor 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fusA PE=3 SV=1 19 190 2.0E-38
sp|A4FUD3|U5S1_BOVIN 116 kDa U5 small nuclear ribonucleoprotein component OS=Bos taurus GN=EFTUD2 PE=2 SV=1 7 440 6.0E-38
sp|Q5F3X4|U5S1_CHICK 116 kDa U5 small nuclear ribonucleoprotein component OS=Gallus gallus GN=EFTUD2 PE=2 SV=1 9 440 6.0E-38
sp|B8D6B2|EF2_DESK1 Elongation factor 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=fusA PE=3 SV=1 19 194 6.0E-38
sp|O08810|U5S1_MOUSE 116 kDa U5 small nuclear ribonucleoprotein component OS=Mus musculus GN=Eftud2 PE=1 SV=1 9 440 7.0E-38
sp|Q9HM85|EF2_HALSA Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fusA PE=3 SV=2 19 187 8.0E-38
sp|B0R8C8|EF2_HALS3 Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=fusA PE=3 SV=1 19 187 8.0E-38
sp|Q15029|U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens GN=EFTUD2 PE=1 SV=1 9 440 9.0E-38
sp|Q5R6E0|U5S1_PONAB 116 kDa U5 small nuclear ribonucleoprotein component OS=Pongo abelii GN=EFTUD2 PE=2 SV=1 9 440 1.0E-37
sp|Q8TRC3|EF2_METAC Elongation factor 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fusA PE=3 SV=1 7 187 2.0E-37
sp|Q464Z3|EF2_METBF Elongation factor 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fusA PE=3 SV=1 7 203 4.0E-37
sp|A3CXM8|EF2_METMJ Elongation factor 2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fusA PE=3 SV=1 7 203 5.0E-37
sp|P33159|EF2_DESMO Elongation factor 2 OS=Desulfurococcus mobilis GN=fusA PE=3 SV=1 8 194 5.0E-37
sp|O93640|EF2_METTE Elongation factor 2 OS=Methanosarcina thermophila GN=fusA PE=3 SV=1 7 190 7.0E-37
sp|Q8PUR7|EF2_METMA Elongation factor 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fusA PE=3 SV=1 7 187 1.0E-36
sp|B8GJK8|EF2_METPE Elongation factor 2 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fusA PE=3 SV=1 7 187 3.0E-36
sp|A0B7D5|EF2_METTP Elongation factor 2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fusA PE=3 SV=1 7 190 2.0E-34
sp|Q74M52|EF2_NANEQ Elongation factor 2 OS=Nanoarchaeum equitans (strain Kin4-M) GN=fusA PE=3 SV=1 7 190 1.0E-33
sp|D3E3N9|EF2_METRM Elongation factor 2 OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=fusA PE=3 SV=1 8 238 1.0E-33
sp|Q2NEL0|EF2_METST Elongation factor 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fusA PE=3 SV=1 7 190 6.0E-33
sp|Q8TXJ4|EF2_METKA Elongation factor 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fusA PE=3 SV=1 32 187 4.0E-31
sp|Q8SQT7|EF2_ENCCU Elongation factor 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=EFT1 PE=1 SV=1 509 1019 7.0E-30
sp|Q47RQ0|LEPA_THEFY Elongation factor 4 OS=Thermobifida fusca (strain YX) GN=lepA PE=3 SV=1 19 201 6.0E-27
sp|Q5VQ69|GUF1_ORYSJ Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0144800 PE=3 SV=1 19 160 2.0E-26
sp|B8B2R1|GUF1_ORYSI Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_21607 PE=3 SV=1 19 160 3.0E-26
sp|C5Z3W1|GUF1_SORBI Translation factor GUF1 homolog, mitochondrial OS=Sorghum bicolor GN=Sb10g003070 PE=3 SV=1 19 160 4.0E-26
sp|C5CCD4|LEPA_MICLC Elongation factor 4 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=lepA PE=3 SV=1 19 159 6.0E-26
sp|B3ESU2|LEPA_AMOA5 Elongation factor 4 OS=Amoebophilus asiaticus (strain 5a2) GN=lepA PE=3 SV=1 17 159 6.0E-26
sp|P53530|LEPA_MYCLE Elongation factor 4 OS=Mycobacterium leprae (strain TN) GN=lepA PE=3 SV=1 19 159 8.0E-26
sp|B8ZUS2|LEPA_MYCLB Elongation factor 4 OS=Mycobacterium leprae (strain Br4923) GN=lepA PE=3 SV=1 19 159 8.0E-26
sp|Q74ZG2|GUF1_ASHGO Translation factor GUF1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GUF1 PE=3 SV=1 5 165 2.0E-25
sp|Q6BMV8|GUF1_DEBHA Translation factor GUF1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GUF1 PE=3 SV=2 18 159 2.0E-25
sp|B8DUL6|LEPA_BIFA0 Elongation factor 4 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=lepA PE=3 SV=1 19 159 3.0E-25
sp|Q9ZLZ3|TYPA_HELPJ GTP-binding protein TypA/BipA homolog OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=typA PE=3 SV=1 17 160 4.0E-25
sp|O25225|TYPA_HELPY GTP-binding protein TypA/BipA homolog OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=typA PE=3 SV=1 17 160 4.0E-25
sp|B2GHU9|LEPA_KOCRD Elongation factor 4 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=lepA PE=3 SV=1 19 200 5.0E-25
sp|Q0IFX5|GUF1_AEDAE Translation factor GUF1 homolog, mitochondrial OS=Aedes aegypti GN=AAEL003926 PE=3 SV=1 19 172 5.0E-25
sp|Q1D6M1|LEPA_MYXXD Elongation factor 4 OS=Myxococcus xanthus (strain DK 1622) GN=lepA PE=3 SV=1 15 159 5.0E-25
sp|Q82BZ3|LEPA_STRAW Elongation factor 4 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=lepA PE=3 SV=1 19 159 6.0E-25
sp|A3DF29|LEPA_CLOTH Elongation factor 4 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=lepA PE=3 SV=1 13 159 6.0E-25
sp|Q8C3X4|GUF1_MOUSE Translation factor Guf1, mitochondrial OS=Mus musculus GN=Guf1 PE=1 SV=1 18 171 7.0E-25
sp|C4Y8M4|GUF1_CLAL4 Translation factor GUF1, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=GUF1 PE=3 SV=1 18 159 7.0E-25
sp|P46943|GUF1_YEAST Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUF1 PE=1 SV=2 18 166 7.0E-25
sp|C8ZDQ3|GUF1_YEAS8 Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=GUF1 PE=3 SV=1 18 166 8.0E-25
sp|A7A1H2|GUF1_YEAS7 Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=GUF1 PE=3 SV=1 18 166 8.0E-25
sp|B3RHG9|GUF1_YEAS1 Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=GUF1 PE=3 SV=1 18 166 8.0E-25
sp|Q8G603|LEPA_BIFLO Elongation factor 4 OS=Bifidobacterium longum (strain NCC 2705) GN=lepA PE=3 SV=1 19 159 9.0E-25
sp|B3DSA9|LEPA_BIFLD Elongation factor 4 OS=Bifidobacterium longum (strain DJO10A) GN=lepA PE=3 SV=1 19 159 9.0E-25
sp|C5M6K8|GUF1_CANTT Translation factor GUF1, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=GUF1 PE=3 SV=1 18 159 9.0E-25
sp|B6K6L6|GUF1_SCHJY Translation factor guf1, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=guf1 PE=3 SV=1 18 159 1.0E-24
sp|A7TPD4|GUF1_VANPO Translation factor GUF1, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=GUF1 PE=3 SV=1 18 166 1.0E-24
sp|B2RKK1|LEPA_PORG3 Elongation factor 4 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=lepA PE=3 SV=1 17 159 1.0E-24
sp|Q7MV56|LEPA_PORGI Elongation factor 4 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lepA PE=3 SV=1 17 159 1.0E-24
sp|B7GRY7|LEPA_BIFLS Elongation factor 4 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=lepA PE=3 SV=1 19 159 1.0E-24
sp|A9S3D3|GUF1_PHYPA Translation factor GUF1 homolog, mitochondrial OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_180825 PE=3 SV=1 19 161 2.0E-24
sp|A6WDJ3|LEPA_KINRD Elongation factor 4 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=lepA PE=3 SV=1 19 180 2.0E-24
sp|O67618|LEPA_AQUAE Elongation factor 4 OS=Aquifex aeolicus (strain VF5) GN=lepA PE=1 SV=1 15 159 2.0E-24
sp|Q6AEB5|LEPA_LEIXX Elongation factor 4 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=lepA PE=3 SV=1 4 159 2.0E-24
sp|Q2JDK2|LEPA_FRASC Elongation factor 4 OS=Frankia sp. (strain CcI3) GN=lepA PE=3 SV=2 19 188 2.0E-24
sp|B9WBR8|GUF1_CANDC Translation factor GUF1, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=GUF1 PE=3 SV=1 18 159 2.0E-24
sp|Q3ATB2|LEPA_CHLCH Elongation factor 4 OS=Chlorobium chlorochromatii (strain CaD3) GN=lepA PE=3 SV=1 19 159 2.0E-24
sp|Q0RP81|LEPA_FRAAA Elongation factor 4 OS=Frankia alni (strain ACN14a) GN=lepA PE=3 SV=1 19 188 2.0E-24
sp|C1GX39|GUF1_PARBA Translation factor GUF1, mitochondrial OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=GUF1 PE=3 SV=2 19 159 2.0E-24
sp|D2VRR7|GUF1_NAEGR Translation factor GUF1 homolog, mitochondrial OS=Naegleria gruberi GN=NAEGRDRAFT_71680 PE=3 SV=1 19 160 2.0E-24
sp|Q7UX15|LEPA1_RHOBA Elongation factor 4 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lepA1 PE=3 SV=1 14 159 2.0E-24
sp|Q6CUH2|GUF1_KLULA Translation factor GUF1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GUF1 PE=3 SV=1 20 159 3.0E-24
sp|P60791|LEPA_MYCPA Elongation factor 4 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=lepA PE=3 SV=1 19 159 3.0E-24
sp|Q59P53|GUF1_CANAL Translation factor GUF1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GUF1 PE=3 SV=1 18 159 3.0E-24
sp|C5DN84|GUF1_LACTC Translation factor GUF1, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=GUF1 PE=3 SV=1 11 159 3.0E-24
sp|C0SHD5|GUF1_PARBP Translation factor GUF1, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb03) GN=GUF1 PE=3 SV=1 19 159 3.0E-24
sp|C1GGI6|GUF1_PARBD Translation factor GUF1, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=GUF1 PE=3 SV=1 19 159 3.0E-24
sp|B3EPG7|LEPA_CHLPB Elongation factor 4 OS=Chlorobium phaeobacteroides (strain BS1) GN=lepA PE=3 SV=1 19 159 3.0E-24
sp|A1R6W8|LEPA_ARTAT Elongation factor 4 OS=Arthrobacter aurescens (strain TC1) GN=lepA PE=3 SV=1 19 173 3.0E-24
sp|Q6A9B2|LEPA_PROAC Elongation factor 4 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=lepA PE=3 SV=1 19 159 3.0E-24
sp|C4YIT6|GUF1_CANAW Translation factor GUF1, mitochondrial OS=Candida albicans (strain WO-1) GN=GUF1 PE=3 SV=1 18 159 3.0E-24
sp|A6H1S4|LEPA_FLAPJ Elongation factor 4 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=lepA PE=3 SV=1 17 159 3.0E-24
sp|A0JX50|LEPA_ARTS2 Elongation factor 4 OS=Arthrobacter sp. (strain FB24) GN=lepA PE=3 SV=1 19 173 3.0E-24
sp|A5CR97|LEPA_CLAM3 Elongation factor 4 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=lepA PE=3 SV=1 19 159 3.0E-24
sp|A6LC18|LEPA_PARD8 Elongation factor 4 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lepA PE=3 SV=1 17 159 3.0E-24
sp|P60794|LEPA_TREDE Elongation factor 4 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=lepA PE=3 SV=1 18 159 3.0E-24
sp|O28385|EF2_ARCFU Elongation factor 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fusA PE=3 SV=1 515 1015 4.0E-24
sp|B8H8S3|LEPA_ARTCA Elongation factor 4 OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=lepA PE=3 SV=1 19 173 4.0E-24
sp|B0RCT0|LEPA_CLAMS Elongation factor 4 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=lepA PE=3 SV=1 19 159 4.0E-24
sp|A5DWY7|GUF1_LODEL Translation factor GUF1, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=GUF1 PE=3 SV=1 17 159 4.0E-24
sp|Q6AL53|LEPA_DESPS Elongation factor 4 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lepA PE=3 SV=1 17 159 5.0E-24
sp|Q8KCH0|LEPA_CHLTE Elongation factor 4 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lepA PE=3 SV=1 19 159 5.0E-24
sp|Q65H50|LEPA_BACLD Elongation factor 4 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=lepA PE=3 SV=1 12 159 5.0E-24
sp|C4Z9E3|LEPA_EUBR3 Elongation factor 4 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=lepA PE=3 SV=1 15 159 6.0E-24
sp|B3QZT9|LEPA_PHYMT Elongation factor 4 OS=Phytoplasma mali (strain AT) GN=lepA PE=3 SV=1 12 159 6.0E-24
sp|C5DWG7|GUF1_ZYGRC Translation factor GUF1, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=GUF1 PE=3 SV=1 5 159 6.0E-24
sp|A5FLU8|LEPA_FLAJ1 Elongation factor 4 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=lepA PE=3 SV=1 17 159 6.0E-24
sp|Q9FLE4|GUF1_ARATH Translation factor GUF1 homolog, mitochondrial OS=Arabidopsis thaliana GN=At5g39900 PE=2 SV=1 16 160 6.0E-24
sp|Q5YZZ7|LEPA_NOCFA Elongation factor 4 OS=Nocardia farcinica (strain IFM 10152) GN=lepA PE=3 SV=1 19 159 6.0E-24
sp|Q0SH84|LEPA_RHOJR Elongation factor 4 OS=Rhodococcus jostii (strain RHA1) GN=lepA PE=3 SV=1 19 159 6.0E-24
sp|B0WXB8|GUF1_CULQU Translation factor GUF1 homolog, mitochondrial OS=Culex quinquefasciatus GN=CPIJ012086 PE=3 SV=1 19 172 7.0E-24
sp|A4XKA0|LEPA_CALS8 Elongation factor 4 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=lepA PE=3 SV=1 12 159 7.0E-24
sp|B3QPU3|LEPA_CHLP8 Elongation factor 4 OS=Chlorobaculum parvum (strain NCIB 8327) GN=lepA PE=3 SV=1 19 159 8.0E-24
sp|Q9X1V8|LEPA_THEMA Elongation factor 4 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=lepA PE=3 SV=1 19 159 8.0E-24
sp|A5DG70|GUF1_PICGU Translation factor GUF1, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=GUF1 PE=3 SV=2 18 159 8.0E-24
sp|C1AUN7|LEPA_RHOOB Elongation factor 4 OS=Rhodococcus opacus (strain B4) GN=lepA PE=3 SV=1 19 159 8.0E-24
sp|B8I3E6|LEPA_CLOCE Elongation factor 4 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=lepA PE=3 SV=1 13 159 9.0E-24
sp|B4UDQ7|LEPA_ANASK Elongation factor 4 OS=Anaeromyxobacter sp. (strain K) GN=lepA PE=3 SV=1 12 159 1.0E-23
sp|Q8N442|GUF1_HUMAN Translation factor GUF1, mitochondrial OS=Homo sapiens GN=GUF1 PE=1 SV=1 18 171 1.0E-23
sp|B8JAF3|LEPA_ANAD2 Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=lepA PE=3 SV=1 12 159 1.0E-23
sp|Q2IIA6|LEPA_ANADE Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lepA PE=3 SV=1 12 159 1.0E-23
sp|P9WK97|LEPA_MYCTU Elongation factor 4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lepA PE=1 SV=1 19 159 1.0E-23
sp|P9WK96|LEPA_MYCTO Elongation factor 4 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lepA PE=3 SV=1 19 159 1.0E-23
sp|A5U598|LEPA_MYCTA Elongation factor 4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=lepA PE=3 SV=1 19 159 1.0E-23
sp|C1AQW9|LEPA_MYCBT Elongation factor 4 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=lepA PE=3 SV=1 19 159 1.0E-23
sp|A1KL96|LEPA_MYCBP Elongation factor 4 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=lepA PE=3 SV=1 19 159 1.0E-23
sp|P65270|LEPA_MYCBO Elongation factor 4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lepA PE=3 SV=1 19 159 1.0E-23
sp|B9RUN8|GUF1_RICCO Translation factor GUF1 homolog, mitochondrial OS=Ricinus communis GN=RCOM_0855130 PE=3 SV=1 19 160 1.0E-23
sp|C4Z541|LEPA_EUBE2 Elongation factor 4 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=lepA PE=3 SV=1 15 159 1.0E-23
sp|Q2LTN3|LEPA_SYNAS Elongation factor 4 OS=Syntrophus aciditrophicus (strain SB) GN=lepA PE=3 SV=1 19 188 1.0E-23
sp|B7PJS6|GUF1_IXOSC Translation factor GUF1 homolog, mitochondrial OS=Ixodes scapularis GN=ISCW003920 PE=3 SV=1 18 159 1.0E-23
sp|B0S1G2|LEPA_FINM2 Elongation factor 4 OS=Finegoldia magna (strain ATCC 29328) GN=lepA PE=3 SV=1 12 159 1.0E-23
sp|Q2RKX8|LEPA_MOOTA Elongation factor 4 OS=Moorella thermoacetica (strain ATCC 39073) GN=lepA PE=3 SV=1 15 159 1.0E-23
sp|Q9RDC9|LEPA_STRCO Elongation factor 4 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lepA PE=3 SV=1 19 159 1.0E-23
sp|O07631|TYPA_BACSU GTP-binding protein TypA/BipA homolog OS=Bacillus subtilis (strain 168) GN=typA PE=3 SV=1 18 224 1.0E-23
sp|Q8AA33|LEPA_BACTN Elongation factor 4 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lepA PE=3 SV=1 17 159 2.0E-23
sp|Q11UD0|LEPA_CYTH3 Elongation factor 4 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=lepA PE=3 SV=1 18 159 2.0E-23
sp|B0K3Y4|LEPA_THEPX Elongation factor 4 OS=Thermoanaerobacter sp. (strain X514) GN=lepA PE=3 SV=1 19 200 2.0E-23
sp|P37949|LEPA_BACSU Elongation factor 4 OS=Bacillus subtilis (strain 168) GN=lepA PE=3 SV=2 12 159 2.0E-23
sp|B0KA85|LEPA_THEP3 Elongation factor 4 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lepA PE=3 SV=1 19 200 2.0E-23
sp|O51115|LEPA_BORBU Elongation factor 4 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=lepA PE=3 SV=2 20 159 2.0E-23
sp|P72749|TYPA_SYNY3 GTP-binding protein TypA/BipA homolog OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=typA PE=3 SV=1 19 160 2.0E-23
sp|A2QU25|GUF1_ASPNC Translation factor guf1, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=guf1 PE=3 SV=1 20 159 2.0E-23
sp|A7Z6W5|LEPA_BACMF Elongation factor 4 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=lepA PE=3 SV=1 12 159 2.0E-23
sp|Q0ICF2|LEPA_SYNS3 Elongation factor 4 OS=Synechococcus sp. (strain CC9311) GN=lepA PE=3 SV=1 19 159 2.0E-23
sp|Q0SP76|LEPA_BORAP Elongation factor 4 OS=Borrelia afzelii (strain PKo) GN=lepA PE=3 SV=1 20 159 2.0E-23
sp|A7HCF3|LEPA_ANADF Elongation factor 4 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lepA PE=3 SV=1 19 159 2.0E-23
sp|Q8K9C8|TYPA_BUCAP GTP-binding protein TypA/BipA homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=typA PE=3 SV=1 17 160 2.0E-23
sp|B2G6W5|LEPA_LACRJ Elongation factor 4 OS=Lactobacillus reuteri (strain JCM 1112) GN=lepA PE=3 SV=1 8 159 2.0E-23
sp|A5VJE9|LEPA_LACRD Elongation factor 4 OS=Lactobacillus reuteri (strain DSM 20016) GN=lepA PE=3 SV=1 8 159 2.0E-23
sp|A0M6M2|LEPA_GRAFK Elongation factor 4 OS=Gramella forsetii (strain KT0803) GN=lepA PE=3 SV=1 17 159 2.0E-23
sp|A2BV79|LEPA_PROM5 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9515) GN=lepA PE=3 SV=1 19 159 2.0E-23
sp|Q7V2Q1|LEPA_PROMP Elongation factor 4 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=lepA PE=3 SV=1 19 159 2.0E-23
sp|B3EE17|LEPA_CHLL2 Elongation factor 4 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=lepA PE=3 SV=1 20 159 2.0E-23
sp|B2GBR9|LEPA_LACF3 Elongation factor 4 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=lepA PE=3 SV=1 13 159 3.0E-23
sp|C8VPJ1|GUF1_EMENI Translation factor guf1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=guf1 PE=3 SV=1 20 159 3.0E-23
sp|A2BPP8|LEPA_PROMS Elongation factor 4 OS=Prochlorococcus marinus (strain AS9601) GN=lepA PE=3 SV=1 19 159 3.0E-23
sp|Q31CB8|LEPA_PROM9 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9312) GN=lepA PE=3 SV=1 19 159 3.0E-23
sp|A8G3D2|LEPA_PROM2 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9215) GN=lepA PE=3 SV=1 19 159 3.0E-23
sp|A4S3R2|GUF1_OSTLU Translation factor GUF1 homolog, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_88434 PE=3 SV=1 20 159 3.0E-23
sp|Q6FR62|GUF1_CANGA Translation factor GUF1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GUF1 PE=3 SV=1 18 171 3.0E-23
sp|A9A0N0|LEPA_DESOH Elongation factor 4 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=lepA PE=3 SV=1 19 188 3.0E-23
sp|A3PBD8|LEPA_PROM0 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9301) GN=lepA PE=3 SV=1 19 159 3.0E-23
sp|B1VGK6|LEPA_CORU7 Elongation factor 4 OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=lepA PE=3 SV=1 19 173 3.0E-23
sp|B9MJZ5|LEPA_CALBD Elongation factor 4 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=lepA PE=3 SV=1 12 159 3.0E-23
sp|Q67S76|LEPA_SYMTH Elongation factor 4 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=lepA PE=3 SV=1 16 159 3.0E-23
sp|A8FFD6|LEPA_BACP2 Elongation factor 4 OS=Bacillus pumilus (strain SAFR-032) GN=lepA PE=3 SV=1 12 159 3.0E-23
sp|Q97JJ6|LEPA_CLOAB Elongation factor 4 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lepA PE=3 SV=1 13 159 4.0E-23
sp|B4S9B7|LEPA_PROA2 Elongation factor 4 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=lepA PE=3 SV=1 19 159 4.0E-23
sp|A6QLJ3|GUF1_BOVIN Translation factor GUF1, mitochondrial OS=Bos taurus GN=GUF1 PE=2 SV=1 18 188 4.0E-23
sp|B1VY28|LEPA_STRGG Elongation factor 4 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=lepA PE=3 SV=1 19 159 4.0E-23
sp|B9KD01|LEPA_CAMLR Elongation factor 4 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=lepA PE=3 SV=1 17 159 4.0E-23
sp|Q64T74|LEPA_BACFR Elongation factor 4 OS=Bacteroides fragilis (strain YCH46) GN=lepA PE=3 SV=1 19 159 4.0E-23
sp|Q5LC85|LEPA_BACFN Elongation factor 4 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=lepA PE=3 SV=1 19 159 4.0E-23
sp|B4SBG4|LEPA_PELPB Elongation factor 4 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=lepA PE=3 SV=1 19 159 4.0E-23
sp|Q7UE01|LEPA2_RHOBA Elongation factor 4 2 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lepA2 PE=3 SV=1 17 159 4.0E-23
sp|Q81LR7|LEPA_BACAN Elongation factor 4 OS=Bacillus anthracis GN=lepA PE=3 SV=1 13 159 4.0E-23
sp|C3P8M5|LEPA_BACAA Elongation factor 4 OS=Bacillus anthracis (strain A0248) GN=lepA PE=3 SV=1 13 159 4.0E-23
sp|B7GKC4|LEPA_ANOFW Elongation factor 4 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=lepA PE=3 SV=1 12 159 4.0E-23
sp|A5N6L8|LEPA_CLOK5 Elongation factor 4 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=lepA PE=3 SV=1 13 159 4.0E-23
sp|A5GMR2|LEPA_SYNPW Elongation factor 4 OS=Synechococcus sp. (strain WH7803) GN=lepA PE=3 SV=1 19 159 4.0E-23
sp|Q00ZZ1|GUF1_OSTTA Translation factor GUF1 homolog, mitochondrial OS=Ostreococcus tauri GN=Ot10g01840 PE=3 SV=1 20 159 5.0E-23
sp|B6QW35|GUF1_TALMQ Translation factor guf1, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=guf1 PE=3 SV=1 19 159 5.0E-23
sp|A7GT14|LEPA_BACCN Elongation factor 4 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=lepA PE=3 SV=1 13 159 5.0E-23
sp|B8MS24|GUF1_TALSN Translation factor guf1, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=guf1 PE=3 SV=1 19 159 5.0E-23
sp|B1YKS5|LEPA_EXIS2 Elongation factor 4 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=lepA PE=3 SV=1 12 159 5.0E-23
sp|Q662S4|LEPA_BORBP Elongation factor 4 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=lepA PE=3 SV=1 20 159 5.0E-23
sp|Q0V3J4|GUF1_PHANO Translation factor GUF1, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=GUF1 PE=3 SV=2 20 159 5.0E-23
sp|Q89BJ8|LEPA_BRADU Elongation factor 4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=lepA PE=3 SV=2 18 188 5.0E-23
sp|A1D5Z0|GUF1_NEOFI Translation factor guf1, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=guf1 PE=3 SV=1 20 159 6.0E-23
sp|Q2U3T4|GUF1_ASPOR Translation factor guf1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=guf1 PE=3 SV=1 20 200 6.0E-23
sp|Q31R08|LEPA_SYNE7 Elongation factor 4 OS=Synechococcus elongatus (strain PCC 7942) GN=lepA PE=3 SV=1 19 159 6.0E-23
sp|B0XZZ2|GUF1_ASPFC Translation factor guf1, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=guf1 PE=3 SV=2 20 159 6.0E-23
sp|C5JRK2|GUF1_AJEDS Translation factor GUF1, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=GUF1 PE=3 SV=1 19 159 6.0E-23
sp|C5GRI9|GUF1_AJEDR Translation factor GUF1, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=GUF1 PE=3 SV=1 19 159 6.0E-23
sp|Q4WYV0|GUF1_ASPFU Translation factor guf1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=guf1 PE=3 SV=2 20 159 6.0E-23
sp|Q1B684|LEPA_MYCSS Elongation factor 4 OS=Mycobacterium sp. (strain MCS) GN=lepA PE=3 SV=1 19 159 6.0E-23
sp|A1UIU2|LEPA_MYCSK Elongation factor 4 OS=Mycobacterium sp. (strain KMS) GN=lepA PE=3 SV=1 19 159 6.0E-23
sp|A3Q2A6|LEPA_MYCSJ Elongation factor 4 OS=Mycobacterium sp. (strain JLS) GN=lepA PE=3 SV=1 19 159 6.0E-23
sp|B0VCT7|LEPA_ACIBY Elongation factor 4 OS=Acinetobacter baumannii (strain AYE) GN=lepA PE=3 SV=1 17 159 6.0E-23
sp|A3M7P5|LEPA_ACIBT Elongation factor 4 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=lepA PE=3 SV=2 17 159 6.0E-23
sp|B2HWQ2|LEPA_ACIBC Elongation factor 4 OS=Acinetobacter baumannii (strain ACICU) GN=lepA PE=3 SV=1 17 159 6.0E-23
sp|B7I580|LEPA_ACIB5 Elongation factor 4 OS=Acinetobacter baumannii (strain AB0057) GN=lepA PE=3 SV=1 17 159 6.0E-23
sp|B7GYS7|LEPA_ACIB3 Elongation factor 4 OS=Acinetobacter baumannii (strain AB307-0294) GN=lepA PE=3 SV=1 17 159 6.0E-23
sp|C6HPI9|GUF1_AJECH Translation factor GUF1, mitochondrial OS=Ajellomyces capsulatus (strain H143) GN=GUF1 PE=3 SV=2 19 159 6.0E-23
sp|A8MFA6|LEPA_ALKOO Elongation factor 4 OS=Alkaliphilus oremlandii (strain OhILAs) GN=lepA PE=3 SV=1 15 159 6.0E-23
sp|Q0CS42|GUF1_ASPTN Translation factor guf1, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=guf1 PE=3 SV=1 20 159 6.0E-23
sp|C0NZL9|GUF1_AJECG Translation factor GUF1, mitochondrial OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=GUF1 PE=3 SV=1 19 159 7.0E-23
sp|A1CLD7|GUF1_ASPCL Translation factor guf1, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=guf1 PE=3 SV=1 20 159 7.0E-23
sp|Q9KD76|LEPA_BACHD Elongation factor 4 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lepA PE=3 SV=1 12 159 7.0E-23
sp|B7HCU5|LEPA_BACC4 Elongation factor 4 OS=Bacillus cereus (strain B4264) GN=lepA PE=3 SV=1 13 159 7.0E-23
sp|B7IYH2|LEPA_BACC2 Elongation factor 4 OS=Bacillus cereus (strain G9842) GN=lepA PE=3 SV=1 13 159 7.0E-23
sp|Q730L6|LEPA_BACC1 Elongation factor 4 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=lepA PE=3 SV=1 13 159 7.0E-23
sp|Q6F9B9|LEPA_ACIAD Elongation factor 4 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lepA PE=3 SV=1 17 159 7.0E-23
sp|B0VTM2|LEPA_ACIBS Elongation factor 4 OS=Acinetobacter baumannii (strain SDF) GN=lepA PE=3 SV=1 17 159 7.0E-23
sp|Q5WHG5|LEPA_BACSK Elongation factor 4 OS=Bacillus clausii (strain KSM-K16) GN=lepA PE=3 SV=1 12 159 7.0E-23
sp|Q818E4|LEPA_BACCR Elongation factor 4 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=lepA PE=3 SV=1 13 159 7.0E-23
sp|B9IY86|LEPA_BACCQ Elongation factor 4 OS=Bacillus cereus (strain Q1) GN=lepA PE=3 SV=1 13 159 7.0E-23
sp|C3L5S2|LEPA_BACAC Elongation factor 4 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=lepA PE=3 SV=1 13 159 7.0E-23
sp|B7HPL8|LEPA_BACC7 Elongation factor 4 OS=Bacillus cereus (strain AH187) GN=lepA PE=3 SV=1 13 159 7.0E-23
sp|B7JNV1|LEPA_BACC0 Elongation factor 4 OS=Bacillus cereus (strain AH820) GN=lepA PE=3 SV=1 13 159 7.0E-23
sp|Q6HDK2|LEPA_BACHK Elongation factor 4 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=lepA PE=3 SV=1 13 159 7.0E-23
sp|Q634M2|LEPA_BACCZ Elongation factor 4 OS=Bacillus cereus (strain ZK / E33L) GN=lepA PE=3 SV=1 13 159 7.0E-23
sp|C1ESL3|LEPA_BACC3 Elongation factor 4 OS=Bacillus cereus (strain 03BB102) GN=lepA PE=3 SV=1 13 159 7.0E-23
sp|A0RIT7|LEPA_BACAH Elongation factor 4 OS=Bacillus thuringiensis (strain Al Hakam) GN=lepA PE=3 SV=1 13 159 7.0E-23
sp|A6L744|LEPA_BACV8 Elongation factor 4 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=lepA PE=3 SV=1 17 159 7.0E-23
sp|A6RGX9|GUF1_AJECN Translation factor GUF1, mitochondrial OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=GUF1 PE=3 SV=2 19 159 8.0E-23
sp|Q5ZUD2|LEPA_LEGPH Elongation factor 4 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lepA PE=3 SV=1 7 159 8.0E-23
sp|A5ID24|LEPA_LEGPC Elongation factor 4 OS=Legionella pneumophila (strain Corby) GN=lepA PE=3 SV=1 7 159 8.0E-23
sp|Q5X443|LEPA_LEGPA Elongation factor 4 OS=Legionella pneumophila (strain Paris) GN=lepA PE=3 SV=1 7 159 8.0E-23
sp|Q46GZ6|LEPA_PROMT Elongation factor 4 OS=Prochlorococcus marinus (strain NATL2A) GN=lepA PE=3 SV=1 19 159 8.0E-23
sp|Q7U5L9|LEPA_SYNPX Elongation factor 4 OS=Synechococcus sp. (strain WH8102) GN=lepA PE=3 SV=1 19 188 8.0E-23
sp|Q5WVI1|LEPA_LEGPL Elongation factor 4 OS=Legionella pneumophila (strain Lens) GN=lepA PE=3 SV=1 7 159 8.0E-23
sp|A1BHJ8|LEPA_CHLPD Elongation factor 4 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=lepA PE=3 SV=1 19 159 8.0E-23
sp|C5FMX6|GUF1_ARTOC Translation factor GUF1, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=GUF1 PE=3 SV=2 20 159 8.0E-23
sp|C4L433|LEPA_EXISA Elongation factor 4 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=lepA PE=3 SV=1 12 159 9.0E-23
sp|A9VHU6|LEPA_BACWK Elongation factor 4 OS=Bacillus weihenstephanensis (strain KBAB4) GN=lepA PE=3 SV=1 13 159 9.0E-23
sp|A2C0M8|LEPA_PROM1 Elongation factor 4 OS=Prochlorococcus marinus (strain NATL1A) GN=lepA PE=3 SV=1 19 159 9.0E-23
sp|B2J0M4|LEPA_NOSP7 Elongation factor 4 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=lepA PE=3 SV=1 19 159 9.0E-23
sp|A4YCV9|EF2_METS5 Elongation factor 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=fusA PE=3 SV=1 506 1027 1.0E-22
sp|P60931|LEPA_CORDI Elongation factor 4 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=lepA PE=3 SV=1 17 173 1.0E-22
sp|B2S3A4|LEPA_TREPS Elongation factor 4 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=lepA PE=3 SV=1 17 159 1.0E-22
sp|O83523|LEPA_TREPA Elongation factor 4 OS=Treponema pallidum (strain Nichols) GN=lepA PE=3 SV=1 17 159 1.0E-22
sp|Q892Q6|LEPA_CLOTE Elongation factor 4 OS=Clostridium tetani (strain Massachusetts / E88) GN=lepA PE=3 SV=2 13 159 1.0E-22
sp|B0CS18|GUF1_LACBS Translation factor GUF1, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=GUF1 PE=3 SV=1 20 159 1.0E-22
sp|A6TSM4|LEPA_ALKMQ Elongation factor 4 OS=Alkaliphilus metalliredigens (strain QYMF) GN=lepA PE=3 SV=1 15 159 1.0E-22
sp|A2CBG9|LEPA_PROM3 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9303) GN=lepA PE=3 SV=1 19 188 1.0E-22
sp|P60930|LEPA_BDEBA Elongation factor 4 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lepA PE=3 SV=2 19 159 1.0E-22
sp|Q3ALG5|LEPA_SYNSC Elongation factor 4 OS=Synechococcus sp. (strain CC9605) GN=lepA PE=3 SV=1 19 188 1.0E-22
sp|Q9VRH6|GUF1_DROME Translation factor waclaw, mitochondrial OS=Drosophila melanogaster GN=waw PE=3 SV=2 19 180 1.0E-22
sp|Q8YU48|LEPA_NOSS1 Elongation factor 4 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=lepA PE=3 SV=1 19 159 1.0E-22
sp|Q182F4|LEPA_PEPD6 Elongation factor 4 OS=Peptoclostridium difficile (strain 630) GN=lepA PE=3 SV=1 13 159 1.0E-22
sp|Q3MG20|LEPA_ANAVT Elongation factor 4 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=lepA PE=3 SV=1 19 159 1.0E-22
sp|Q88VN0|LEPA1_LACPL Elongation factor 4 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lepA1 PE=3 SV=1 11 159 1.0E-22
sp|A8AWG3|LEPA_STRGC Elongation factor 4 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=lepA PE=3 SV=1 8 159 1.0E-22
sp|Q7V8S4|LEPA_PROMM Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9313) GN=lepA PE=3 SV=1 19 188 1.0E-22
sp|Q1QR19|LEPA_NITHX Elongation factor 4 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=lepA PE=3 SV=1 18 159 1.0E-22
sp|Q72E76|LEPA_DESVH Elongation factor 4 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=lepA PE=3 SV=1 19 159 1.0E-22
sp|A7GHI0|LEPA_CLOBL Elongation factor 4 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=lepA PE=3 SV=1 13 159 1.0E-22
sp|B1ILM7|LEPA_CLOBK Elongation factor 4 OS=Clostridium botulinum (strain Okra / Type B1) GN=lepA PE=3 SV=1 13 159 1.0E-22
sp|P34617|GUF1_CAEEL Translation factor GUF1 homolog, mitochondrial OS=Caenorhabditis elegans GN=ZK1236.1 PE=3 SV=2 6 159 1.0E-22
sp|C5PCH4|GUF1_COCP7 Translation factor GUF1, mitochondrial OS=Coccidioides posadasii (strain C735) GN=GUF1 PE=3 SV=1 19 159 2.0E-22
sp|B9E6X5|LEPA_MACCJ Elongation factor 4 OS=Macrococcus caseolyticus (strain JCSC5402) GN=lepA PE=3 SV=1 12 159 2.0E-22
sp|B1V9C5|LEPA_PHYAS Elongation factor 4 OS=Phytoplasma australiense GN=lepA PE=3 SV=1 13 159 2.0E-22
sp|C0M8H9|LEPA_STRE4 Elongation factor 4 OS=Streptococcus equi subsp. equi (strain 4047) GN=lepA PE=3 SV=1 12 159 2.0E-22
sp|B4U3G9|LEPA_STREM Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=lepA PE=3 SV=1 12 159 2.0E-22
sp|A5G4G3|LEPA_GEOUR Elongation factor 4 OS=Geobacter uraniireducens (strain Rf4) GN=lepA PE=3 SV=1 18 159 2.0E-22
sp|C1FVU4|LEPA_CLOBJ Elongation factor 4 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=lepA PE=3 SV=1 19 159 2.0E-22
sp|C7ZA26|GUF1_NECH7 Translation factor GUF1, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=GUF1 PE=3 SV=1 20 159 2.0E-22
sp|A5D3X6|LEPA_PELTS Elongation factor 4 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=lepA PE=3 SV=1 19 258 2.0E-22
sp|B2USI5|LEPA_HELPS Elongation factor 4 OS=Helicobacter pylori (strain Shi470) GN=lepA PE=3 SV=1 17 159 2.0E-22
sp|A4J7F8|LEPA_DESRM Elongation factor 4 OS=Desulfotomaculum reducens (strain MI-1) GN=lepA PE=3 SV=1 15 159 2.0E-22
sp|B0G189|GUF1_DICDI Translation factor GUF1 homolog, mitochondrial OS=Dictyostelium discoideum GN=guf1 PE=3 SV=1 3 159 2.0E-22
sp|Q7M8H5|LEPA_WOLSU Elongation factor 4 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=lepA PE=3 SV=1 17 159 2.0E-22
sp|Q8RB72|LEPA_CALS4 Elongation factor 4 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=lepA PE=3 SV=1 12 159 2.0E-22
sp|Q01SV7|LEPA_SOLUE Elongation factor 4 OS=Solibacter usitatus (strain Ellin6076) GN=lepA PE=3 SV=1 19 188 2.0E-22
sp|Q7VDF7|LEPA_PROMA Elongation factor 4 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=lepA PE=3 SV=1 19 159 2.0E-22
sp|Q30XI4|LEPA_DESAG Elongation factor 4 OS=Desulfovibrio alaskensis (strain G20) GN=lepA PE=3 SV=1 12 159 2.0E-22
sp|Q3SVT1|LEPA_NITWN Elongation factor 4 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lepA PE=3 SV=1 18 159 2.0E-22
sp|Q3B2V1|LEPA_CHLL7 Elongation factor 4 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lepA PE=3 SV=1 19 159 2.0E-22
sp|A9BE39|LEPA_PROM4 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9211) GN=lepA PE=3 SV=1 19 188 2.0E-22
sp|Q3A445|LEPA_PELCD Elongation factor 4 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lepA PE=3 SV=1 19 159 2.0E-22
sp|C3L3H1|LEPA_CLOB6 Elongation factor 4 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=lepA PE=3 SV=1 13 159 2.0E-22
sp|A5I644|LEPA_CLOBH Elongation factor 4 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=lepA PE=3 SV=1 13 159 2.0E-22
sp|A7FXL9|LEPA_CLOB1 Elongation factor 4 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=lepA PE=3 SV=1 13 159 2.0E-22
sp|C4JWU3|GUF1_UNCRE Translation factor GUF1, mitochondrial OS=Uncinocarpus reesii (strain UAMH 1704) GN=GUF1 PE=3 SV=1 20 159 2.0E-22
sp|Q3AWX3|LEPA_SYNS9 Elongation factor 4 OS=Synechococcus sp. (strain CC9902) GN=lepA PE=3 SV=1 19 188 2.0E-22
sp|B1KZP1|LEPA_CLOBM Elongation factor 4 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=lepA PE=3 SV=1 13 159 2.0E-22
sp|Q5XCD2|LEPA_STRP6 Elongation factor 4 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=lepA PE=3 SV=1 12 159 3.0E-22
sp|B8HLK8|LEPA_CYAP4 Elongation factor 4 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=lepA PE=3 SV=1 19 258 3.0E-22
sp|B3RXR7|GUF1_TRIAD Translation factor GUF1 homolog, mitochondrial OS=Trichoplax adhaerens GN=TRIADDRAFT_56304 PE=3 SV=1 19 159 3.0E-22
sp|B1MW21|EFG_LEUCK Elongation factor G OS=Leuconostoc citreum (strain KM20) GN=fusA PE=3 SV=1 20 299 3.0E-22
sp|A9RFQ5|GUFP_PHYPA Translation factor GUF1 homolog, chloroplastic OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_158777 PE=3 SV=1 18 159 3.0E-22
sp|Q5N390|LEPA_SYNP6 Elongation factor 4 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=lepA PE=3 SV=2 19 159 3.0E-22
sp|Q7VRQ8|LEPA_BLOFL Elongation factor 4 OS=Blochmannia floridanus GN=lepA PE=3 SV=1 19 171 3.0E-22
sp|Q6C255|GUF1_YARLI Translation factor GUF1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GUF1 PE=3 SV=1 20 168 3.0E-22
sp|A5B4D2|GUFP_VITVI Translation factor GUF1 homolog, chloroplastic OS=Vitis vinifera GN=VITISV_013255 PE=3 SV=1 18 159 3.0E-22
sp|Q5KWZ3|LEPA_GEOKA Elongation factor 4 OS=Geobacillus kaustophilus (strain HTA426) GN=lepA PE=3 SV=1 12 159 3.0E-22
sp|A4SFN5|LEPA_CHLPM Elongation factor 4 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=lepA PE=3 SV=1 19 159 3.0E-22
sp|B8J444|LEPA_DESDA Elongation factor 4 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=lepA PE=3 SV=1 15 159 3.0E-22
sp|P0DC23|LEPA_STRPQ Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=lepA PE=3 SV=1 12 210 3.0E-22
sp|P0DC22|LEPA_STRP3 Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=lepA PE=3 SV=1 12 210 3.0E-22
sp|Q1AU26|EFG_RUBXD Elongation factor G OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=fusA PE=3 SV=1 17 161 3.0E-22
sp|Q9ZM93|LEPA_HELPJ Elongation factor 4 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lepA PE=3 SV=1 17 159 3.0E-22
sp|B9DSE0|LEPA_STRU0 Elongation factor 4 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=lepA PE=3 SV=1 12 159 3.0E-22
sp|Q48TU0|LEPA_STRPM Elongation factor 4 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=lepA PE=3 SV=1 12 159 3.0E-22
sp|Q1JH37|LEPA_STRPD Elongation factor 4 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=lepA PE=3 SV=1 12 159 3.0E-22
sp|Q1JLY8|LEPA_STRPC Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=lepA PE=3 SV=1 12 159 3.0E-22
sp|Q3AF13|LEPA_CARHZ Elongation factor 4 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=lepA PE=3 SV=1 19 188 3.0E-22
sp|B5XLC6|LEPA_STRPZ Elongation factor 4 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=lepA PE=3 SV=1 12 159 3.0E-22
sp|Q99ZV8|LEPA_STRP1 Elongation factor 4 OS=Streptococcus pyogenes serotype M1 GN=lepA PE=3 SV=1 12 159 3.0E-22
sp|Q4JWS1|LEPA_CORJK Elongation factor 4 OS=Corynebacterium jeikeium (strain K411) GN=lepA PE=3 SV=1 19 159 3.0E-22
sp|C0MDV7|LEPA_STRS7 Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=lepA PE=3 SV=1 12 159 3.0E-22
sp|B1X3K4|GUFP_PAUCH Translation factor GUF1 homolog, organellar chromatophore OS=Paulinella chromatophora GN=lepA PE=3 SV=1 19 159 3.0E-22
sp|P65274|LEPA_STRA5 Elongation factor 4 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=lepA PE=3 SV=1 12 159 3.0E-22
sp|P65273|LEPA_STRA3 Elongation factor 4 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=lepA PE=3 SV=1 12 159 3.0E-22
sp|Q3K1F9|LEPA_STRA1 Elongation factor 4 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=lepA PE=3 SV=1 12 159 3.0E-22
sp|Q03KW7|LEPA_STRTD Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=lepA PE=3 SV=1 13 159 4.0E-22
sp|Q5M008|LEPA_STRT1 Elongation factor 4 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=lepA PE=3 SV=1 13 159 4.0E-22
sp|Q17X87|LEPA_HELAH Elongation factor 4 OS=Helicobacter acinonychis (strain Sheeba) GN=lepA PE=3 SV=1 17 159 4.0E-22
sp|B3PLU0|LEPA_MYCA5 Elongation factor 4 OS=Mycoplasma arthritidis (strain 158L3-1) GN=lepA PE=3 SV=1 19 159 4.0E-22
sp|Q89AC9|TYPA_BUCBP GTP-binding protein TypA/BipA homolog OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=typA PE=3 SV=2 13 160 4.0E-22
sp|Q5M4M2|LEPA_STRT2 Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=lepA PE=3 SV=1 13 159 4.0E-22
sp|B5ZAB8|LEPA_HELPG Elongation factor 4 OS=Helicobacter pylori (strain G27) GN=lepA PE=3 SV=1 17 159 4.0E-22
sp|A0L631|LEPA_MAGMM Elongation factor 4 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lepA PE=3 SV=1 19 188 4.0E-22
sp|B1I6E0|LEPA_DESAP Elongation factor 4 OS=Desulforudis audaxviator (strain MP104C) GN=lepA PE=3 SV=1 19 200 4.0E-22
sp|A4VUL8|LEPA_STRSY Elongation factor 4 OS=Streptococcus suis (strain 05ZYH33) GN=lepA PE=3 SV=1 8 159 4.0E-22
sp|A4W0W0|LEPA_STRS2 Elongation factor 4 OS=Streptococcus suis (strain 98HAH33) GN=lepA PE=3 SV=1 8 159 4.0E-22
sp|Q112D2|LEPA_TRIEI Elongation factor 4 OS=Trichodesmium erythraeum (strain IMS101) GN=lepA PE=3 SV=1 19 159 4.0E-22
sp|Q1JC06|LEPA_STRPB Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=lepA PE=3 SV=1 12 159 4.0E-22
sp|B6K286|EFGM_SCHJY Elongation factor G, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mef1 PE=3 SV=1 19 161 4.0E-22
sp|Q1J6V6|LEPA_STRPF Elongation factor 4 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=lepA PE=3 SV=1 12 159 4.0E-22
sp|B1IC02|LEPA_STRPI Elongation factor 4 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=lepA PE=3 SV=1 8 159 5.0E-22
sp|A8XT37|GUF1_CAEBR Translation factor GUF1 homolog, mitochondrial OS=Caenorhabditis briggsae GN=CBG18137 PE=3 SV=1 6 159 5.0E-22
sp|Q2GD00|LEPA_NEOSM Elongation factor 4 OS=Neorickettsia sennetsu (strain Miyayama) GN=lepA PE=3 SV=1 17 159 5.0E-22
sp|B8DIZ5|LEPA_DESVM Elongation factor 4 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=lepA PE=3 SV=1 19 159 5.0E-22
sp|Q0TNS2|LEPA_CLOP1 Elongation factor 4 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=lepA PE=3 SV=1 15 159 5.0E-22
sp|A9KKU4|LEPA_CLOPH Elongation factor 4 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=lepA PE=3 SV=1 19 159 5.0E-22
sp|Q0SRD8|LEPA_CLOPS Elongation factor 4 OS=Clostridium perfringens (strain SM101 / Type A) GN=lepA PE=3 SV=1 15 159 5.0E-22
sp|Q8XIS6|LEPA_CLOPE Elongation factor 4 OS=Clostridium perfringens (strain 13 / Type A) GN=lepA PE=3 SV=1 15 159 5.0E-22
sp|Q8FNA3|LEPA_COREF Elongation factor 4 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=lepA PE=3 SV=1 19 159 5.0E-22
sp|P60792|LEPA_ONYPE Elongation factor 4 OS=Onion yellows phytoplasma (strain OY-M) GN=lepA PE=3 SV=1 13 159 5.0E-22
sp|Q8Y742|LEPA_LISMO Elongation factor 4 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lepA PE=3 SV=1 12 159 5.0E-22
sp|B8DE32|LEPA_LISMH Elongation factor 4 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=lepA PE=3 SV=1 12 159 5.0E-22
sp|Q71ZJ1|LEPA_LISMF Elongation factor 4 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=lepA PE=3 SV=1 12 159 5.0E-22
sp|C1KVC6|LEPA_LISMC Elongation factor 4 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=lepA PE=3 SV=1 12 159 5.0E-22
sp|B6JKS8|LEPA_HELP2 Elongation factor 4 OS=Helicobacter pylori (strain P12) GN=lepA PE=3 SV=1 17 159 5.0E-22
sp|Q83NI1|LEPA_TROW8 Elongation factor 4 OS=Tropheryma whipplei (strain TW08/27) GN=lepA PE=3 SV=1 19 159 5.0E-22
sp|Q83MZ5|LEPA_TROWT Elongation factor 4 OS=Tropheryma whipplei (strain Twist) GN=lepA PE=3 SV=1 19 159 5.0E-22
sp|Q0VP16|LEPA_ALCBS Elongation factor 4 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=lepA PE=3 SV=1 17 159 5.0E-22
sp|Q8PUR7|EF2_METMA Elongation factor 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fusA PE=3 SV=1 515 1010 6.0E-22
sp|C1CKU6|LEPA_STRZP Elongation factor 4 OS=Streptococcus pneumoniae (strain P1031) GN=lepA PE=3 SV=1 8 159 6.0E-22
sp|Q97QK5|LEPA_STRPN Elongation factor 4 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=lepA PE=3 SV=1 8 159 6.0E-22
sp|B5EB36|LEPA_GEOBB Elongation factor 4 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lepA PE=3 SV=1 19 159 6.0E-22
sp|B9RHQ5|GUFP_RICCO Translation factor GUF1 homolog, chloroplastic OS=Ricinus communis GN=RCOM_1767360 PE=3 SV=1 18 159 6.0E-22
sp|A0AIS8|LEPA_LISW6 Elongation factor 4 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lepA PE=3 SV=1 12 159 6.0E-22
sp|A5GRE6|LEPA_SYNR3 Elongation factor 4 OS=Synechococcus sp. (strain RCC307) GN=lepA PE=3 SV=1 19 159 6.0E-22
sp|B0C9R9|LEPA_ACAM1 Elongation factor 4 OS=Acaryochloris marina (strain MBIC 11017) GN=lepA PE=3 SV=1 19 159 6.0E-22
sp|B6JJT7|LEPA_OLICO Elongation factor 4 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=lepA PE=3 SV=1 18 159 6.0E-22
sp|A5WCD6|LEPA_PSYWF Elongation factor 4 OS=Psychrobacter sp. (strain PRwf-1) GN=lepA PE=3 SV=1 18 159 6.0E-22
sp|Q92BN4|LEPA_LISIN Elongation factor 4 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lepA PE=3 SV=1 12 159 6.0E-22
sp|Q9PBA1|LEPA_XYLFA Elongation factor 4 OS=Xylella fastidiosa (strain 9a5c) GN=lepA PE=3 SV=1 17 159 6.0E-22
sp|O25122|LEPA_HELPY Elongation factor 4 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lepA PE=3 SV=1 17 159 6.0E-22
sp|C1C7G9|LEPA_STRP7 Elongation factor 4 OS=Streptococcus pneumoniae (strain 70585) GN=lepA PE=3 SV=1 8 159 7.0E-22
sp|B5E4T8|LEPA_STRP4 Elongation factor 4 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=lepA PE=3 SV=1 8 159 7.0E-22
sp|C1A6Q2|EFG_GEMAT Elongation factor G OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=fusA PE=3 SV=1 20 161 7.0E-22
sp|Q1AVV0|LEPA_RUBXD Elongation factor 4 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=lepA PE=3 SV=1 12 192 7.0E-22
sp|Q1CUF5|LEPA_HELPH Elongation factor 4 OS=Helicobacter pylori (strain HPAG1) GN=lepA PE=3 SV=1 17 159 7.0E-22
sp|Q8PB55|LEPA_XANCP Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lepA PE=3 SV=1 17 159 7.0E-22
sp|B0RX30|LEPA_XANCB Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain B100) GN=lepA PE=3 SV=1 17 159 7.0E-22
sp|Q4USF4|LEPA_XANC8 Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lepA PE=3 SV=1 17 159 7.0E-22
sp|Q03ZQ2|EFG_LEUMM Elongation factor G OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=fusA PE=3 SV=1 20 185 7.0E-22
sp|B0U3D5|LEPA_XYLFM Elongation factor 4 OS=Xylella fastidiosa (strain M12) GN=lepA PE=3 SV=1 17 159 7.0E-22
sp|A0LI00|LEPA_SYNFM Elongation factor 4 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=lepA PE=3 SV=1 19 200 7.0E-22
sp|Q1QDV6|LEPA_PSYCK Elongation factor 4 OS=Psychrobacter cryohalolentis (strain K5) GN=lepA PE=3 SV=1 18 159 7.0E-22
sp|Q87C09|LEPA_XYLFT Elongation factor 4 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=lepA PE=3 SV=1 17 159 7.0E-22
sp|B2I601|LEPA_XYLF2 Elongation factor 4 OS=Xylella fastidiosa (strain M23) GN=lepA PE=3 SV=1 17 159 7.0E-22
sp|A4IR35|LEPA_GEOTN Elongation factor 4 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=lepA PE=3 SV=1 12 159 7.0E-22
sp|C6DZ67|LEPA_GEOSM Elongation factor 4 OS=Geobacter sp. (strain M21) GN=lepA PE=3 SV=1 19 159 7.0E-22
sp|Q4FUV9|LEPA_PSYA2 Elongation factor 4 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=lepA PE=3 SV=1 18 159 7.0E-22
sp|B3Q991|LEPA_RHOPT Elongation factor 4 OS=Rhodopseudomonas palustris (strain TIE-1) GN=lepA PE=3 SV=1 18 188 7.0E-22
sp|P60793|LEPA_RHOPA Elongation factor 4 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lepA PE=3 SV=1 18 188 7.0E-22
sp|Q04ED6|EFG_OENOB Elongation factor G OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=fusA PE=3 SV=1 20 168 7.0E-22
sp|B9GHA6|GUFP_POPTR Translation factor GUF1 homolog, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_815670 PE=3 SV=2 17 159 8.0E-22
sp|Q049W8|LEPA_LACDB Elongation factor 4 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=lepA PE=3 SV=1 7 159 9.0E-22
sp|Q1G9R4|LEPA_LACDA Elongation factor 4 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=lepA PE=3 SV=1 7 159 9.0E-22
sp|Q1WUE6|LEPA_LACS1 Elongation factor 4 OS=Lactobacillus salivarius (strain UCC118) GN=lepA PE=3 SV=1 9 159 9.0E-22
sp|P0A3B4|TYPA_SHIFL GTP-binding protein TypA/BipA OS=Shigella flexneri GN=typA PE=3 SV=1 19 160 9.0E-22
sp|P32132|TYPA_ECOLI GTP-binding protein TypA/BipA OS=Escherichia coli (strain K12) GN=typA PE=1 SV=2 19 160 9.0E-22
sp|P0A3B1|TYPA_ECOL6 GTP-binding protein TypA/BipA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=typA PE=3 SV=1 19 160 9.0E-22
sp|P0A3B3|TYPA_ECO57 GTP-binding protein TypA/BipA OS=Escherichia coli O157:H7 GN=typA PE=3 SV=1 19 160 9.0E-22
sp|P0A3B2|TYPA_ECO27 GTP-binding protein TypA/BipA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=typA PE=3 SV=1 19 160 9.0E-22
sp|C3PHY1|LEPA_CORA7 Elongation factor 4 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=lepA PE=3 SV=1 19 173 9.0E-22
sp|Q3ZXK4|LEPA_DEHMC Elongation factor 4 OS=Dehalococcoides mccartyi (strain CBDB1) GN=lepA PE=3 SV=1 19 159 1.0E-21
sp|A5FR18|LEPA_DEHMB Elongation factor 4 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=lepA PE=3 SV=1 19 159 1.0E-21
sp|P60790|LEPA_LACJO Elongation factor 4 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=lepA PE=3 SV=1 12 159 1.0E-21
sp|Q07TF1|LEPA_RHOP5 Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisA53) GN=lepA PE=3 SV=1 18 159 1.0E-21
sp|A7I1F0|LEPA_CAMHC Elongation factor 4 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=lepA PE=3 SV=1 18 159 1.0E-21
sp|Q8DM20|LEPA_THEEB Elongation factor 4 OS=Thermosynechococcus elongatus (strain BP-1) GN=lepA PE=3 SV=1 19 159 1.0E-21
sp|C6BST2|LEPA_DESAD Elongation factor 4 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=lepA PE=3 SV=1 19 159 1.0E-21
sp|Q044A7|LEPA_LACGA Elongation factor 4 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=lepA PE=3 SV=1 12 159 1.0E-21
sp|Q0AWL9|LEPA_SYNWW Elongation factor 4 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=lepA PE=3 SV=1 17 159 1.0E-21
sp|Q2NS11|LEPA_SODGM Elongation factor 4 OS=Sodalis glossinidius (strain morsitans) GN=lepA PE=3 SV=1 17 159 1.0E-21
sp|B6H2S6|GUF1_PENRW Translation factor guf1, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=guf1 PE=3 SV=1 19 159 1.0E-21
sp|A4QV78|GUF1_MAGO7 Translation factor GUF1, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=GUF1 PE=3 SV=2 20 159 1.0E-21
sp|C1CEG3|LEPA_STRZJ Elongation factor 4 OS=Streptococcus pneumoniae (strain JJA) GN=lepA PE=3 SV=1 8 159 1.0E-21
sp|C1CR98|LEPA_STRZT Elongation factor 4 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=lepA PE=3 SV=1 8 159 1.0E-21
sp|Q8DPN5|LEPA_STRR6 Elongation factor 4 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=lepA PE=3 SV=1 8 159 1.0E-21
sp|B8ZQ69|LEPA_STRPJ Elongation factor 4 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=lepA PE=3 SV=1 8 159 1.0E-21
sp|Q04KB7|LEPA_STRP2 Elongation factor 4 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=lepA PE=3 SV=1 8 159 1.0E-21
sp|B0TAD2|LEPA_HELMI Elongation factor 4 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=lepA PE=3 SV=1 18 159 1.0E-21
sp|B9F2U5|GUFP_ORYSJ Translation factor GUF1 homolog, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0157700 PE=3 SV=1 18 159 1.0E-21
sp|Q30Q17|LEPA_SULDN Elongation factor 4 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=lepA PE=3 SV=1 17 159 1.0E-21
sp|Q8TRC3|EF2_METAC Elongation factor 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fusA PE=3 SV=1 515 1010 2.0E-21
sp|Q3BVV9|LEPA_XANC5 Elongation factor 4 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lepA PE=3 SV=1 17 159 2.0E-21
sp|Q831Z0|LEPA_ENTFA Elongation factor 4 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=lepA PE=3 SV=1 14 159 2.0E-21
sp|Q2J2Y0|LEPA_RHOP2 Elongation factor 4 OS=Rhodopseudomonas palustris (strain HaA2) GN=lepA PE=3 SV=2 18 159 2.0E-21
sp|Q8PMV3|LEPA_XANAC Elongation factor 4 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lepA PE=3 SV=1 17 159 2.0E-21
sp|Q13E78|LEPA_RHOPS Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisB5) GN=lepA PE=3 SV=2 18 159 2.0E-21
sp|Q3J8R1|EFG_NITOC Elongation factor G OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=fusA PE=3 SV=1 20 160 2.0E-21
sp|Q9CGI8|LEPA_LACLA Elongation factor 4 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lepA PE=3 SV=1 8 159 2.0E-21
sp|A2RL76|LEPA_LACLM Elongation factor 4 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lepA PE=3 SV=1 8 159 2.0E-21
sp|Q0SMG2|EFG2_BORAP Elongation factor G 2 OS=Borrelia afzelii (strain PKo) GN=fusA2 PE=3 SV=1 19 161 2.0E-21
sp|Q02Z80|LEPA_LACLS Elongation factor 4 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=lepA PE=3 SV=1 8 159 2.0E-21
sp|Q3Z864|LEPA_DEHM1 Elongation factor 4 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=lepA PE=3 SV=1 20 159 2.0E-21
sp|Q8G5B6|EFG_BIFLO Elongation factor G OS=Bifidobacterium longum (strain NCC 2705) GN=fusA PE=3 SV=1 17 161 2.0E-21
sp|B3DT30|EFG_BIFLD Elongation factor G OS=Bifidobacterium longum (strain DJO10A) GN=fusA PE=3 SV=1 17 161 2.0E-21
sp|Q39US7|LEPA_GEOMG Elongation factor 4 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=lepA PE=3 SV=2 18 258 2.0E-21
sp|Q8RFD1|LEPA_FUSNN Elongation factor 4 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=lepA PE=3 SV=1 17 159 2.0E-21
sp|B2FQC4|LEPA_STRMK Elongation factor 4 OS=Stenotrophomonas maltophilia (strain K279a) GN=lepA PE=3 SV=1 17 159 2.0E-21
sp|Q8NN68|LEPA_CORGL Elongation factor 4 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=lepA PE=3 SV=1 19 159 2.0E-21
sp|B4SRL3|LEPA_STRM5 Elongation factor 4 OS=Stenotrophomonas maltophilia (strain R551-3) GN=lepA PE=3 SV=1 17 159 2.0E-21
sp|B0JQT7|LEPA_MICAN Elongation factor 4 OS=Microcystis aeruginosa (strain NIES-843) GN=lepA PE=3 SV=1 19 159 2.0E-21
sp|A8YVQ1|LEPA_LACH4 Elongation factor 4 OS=Lactobacillus helveticus (strain DPC 4571) GN=lepA PE=3 SV=1 7 159 2.0E-21
sp|Q7S0P6|GUF1_NEUCR Translation factor guf1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=guf1 PE=3 SV=2 20 159 2.0E-21
sp|P57508|TYPA_BUCAI GTP-binding protein TypA/BipA homolog OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=typA PE=3 SV=1 19 161 2.0E-21
sp|Q38W39|LEPA_LACSS Elongation factor 4 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=lepA PE=3 SV=1 12 159 2.0E-21
sp|O93640|EF2_METTE Elongation factor 2 OS=Methanosarcina thermophila GN=fusA PE=3 SV=1 515 1010 3.0E-21
sp|B5EQB5|LEPA_ACIF5 Elongation factor 4 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=lepA PE=3 SV=1 15 159 3.0E-21
sp|B7J9J8|LEPA_ACIF2 Elongation factor 4 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=lepA PE=3 SV=1 15 159 3.0E-21
sp|Q464Z3|EF2_METBF Elongation factor 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fusA PE=3 SV=1 515 1010 1.0E-20
sp|Q5UZS7|EF2_HALMA Elongation factor 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=fusA PE=3 SV=1 515 1010 2.0E-20
sp|C7NYH7|EF2_HALMD Elongation factor 2 OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=fusA PE=3 SV=1 515 1010 1.0E-17
sp|A7I4X4|EF2_METB6 Elongation factor 2 OS=Methanoregula boonei (strain 6A8) GN=fusA PE=3 SV=1 515 1010 2.0E-17
sp|Q9HM85|EF2_HALSA Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fusA PE=3 SV=2 515 1010 2.0E-16
sp|B0R8C8|EF2_HALS3 Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=fusA PE=3 SV=1 515 1010 2.0E-16
sp|A3CXM8|EF2_METMJ Elongation factor 2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fusA PE=3 SV=1 515 1010 2.0E-16
sp|Q9YC19|EF2_AERPE Elongation factor 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fusA PE=3 SV=1 857 1050 1.0E-14
sp|A8ACA7|EF2_IGNH4 Elongation factor 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fusA PE=3 SV=1 506 738 2.0E-14
sp|A5ULM6|EF2_METS3 Elongation factor 2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fusA PE=3 SV=1 515 691 6.0E-14
sp|O59521|EF2_PYRHO Elongation factor 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fusA PE=1 SV=2 515 697 1.0E-13
sp|C3NED6|EF2_SULIY Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1 506 691 2.0E-13
sp|C3NHB6|EF2_SULIN Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1 506 691 2.0E-13
sp|C3MVH1|EF2_SULIM Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1 506 691 2.0E-13
sp|C3MQ53|EF2_SULIL Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1 506 691 2.0E-13
sp|C4KHE9|EF2_SULIK Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1 506 691 2.0E-13
sp|C3N5S0|EF2_SULIA Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1 506 691 2.0E-13
sp|P30925|EF2_SULSO Elongation factor 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fusA PE=1 SV=3 506 691 2.0E-13
sp|Q975H5|EF2_SULTO Elongation factor 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fusA PE=3 SV=3 508 691 2.0E-13
sp|A4WMR8|EF2_PYRAR Elongation factor 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fusA PE=3 SV=1 514 691 2.0E-13
sp|A0B7D5|EF2_METTP Elongation factor 2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fusA PE=3 SV=1 861 1008 4.0E-13
sp|C5A6N7|EF2_THEGJ Elongation factor 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fusA PE=3 SV=1 515 693 5.0E-13
sp|Q9YC19|EF2_AERPE Elongation factor 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fusA PE=3 SV=1 514 691 7.0E-13
sp|Q58448|EF2_METJA Elongation factor 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fusA PE=3 SV=1 515 691 7.0E-13
sp|Q5JFZ3|EF2_THEKO Elongation factor 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fusA PE=3 SV=1 515 693 8.0E-13
sp|O93637|EF2_METMT Elongation factor 2 OS=Methanococcoides methylutens GN=fusA PE=3 SV=1 518 691 1.0E-12
sp|A1RVX2|EF2_PYRIL Elongation factor 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fusA PE=3 SV=1 514 691 1.0E-12
sp|B1YE08|EF2_PYRNV Elongation factor 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fusA PE=3 SV=1 514 691 1.0E-12
sp|Q9V1Z8|EF2_PYRAB Elongation factor 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fusA PE=3 SV=1 515 697 2.0E-12
sp|A3DMV6|EF2_STAMF Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fusA PE=3 SV=1 857 998 3.0E-12
sp|P61878|EF2_PYRWO Elongation factor 2 OS=Pyrococcus woesei GN=fusA PE=3 SV=1 515 693 3.0E-12
sp|P61877|EF2_PYRFU Elongation factor 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fusA PE=3 SV=1 515 693 3.0E-12
sp|C6A4M0|EF2_THESM Elongation factor 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fusA PE=3 SV=1 515 693 4.0E-12
sp|B6YVG5|EF2_THEON Elongation factor 2 OS=Thermococcus onnurineus (strain NA1) GN=fusA PE=3 SV=1 515 693 5.0E-12
sp|A3DMV6|EF2_STAMF Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fusA PE=3 SV=1 506 691 5.0E-12
sp|A3MSN3|EF2_PYRCJ Elongation factor 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fusA PE=3 SV=1 514 691 5.0E-12
sp|P26752|EF2_THEAC Elongation factor 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fusA PE=3 SV=2 515 691 8.0E-12
sp|Q979T3|EF2_THEVO Elongation factor 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fusA PE=3 SV=1 515 691 1.0E-11
sp|Q8ZZC1|EF2_PYRAE Elongation factor 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fusA PE=3 SV=1 514 691 2.0E-11
sp|A0RW30|EF2_CENSY Elongation factor 2 OS=Cenarchaeum symbiosum (strain A) GN=fusA PE=3 SV=1 515 736 2.0E-11
sp|O93632|EF2_METBU Elongation factor 2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fusA PE=3 SV=1 471 691 3.0E-11
sp|B1L7Q0|EF2_KORCO Elongation factor 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=fusA PE=3 SV=1 471 691 3.0E-11
sp|Q8TXJ4|EF2_METKA Elongation factor 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fusA PE=3 SV=1 515 691 3.0E-11
sp|P23112|EF2_SULAC Elongation factor 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fusA PE=1 SV=3 506 691 4.0E-11
sp|Q2NEL0|EF2_METST Elongation factor 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fusA PE=3 SV=1 515 691 4.0E-11
sp|C3NED6|EF2_SULIY Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1 857 1027 6.0E-11
sp|C3NHB6|EF2_SULIN Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1 857 1027 6.0E-11
sp|C3MVH1|EF2_SULIM Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1 857 1027 6.0E-11
sp|C3MQ53|EF2_SULIL Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1 857 1027 6.0E-11
sp|C4KHE9|EF2_SULIK Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1 857 1027 6.0E-11
sp|C3N5S0|EF2_SULIA Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1 857 1027 6.0E-11
sp|P30925|EF2_SULSO Elongation factor 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fusA PE=1 SV=3 857 1027 6.0E-11
sp|O27131|EF2_METTH Elongation factor 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fusA PE=3 SV=2 515 691 6.0E-11
sp|B8GJK8|EF2_METPE Elongation factor 2 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fusA PE=3 SV=1 515 693 6.0E-11
sp|Q6LXI2|EF2_METMP Elongation factor 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=fusA PE=3 SV=1 515 692 1.0E-10
sp|Q6L200|EF2_PICTO Elongation factor 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fusA PE=3 SV=1 515 691 1.0E-10
sp|Q975H5|EF2_SULTO Elongation factor 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fusA PE=3 SV=3 857 998 2.0E-10
sp|P23112|EF2_SULAC Elongation factor 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fusA PE=1 SV=3 857 1027 2.0E-10
sp|A4FWF0|EF2_METM5 Elongation factor 2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=fusA PE=3 SV=1 515 692 2.0E-10
sp|B8D6B2|EF2_DESK1 Elongation factor 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=fusA PE=3 SV=1 857 1050 2.0E-10
sp|P33159|EF2_DESMO Elongation factor 2 OS=Desulfurococcus mobilis GN=fusA PE=3 SV=1 508 691 2.0E-10
sp|A9A9U4|EF2_METM6 Elongation factor 2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=fusA PE=3 SV=1 515 691 3.0E-10
sp|A6VGV5|EF2_METM7 Elongation factor 2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=fusA PE=3 SV=1 515 691 3.0E-10
sp|A6UV44|EF2_META3 Elongation factor 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fusA PE=3 SV=1 515 691 3.0E-10
sp|Q3J8R1|EFG_NITOC Elongation factor G OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=fusA PE=3 SV=1 517 696 3.0E-10
sp|B8D6B2|EF2_DESK1 Elongation factor 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=fusA PE=3 SV=1 508 691 4.0E-10
sp|C1A6Q2|EFG_GEMAT Elongation factor G OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=fusA PE=3 SV=1 517 691 4.0E-10
sp|B1YE08|EF2_PYRNV Elongation factor 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fusA PE=3 SV=1 857 1050 5.0E-10
sp|P33159|EF2_DESMO Elongation factor 2 OS=Desulfurococcus mobilis GN=fusA PE=3 SV=1 857 1027 9.0E-10
sp|B8GJK8|EF2_METPE Elongation factor 2 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fusA PE=3 SV=1 872 1010 1.0E-09
sp|A8ACA7|EF2_IGNH4 Elongation factor 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fusA PE=3 SV=1 857 1008 2.0E-09
sp|P09604|EF2_METVS Elongation factor 2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=fusA PE=3 SV=2 515 691 2.0E-09
sp|Q3IUM4|EF2_NATPD Elongation factor 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fusA PE=3 SV=1 515 703 3.0E-09
sp|Q58448|EF2_METJA Elongation factor 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fusA PE=3 SV=1 861 1013 3.0E-09
sp|B1L7Q0|EF2_KORCO Elongation factor 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=fusA PE=3 SV=1 864 1010 4.0E-09
sp|O59521|EF2_PYRHO Elongation factor 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fusA PE=1 SV=2 857 1008 4.0E-09
sp|Q9V1Z8|EF2_PYRAB Elongation factor 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fusA PE=3 SV=1 857 1008 5.0E-09
sp|Q8ZZC1|EF2_PYRAE Elongation factor 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fusA PE=3 SV=1 857 1050 7.0E-09
sp|Q6LXI2|EF2_METMP Elongation factor 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=fusA PE=3 SV=1 861 1008 1.0E-08
sp|A6VGV5|EF2_METM7 Elongation factor 2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=fusA PE=3 SV=1 861 1008 1.0E-08
sp|Q8G5B6|EFG_BIFLO Elongation factor G OS=Bifidobacterium longum (strain NCC 2705) GN=fusA PE=3 SV=1 517 694 1.0E-08
sp|B3DT30|EFG_BIFLD Elongation factor G OS=Bifidobacterium longum (strain DJO10A) GN=fusA PE=3 SV=1 517 694 1.0E-08
sp|A9A9U4|EF2_METM6 Elongation factor 2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=fusA PE=3 SV=1 861 1008 2.0E-08
sp|A4FWF0|EF2_METM5 Elongation factor 2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=fusA PE=3 SV=1 861 1008 2.0E-08
sp|C5A6N7|EF2_THEGJ Elongation factor 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fusA PE=3 SV=1 857 1008 3.0E-08
sp|A4WMR8|EF2_PYRAR Elongation factor 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fusA PE=3 SV=1 857 1050 3.0E-08
sp|Q3IUM4|EF2_NATPD Elongation factor 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fusA PE=3 SV=1 861 1053 3.0E-08
sp|A0B7D5|EF2_METTP Elongation factor 2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fusA PE=3 SV=1 498 691 3.0E-08
sp|Q5JFZ3|EF2_THEKO Elongation factor 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fusA PE=3 SV=1 857 1008 5.0E-08
sp|P61878|EF2_PYRWO Elongation factor 2 OS=Pyrococcus woesei GN=fusA PE=3 SV=1 857 1008 6.0E-08
sp|P61877|EF2_PYRFU Elongation factor 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fusA PE=3 SV=1 857 1008 6.0E-08
sp|B6YVG5|EF2_THEON Elongation factor 2 OS=Thermococcus onnurineus (strain NA1) GN=fusA PE=3 SV=1 857 1008 9.0E-08
sp|A1RVX2|EF2_PYRIL Elongation factor 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fusA PE=3 SV=1 857 1050 9.0E-08
sp|A3MSN3|EF2_PYRCJ Elongation factor 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fusA PE=3 SV=1 857 1050 1.0E-07
sp|P09604|EF2_METVS Elongation factor 2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=fusA PE=3 SV=2 861 1008 1.0E-07
sp|C6A4M0|EF2_THESM Elongation factor 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fusA PE=3 SV=1 857 1008 1.0E-07
sp|A6UV44|EF2_META3 Elongation factor 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fusA PE=3 SV=1 861 1008 1.0E-07
sp|Q8TXJ4|EF2_METKA Elongation factor 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fusA PE=3 SV=1 864 1013 1.0E-07
sp|Q04ED6|EFG_OENOB Elongation factor G OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=fusA PE=3 SV=1 517 693 1.0E-07
sp|O93632|EF2_METBU Elongation factor 2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fusA PE=3 SV=1 861 1010 2.0E-07
sp|Q74M52|EF2_NANEQ Elongation factor 2 OS=Nanoarchaeum equitans (strain Kin4-M) GN=fusA PE=3 SV=1 516 748 2.0E-07
sp|D3E3N9|EF2_METRM Elongation factor 2 OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=fusA PE=3 SV=1 514 692 2.0E-07
sp|D3E3N9|EF2_METRM Elongation factor 2 OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=fusA PE=3 SV=1 864 1024 4.0E-07
sp|O27131|EF2_METTH Elongation factor 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fusA PE=3 SV=2 864 1010 6.0E-07
sp|Q6L200|EF2_PICTO Elongation factor 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fusA PE=3 SV=1 864 996 7.0E-07
sp|Q2NEL0|EF2_METST Elongation factor 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fusA PE=3 SV=1 864 1008 9.0E-07
sp|O93637|EF2_METMT Elongation factor 2 OS=Methanococcoides methylutens GN=fusA PE=3 SV=1 872 1010 1.0E-06
sp|A5ULM6|EF2_METS3 Elongation factor 2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fusA PE=3 SV=1 864 1010 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0032550 purine ribonucleoside binding No
GO:0001883 purine nucleoside binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0032549 ribonucleoside binding No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0032561 guanyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0001882 nucleoside binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8175
MPVVSPEKLVSLQRQSRDIRNICILAHVDHGKTSLTDALLATNGIISPKLAGKIRYLDSRPDEQTRGITMESSAI
SLYFSMLRRSAPDADPTPKEYLINLIDSPGHIDFSSEVSTASRLCDGAVVLVDAVEGVCSQTVTVLRQAWTEELK
PLLVINKMDRLVTELKMSPPEAYVHLSKLLEQVNAVLGSFFQGERMEEDLNWRERMEERVSVAAAAKASTTEDPV
SDAGELQFEERDDEDIYFAPEKNNVIFSSAIDGWAFTCRQFASLYEKKLGIKRGVMEKVLWGSFYLDPKTKKVLG
PKHLKGRSLKPMFVQLVLEPIWTVYQATCGGDNGKGDPALLEKVTKSLGISIPPHVVRARDPRLLLTTVFGSWLP
LSTALLVSVVESLPSPPAAQAERLPQLLDSSPGSQCIGDAIREAVVEFKAGPPDPVVAYVSKMVSIPESELPENK
RRTTGQLSGEEARELARRKRAEAARAQAIKEENGIESLTEALDSAGLDDAGPDAEESKADPERLIGFARIYSGTL
SVGDTLYAIPPKWSPANPQADPRPQQVTVTALYMLMGRNLESLASVPAGVVFGIGGLEGKMLKSGTLCSRLDGAV
NLAGVSSAGKPIVRVALEPENPADLDKMISGLHLLVQSDPCAEYQQSASGEHVLLTAGELHLERCLLDLKERFAR
CEIQAGAPIVPYRETIVRAEEMRPPTNKELGRGAVVSVTSSKQVTMAIRARPLPADVTEFLIKNADSIKRLYSER
KSTDGTGEQEVGEENIVVPDTAVSAASFLSADELRRQLQSRLEAGKGREAWKGHVDQIAAFGPRRTGPNLLIDAT
GDGILSKVFSAAAKSSESAPPRAEEALRACHLADKITYAFQLATAQGPLCHEPLQGVAVFVEDVSLGQSEDGSSA
RDKLGRLTGEVIKSFQASVRAALLDWSPRLMLAMYSVEIQASTEVLGRVYDVLTRRRGRVVAEIMKEGTPFFTIQ
ALLPVAESFGFADEMRKRTSGAAQPQLIFAGFEVLDEDPFWVPFTEDDLEDLGELADKENVAKRYMDGVRRKKGL
LVEGRNVATDAEKQKTLKR*
Coding >Hirsu2|8175
ATGCCTGTCGTCAGCCCAGAAAAGCTTGTGAGCCTGCAAAGGCAGTCCCGGGACATCCGGAATATATGTATTCTT
GCTCACGTAGATCACGGCAAGACATCCTTAACGGATGCCTTGCTTGCCACCAATGGCATCATCTCCCCCAAGTTG
GCCGGCAAGATCCGCTACCTCGACTCTCGCCCTGACGAGCAGACCCGGGGCATCACCATGGAGTCCTCGGCCATT
TCACTCTACTTCTCCATGCTCCGGAGGTCCGCCCCGGACGCGGACCCGACGCCCAAGGAGTATCTCATCAACCTG
ATCGACTCACCCGGTCACATAGACTTCAGCAGCGAGGTCTCGACCGCCTCTAGACTCTGCGACGGAGCCGTCGTC
CTCGTTGATGCCGTCGAAGGCGTCTGCAGCCAGACCGTCACCGTCCTTCGCCAGGCATGGACCGAAGAGCTCAAG
CCGCTACTCGTCATCAACAAGATGGACCGGCTGGTGACCGAGCTGAAAATGAGTCCGCCAGAGGCGTACGTCCAT
CTGAGCAAGCTGCTGGAGCAGGTCAACGCCGTCCTAGGAAGCTTCTTCCAGGGCGAAAGAATGGAGGAGGATCTG
AACTGGAGGGAGAGGATGGAGGAGCGCGTCAGCGTCGCCGCCGCCGCCAAGGCATCCACCACTGAAGATCCAGTC
AGCGATGCCGGAGAGCTCCAGTTCGAGGAGAGAGACGACGAGGACATCTACTTCGCCCCGGAAAAGAACAACGTC
ATCTTCAGCAGCGCCATCGACGGCTGGGCCTTCACCTGCCGGCAGTTCGCAAGCCTGTACGAGAAGAAGCTCGGC
ATCAAGAGAGGCGTCATGGAGAAGGTTCTCTGGGGCAGCTTCTATCTCGACCCCAAGACGAAAAAGGTGCTCGGC
CCCAAGCATCTGAAGGGACGGAGCCTGAAGCCCATGTTTGTCCAGCTGGTCCTGGAGCCCATCTGGACCGTCTAC
CAGGCCACCTGTGGCGGAGACAACGGCAAAGGGGACCCGGCCCTCCTCGAAAAAGTCACAAAGTCCCTCGGCATC
AGCATCCCGCCCCACGTTGTGCGGGCACGAGATCCCAGGCTGCTGCTGACCACCGTCTTTGGCTCCTGGCTGCCG
TTGTCGACGGCACTCCTCGTGTCGGTTGTCGAGTCTCTGCCGTCGCCCCCGGCAGCGCAAGCCGAGCGCCTCCCC
CAGCTGCTCGACAGCTCGCCGGGATCGCAGTGCATCGGCGACGCCATCAGGGAAGCCGTGGTGGAATTCAAGGCT
GGTCCGCCGGACCCCGTTGTTGCCTACGTGAGCAAGATGGTATCCATTCCCGAAAGCGAGCTGCCCGAGAACAAG
AGGAGGACCACCGGCCAACTGAGCGGCGAGGAGGCAAGAGAGCTGGCCCGGAGGAAGAGGGCCGAGGCGGCGCGA
GCGCAGGCGATCAAGGAGGAGAACGGAATCGAGAGCCTGACCGAGGCCCTCGATTCCGCAGGACTCGACGACGCG
GGGCCGGACGCGGAGGAGAGCAAGGCGGACCCGGAGCGCCTGATCGGCTTCGCCAGGATTTACTCTGGCACACTG
TCGGTCGGCGACACGCTCTACGCCATCCCACCCAAGTGGTCTCCTGCGAACCCACAGGCCGATCCGCGGCCGCAG
CAGGTCACCGTCACGGCGCTCTACATGCTCATGGGCCGGAACCTGGAGTCTCTGGCCTCCGTACCGGCCGGCGTT
GTCTTCGGCATCGGCGGCCTGGAGGGCAAGATGCTCAAGTCGGGGACGCTGTGCAGTCGCCTCGACGGGGCCGTC
AACCTCGCGGGCGTGAGCTCGGCCGGGAAGCCGATCGTGCGGGTGGCGCTCGAGCCGGAGAACCCGGCGGACCTG
GACAAGATGATTAGCGGCCTGCACCTCCTCGTCCAGAGCGACCCGTGCGCCGAGTACCAGCAGTCCGCGAGCGGC
GAACACGTCTTGCTGACCGCCGGCGAGCTGCATCTGGAGCGATGCCTGCTCGACCTCAAGGAGCGGTTCGCGCGC
TGCGAAATCCAAGCCGGTGCCCCCATTGTGCCTTACCGGGAGACGATTGTCCGCGCGGAAGAGATGCGGCCGCCT
ACGAACAAGGAGCTAGGCCGGGGGGCCGTCGTCAGCGTCACGAGCTCCAAGCAGGTCACCATGGCCATCCGCGCT
CGGCCACTGCCGGCGGACGTGACCGAGTTCCTCATCAAGAACGCCGACTCGATCAAGCGTCTCTACTCGGAGCGC
AAGTCGACAGACGGAACCGGCGAGCAAGAGGTCGGCGAGGAGAACATCGTCGTGCCCGACACCGCCGTCAGCGCC
GCCAGTTTCCTCTCGGCCGACGAGCTGAGGCGGCAGCTGCAGAGCCGGCTGGAGGCTGGCAAGGGGCGCGAGGCC
TGGAAGGGGCACGTCGACCAGATCGCCGCGTTCGGGCCGCGGCGCACCGGGCCGAACCTGCTCATCGACGCGACC
GGGGACGGCATCCTGAGCAAGGTGTTCTCGGCCGCCGCCAAGAGCTCGGAGAGCGCTCCTCCTCGCGCGGAAGAG
GCCCTCCGCGCGTGCCACCTGGCCGACAAGATCACGTACGCCTTCCAGCTGGCAACGGCGCAGGGCCCGCTGTGC
CACGAGCCGCTGCAGGGCGTCGCCGTCTTCGTCGAGGACGTGAGCCTCGGCCAGTCGGAGGACGGGTCGTCGGCG
CGCGACAAGCTCGGCAGGCTGACGGGCGAGGTCATCAAGTCCTTCCAGGCGTCGGTCCGGGCCGCCCTGCTCGAC
TGGTCGCCGCGGCTGATGCTGGCCATGTACTCGGTCGAGATCCAGGCCTCGACCGAGGTGCTCGGGCGGGTGTAC
GACGTGCTGACGCGGCGGCGCGGACGGGTCGTGGCCGAGATCATGAAGGAGGGCACGCCCTTCTTCACCATCCAG
GCGCTGCTCCCGGTGGCGGAAAGCTTCGGGTTCGCGGACGAGATGCGCAAGCGCACGAGCGGGGCGGCGCAGCCG
CAGCTCATCTTCGCCGGCTTCGAGGTCCTCGACGAAGACCCGTTCTGGGTCCCGTTCACGGAGGATGACCTGGAA
GACCTCGGCGAGCTGGCCGACAAGGAGAACGTGGCCAAGCGGTACATGGACGGCGTGCGACGCAAGAAGGGGCTG
CTGGTCGAGGGCCGCAACGTGGCCACGGACGCGGAGAAGCAGAAGACGCTGAAGCGATGA
Transcript >Hirsu2|8175
ATGCCTGTCGTCAGCCCAGAAAAGCTTGTGAGCCTGCAAAGGCAGTCCCGGGACATCCGGAATATATGTATTCTT
GCTCACGTAGATCACGGCAAGACATCCTTAACGGATGCCTTGCTTGCCACCAATGGCATCATCTCCCCCAAGTTG
GCCGGCAAGATCCGCTACCTCGACTCTCGCCCTGACGAGCAGACCCGGGGCATCACCATGGAGTCCTCGGCCATT
TCACTCTACTTCTCCATGCTCCGGAGGTCCGCCCCGGACGCGGACCCGACGCCCAAGGAGTATCTCATCAACCTG
ATCGACTCACCCGGTCACATAGACTTCAGCAGCGAGGTCTCGACCGCCTCTAGACTCTGCGACGGAGCCGTCGTC
CTCGTTGATGCCGTCGAAGGCGTCTGCAGCCAGACCGTCACCGTCCTTCGCCAGGCATGGACCGAAGAGCTCAAG
CCGCTACTCGTCATCAACAAGATGGACCGGCTGGTGACCGAGCTGAAAATGAGTCCGCCAGAGGCGTACGTCCAT
CTGAGCAAGCTGCTGGAGCAGGTCAACGCCGTCCTAGGAAGCTTCTTCCAGGGCGAAAGAATGGAGGAGGATCTG
AACTGGAGGGAGAGGATGGAGGAGCGCGTCAGCGTCGCCGCCGCCGCCAAGGCATCCACCACTGAAGATCCAGTC
AGCGATGCCGGAGAGCTCCAGTTCGAGGAGAGAGACGACGAGGACATCTACTTCGCCCCGGAAAAGAACAACGTC
ATCTTCAGCAGCGCCATCGACGGCTGGGCCTTCACCTGCCGGCAGTTCGCAAGCCTGTACGAGAAGAAGCTCGGC
ATCAAGAGAGGCGTCATGGAGAAGGTTCTCTGGGGCAGCTTCTATCTCGACCCCAAGACGAAAAAGGTGCTCGGC
CCCAAGCATCTGAAGGGACGGAGCCTGAAGCCCATGTTTGTCCAGCTGGTCCTGGAGCCCATCTGGACCGTCTAC
CAGGCCACCTGTGGCGGAGACAACGGCAAAGGGGACCCGGCCCTCCTCGAAAAAGTCACAAAGTCCCTCGGCATC
AGCATCCCGCCCCACGTTGTGCGGGCACGAGATCCCAGGCTGCTGCTGACCACCGTCTTTGGCTCCTGGCTGCCG
TTGTCGACGGCACTCCTCGTGTCGGTTGTCGAGTCTCTGCCGTCGCCCCCGGCAGCGCAAGCCGAGCGCCTCCCC
CAGCTGCTCGACAGCTCGCCGGGATCGCAGTGCATCGGCGACGCCATCAGGGAAGCCGTGGTGGAATTCAAGGCT
GGTCCGCCGGACCCCGTTGTTGCCTACGTGAGCAAGATGGTATCCATTCCCGAAAGCGAGCTGCCCGAGAACAAG
AGGAGGACCACCGGCCAACTGAGCGGCGAGGAGGCAAGAGAGCTGGCCCGGAGGAAGAGGGCCGAGGCGGCGCGA
GCGCAGGCGATCAAGGAGGAGAACGGAATCGAGAGCCTGACCGAGGCCCTCGATTCCGCAGGACTCGACGACGCG
GGGCCGGACGCGGAGGAGAGCAAGGCGGACCCGGAGCGCCTGATCGGCTTCGCCAGGATTTACTCTGGCACACTG
TCGGTCGGCGACACGCTCTACGCCATCCCACCCAAGTGGTCTCCTGCGAACCCACAGGCCGATCCGCGGCCGCAG
CAGGTCACCGTCACGGCGCTCTACATGCTCATGGGCCGGAACCTGGAGTCTCTGGCCTCCGTACCGGCCGGCGTT
GTCTTCGGCATCGGCGGCCTGGAGGGCAAGATGCTCAAGTCGGGGACGCTGTGCAGTCGCCTCGACGGGGCCGTC
AACCTCGCGGGCGTGAGCTCGGCCGGGAAGCCGATCGTGCGGGTGGCGCTCGAGCCGGAGAACCCGGCGGACCTG
GACAAGATGATTAGCGGCCTGCACCTCCTCGTCCAGAGCGACCCGTGCGCCGAGTACCAGCAGTCCGCGAGCGGC
GAACACGTCTTGCTGACCGCCGGCGAGCTGCATCTGGAGCGATGCCTGCTCGACCTCAAGGAGCGGTTCGCGCGC
TGCGAAATCCAAGCCGGTGCCCCCATTGTGCCTTACCGGGAGACGATTGTCCGCGCGGAAGAGATGCGGCCGCCT
ACGAACAAGGAGCTAGGCCGGGGGGCCGTCGTCAGCGTCACGAGCTCCAAGCAGGTCACCATGGCCATCCGCGCT
CGGCCACTGCCGGCGGACGTGACCGAGTTCCTCATCAAGAACGCCGACTCGATCAAGCGTCTCTACTCGGAGCGC
AAGTCGACAGACGGAACCGGCGAGCAAGAGGTCGGCGAGGAGAACATCGTCGTGCCCGACACCGCCGTCAGCGCC
GCCAGTTTCCTCTCGGCCGACGAGCTGAGGCGGCAGCTGCAGAGCCGGCTGGAGGCTGGCAAGGGGCGCGAGGCC
TGGAAGGGGCACGTCGACCAGATCGCCGCGTTCGGGCCGCGGCGCACCGGGCCGAACCTGCTCATCGACGCGACC
GGGGACGGCATCCTGAGCAAGGTGTTCTCGGCCGCCGCCAAGAGCTCGGAGAGCGCTCCTCCTCGCGCGGAAGAG
GCCCTCCGCGCGTGCCACCTGGCCGACAAGATCACGTACGCCTTCCAGCTGGCAACGGCGCAGGGCCCGCTGTGC
CACGAGCCGCTGCAGGGCGTCGCCGTCTTCGTCGAGGACGTGAGCCTCGGCCAGTCGGAGGACGGGTCGTCGGCG
CGCGACAAGCTCGGCAGGCTGACGGGCGAGGTCATCAAGTCCTTCCAGGCGTCGGTCCGGGCCGCCCTGCTCGAC
TGGTCGCCGCGGCTGATGCTGGCCATGTACTCGGTCGAGATCCAGGCCTCGACCGAGGTGCTCGGGCGGGTGTAC
GACGTGCTGACGCGGCGGCGCGGACGGGTCGTGGCCGAGATCATGAAGGAGGGCACGCCCTTCTTCACCATCCAG
GCGCTGCTCCCGGTGGCGGAAAGCTTCGGGTTCGCGGACGAGATGCGCAAGCGCACGAGCGGGGCGGCGCAGCCG
CAGCTCATCTTCGCCGGCTTCGAGGTCCTCGACGAAGACCCGTTCTGGGTCCCGTTCACGGAGGATGACCTGGAA
GACCTCGGCGAGCTGGCCGACAAGGAGAACGTGGCCAAGCGGTACATGGACGGCGTGCGACGCAAGAAGGGGCTG
CTGGTCGAGGGCCGCAACGTGGCCACGGACGCGGAGAAGCAGAAGACGCTGAAGCGATGA
Gene >Hirsu2|8175
ATGCCTGTCGTCAGCCCAGAAAAGCTTGTGAGCCTGCAAAGGCAGTCCCGGGACATCCGGAATGTAGGCTAGAGC
TCCCTCCGCCGCCTCTCTGAATACTTGCTGATGTTCTGCGGCCAGATATGTATTCTTGCTCACGTAGATCACGGC
AAGACATCCTTAACGGATGCCTTGCTTGCCACCAATGGCATCATCTCCCCCAAGTTGGCCGGCAAGATCCGCTAC
CTCGACTCTCGCCCTGACGAGCAGACCCGGGGCATCACCATGGAGTCCTCGGCCATTTCACTCTACTTCTCCATG
CTCCGGAGGTCCGCCCCGGACGCGGACCCGACGCCCAAGGAGTATCTCATCAACCTGATCGACTCACCCGGTCAC
ATAGACTTCAGCAGCGAGGTCTCGACCGCCTCTAGACTCTGCGACGGAGCCGTCGTCCTCGTTGATGCCGTCGAA
GGCGTCTGCAGCCAGACCGTCACCGTCCTTCGCCAGGCATGGACCGAAGAGCTCAAGCCGCTACTCGTCATCAAC
AAGATGGACCGGCTGGTGACCGAGCTGAAAATGAGTCCGCCAGAGGCGTACGTCCATCTGAGCAAGCTGCTGGAG
CAGGTCAACGCCGTCCTAGGAAGCTTCTTCCAGGGCGAAAGAATGGAGGAGGATCTGAACTGGAGGGAGAGGATG
GAGGAGCGCGTCAGCGTCGCCGCCGCCGCCAAGGCATCCACCACTGAAGATCCAGTCAGCGATGCCGGAGAGCTC
CAGTTCGAGGAGAGAGACGACGAGGACATCTACTTCGCCCCGGAAAAGAACAACGTCATCTTCAGCAGCGCCATC
GACGGCTGGGCCTTCACCTGCCGGCAGTTCGCAAGCCTGTACGAGAAGAAGCTCGGCATCAAGAGAGGCGTCATG
GAGAAGGTTCTCTGGGGCAGCTTCTATCTCGACCCCAAGACGAAAAAGGTGCTCGGCCCCAAGCATCTGAAGGGA
CGGAGCCTGAAGCCCATGTTTGTCCAGCTGGTCCTGGAGCCCATCTGGACCGTCTACCAGGCCACCTGTGGCGGA
GACAACGGCAAAGGGGACCCGGCCCTCCTCGAAAAAGTCACAAAGTCCCTCGGCATCAGCATCCCGCCCCACGTT
GTGCGGGCACGAGATCCCAGGCTGCTGCTGACCACCGTCTTTGGCTCCTGGCTGCCGTTGTCGACGGCACTCCTC
GTGTCGGTTGTCGAGTCTCTGCCGTCGCCCCCGGCAGCGCAAGCCGAGCGCCTCCCCCAGCTGCTCGACAGCTCG
CCGGGATCGCAGTGCATCGGCGACGCCATCAGGGAAGCCGTGGTGGAATTCAAGGCTGGTCCGCCGGACCCCGTT
GTTGCCTACGTGAGCAAGATGGTATCCATTCCCGAAAGCGAGCTGCCCGAGAACAAGAGGAGGACCACCGGCCAA
CTGAGCGGCGAGGAGGCAAGAGAGCTGGCCCGGAGGAAGAGGGCCGAGGCGGCGCGAGCGCAGGCGATCAAGGAG
GAGAACGGAATCGAGAGCCTGACCGAGGCCCTCGATTCCGCAGGACTCGACGACGCGGGGCCGGACGCGGAGGAG
AGCAAGGCGGACCCGGAGCGCCTGATCGGCTTCGCCAGGATTTACTCTGGCACACTGTCGGTCGGCGACACGCTC
TACGCCATCCCACCCAAGTGGTCTCCTGCGAACCCACAGGCCGATCCGCGGCCGCAGCAGGTCACCGTCACGGCG
CTCTACATGCTCATGGGCCGGAACCTGGAGTCTCTGGCCTCCGTACCGGCCGGCGTTGTCTTCGGCATCGGCGGC
CTGGAGGGCAAGATGCTCAAGTCGGGGACGCTGTGCAGTCGCCTCGACGGGGCCGTCAACCTCGCGGGCGTGAGC
TCGGCCGGGAAGCCGATCGTGCGGGTGGCGCTCGAGCCGGAGAACCCGGCGGACCTGGACAAGATGATTAGCGGC
CTGCACCTCCTCGTCCAGAGCGACCCGTGCGCCGAGTACCAGCAGTCCGCGAGCGGCGAACACGTCTTGCTGACC
GCCGGCGAGCTGCATCTGGAGCGATGCCTGCTCGACCTCAAGGAGCGGTTCGCGCGCTGCGAAATCCAAGCCGGT
GCCCCCATTGTGCCTTACCGGGAGACGATTGTCCGCGCGGAAGAGATGCGGCCGCCTACGAACAAGGAGCTAGGC
CGGGGGGCCGTCGTCAGCGTCACGAGCTCCAAGCAGGTCACCATGGCCATCCGCGCTCGGCCACTGCCGGCGGAC
GTGACCGAGTTCCTCATCAAGAACGCCGACTCGATCAAGCGTCTCTACTCGGAGCGCAAGTCGACAGACGGAACC
GGCGAGCAAGAGGTCGGCGAGGAGAACATCGTCGTGCCCGACACCGCCGTCAGCGCCGCCAGTTTCCTCTCGGCC
GACGAGCTGAGGCGGCAGCTGCAGAGCCGGCTGGAGGCTGGCAAGGGGCGCGAGGCCTGGAAGGGGCACGTCGAC
CAGATCGCCGCGTTCGGGCCGCGGCGCACCGGGCCGAACCTGCTCATCGACGCGACCGGGGACGGCATCCTGAGC
AAGGTGTTCTCGGCCGCCGCCAAGAGCTCGGAGAGCGCTCCTCCTCGCGCGGAAGAGGCCCTCCGCGCGTGCCAC
CTGGCCGACAAGATCACGTACGCCTTCCAGCTGGCAACGGCGCAGGGCCCGCTGTGCCACGAGCCGCTGCAGGGC
GTCGCCGTCTTCGTCGAGGACGTGAGCCTCGGCCAGTCGGAGGACGGGTCGTCGGCGCGCGACAAGCTCGGCAGG
CTGACGGGCGAGGTCATCAAGTCCTTCCAGGCGTCGGTCCGGGCCGCCCTGCTCGACTGGTCGCCGCGGCTGATG
CTGGCCATGTACTCGGTCGAGATCCAGGCCTCGACCGAGGTGCTCGGGCGGGTGTACGACGTGCTGACGCGGCGG
CGCGGACGGGTCGTGGCCGAGATCATGAAGGAGGGCACGCCCTTCTTCACCATCCAGGCGCTGCTCCCGGTGGCG
GAAAGCTTCGGGTTCGCGGACGAGATGCGCAAGCGCACGAGCGGGGCGGCGCAGCCGCAGCTCATCTTCGCCGGC
TTCGAGGTCCTCGACGAAGACCCGTTCTGGGTCCCGTTCACGGAGGATGACCTGGAAGACCTCGGCGAGCTGGCC
GACAAGGAGAACGTGGCCAAGCGGTACATGGACGGCGTGCGACGCAAGAAGGGGCTGCTGGTCGAGGGCCGCAAC
GTGGCCACGGACGCGGAGAAGCAGAAGACGCTGAAGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail