Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8165
Gene name
LocationContig_515:9951..11630
Strand-
Gene length (bp)1679
Transcript length (bp)1617
Coding sequence length (bp)1617
Protein length (aa) 539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I 1.9E-07 51 86
PF02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I 7.1E-06 109 173
PF00408 PGM_PMM_IV Phosphoglucomutase/phosphomannomutase, C-terminal domain 3.1E-10 457 533

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4V2|AGM1_CANAX Phosphoacetylglucosamine mutase OS=Candida albicans GN=AGM1 PE=1 SV=1 12 534 4.0E-175
sp|Q09770|AGM2_SCHPO Phosphoacetylglucosamine mutase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1296.01c PE=1 SV=2 18 533 4.0E-169
sp|F1RQM2|AGM1_PIG Phosphoacetylglucosamine mutase OS=Sus scrofa GN=PGM3 PE=1 SV=2 3 535 6.0E-164
sp|O95394|AGM1_HUMAN Phosphoacetylglucosamine mutase OS=Homo sapiens GN=PGM3 PE=1 SV=1 5 536 2.0E-160
sp|Q9CYR6|AGM1_MOUSE Phosphoacetylglucosamine mutase OS=Mus musculus GN=Pgm3 PE=1 SV=1 9 536 5.0E-157
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4V2|AGM1_CANAX Phosphoacetylglucosamine mutase OS=Candida albicans GN=AGM1 PE=1 SV=1 12 534 4.0E-175
sp|Q09770|AGM2_SCHPO Phosphoacetylglucosamine mutase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1296.01c PE=1 SV=2 18 533 4.0E-169
sp|F1RQM2|AGM1_PIG Phosphoacetylglucosamine mutase OS=Sus scrofa GN=PGM3 PE=1 SV=2 3 535 6.0E-164
sp|O95394|AGM1_HUMAN Phosphoacetylglucosamine mutase OS=Homo sapiens GN=PGM3 PE=1 SV=1 5 536 2.0E-160
sp|Q9CYR6|AGM1_MOUSE Phosphoacetylglucosamine mutase OS=Mus musculus GN=Pgm3 PE=1 SV=1 9 536 5.0E-157
sp|P38628|AGM1_YEAST Phosphoacetylglucosamine mutase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCM1 PE=1 SV=2 20 534 2.0E-150
sp|Q09687|AGM1_SCHPO Phosphoacetylglucosamine mutase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13C5.05c PE=1 SV=1 14 533 2.0E-141
sp|P57750|AGM1_ARATH Phosphoacetylglucosamine mutase OS=Arabidopsis thaliana GN=DRT101 PE=1 SV=1 5 536 2.0E-133
sp|Q6ZDQ1|AGM1_ORYSJ Phosphoacetylglucosamine mutase OS=Oryza sativa subsp. japonica GN=Os07g0195400 PE=2 SV=1 13 536 1.0E-126
sp|Q8SSL7|AGM1_ENCCU Probable phosphoacetylglucosamine mutase OS=Encephalitozoon cuniculi (strain GB-M1) GN=PCM1 PE=1 SV=1 22 533 2.0E-84
sp|A6LMW5|GLMM_THEM4 Phosphoglucosamine mutase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=glmM PE=3 SV=1 123 536 5.0E-13
sp|Q8G533|GLMM_BIFLO Phosphoglucosamine mutase OS=Bifidobacterium longum (strain NCC 2705) GN=glmM PE=3 SV=1 35 535 6.0E-11
sp|B3DTC2|GLMM_BIFLD Phosphoglucosamine mutase OS=Bifidobacterium longum (strain DJO10A) GN=glmM PE=3 SV=1 35 535 6.0E-11
sp|A0PXZ6|GLMM_CLONN Phosphoglucosamine mutase OS=Clostridium novyi (strain NT) GN=glmM PE=3 SV=1 123 535 1.0E-10
sp|Q82WX6|GLMM_NITEU Phosphoglucosamine mutase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=glmM PE=3 SV=1 124 535 1.0E-10
sp|Q1IXS5|GLMM_DEIGD Phosphoglucosamine mutase OS=Deinococcus geothermalis (strain DSM 11300) GN=glmM PE=3 SV=1 124 537 1.0E-10
sp|B8DWH9|GLMM_BIFA0 Phosphoglucosamine mutase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=glmM PE=3 SV=1 35 533 3.0E-10
sp|B8D0U9|GLMM_HALOH Phosphoglucosamine mutase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=glmM PE=3 SV=1 124 535 3.0E-10
sp|B2A4R9|GLMM_NATTJ Phosphoglucosamine mutase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=glmM PE=3 SV=1 187 535 6.0E-10
sp|Q9RSQ3|GLMM_DEIRA Phosphoglucosamine mutase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=glmM PE=3 SV=1 122 538 3.0E-08
sp|C4KZK4|GLMM_EXISA Phosphoglucosamine mutase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=glmM PE=3 SV=1 278 535 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016868 intramolecular transferase activity, phosphotransferases Yes
GO:0071704 organic substance metabolic process Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0008152 metabolic process No
GO:0016853 isomerase activity No
GO:0008150 biological_process No
GO:0016866 intramolecular transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8165
MDDKILAASARHPITAGHAYKYGTAGFRMRADLLPGVSFRVGLVAALRSRKLNGQAIGVMVTASHNPAADNGVKI
VDPMGEMLEQEWEVYATHLVNCPSDQALLDGYKALAARLKIDLAGPARVVYGRDTRPSGHGLVAALADALDAANA
EYTDYKILTTPQLHYLTRCVNTEGTPKSYGQATEAGYYQKFADAFVHALRGRKIQGQLTVDCANGVGGPKLAEML
KVLPKPDTGFDVKIVNDDVLRPEVLNLECGADYVKTKQRTPQNPKPVPGARCCSFDGDADRLIYYWIDPDTGFFM
LDGDRISSLSASFIGDLVRAAGLEDDLRIGVVQTAYANGASTSYIEKHLRLPVVCTPTGVKHLHHAACQFDIGVY
FEANGHGTVVFSQEAMRVFRDKEPQSPAQKDALETLTAVGELINQTVGDAITDMLLVEVILAHKGWTLKDWAMTY
TDLPNRLVRVEVGNKDLFKATDAERRLSHPARAQDAIDQVVRKYTTARSFARASGTENACRVYAEAATRSEADEL
ANKVAQIVKQFGS*
Coding >Hirsu2|8165
ATGGACGACAAGATTCTCGCCGCCTCGGCCAGGCACCCCATCACGGCCGGCCACGCTTACAAGTATGGCACGGCC
GGCTTCCGCATGAGGGCCGACCTGCTGCCCGGCGTCTCGTTCCGCGTCGGCCTCGTCGCCGCCCTGCGCAGCCGC
AAGCTCAACGGCCAGGCCATTGGCGTCATGGTCACCGCCAGCCACAACCCGGCCGCCGACAACGGCGTCAAGATC
GTCGACCCCATGGGCGAGATGCTGGAGCAGGAGTGGGAGGTCTACGCCACCCACCTCGTCAACTGCCCCTCCGAC
CAGGCCCTGCTCGACGGCTACAAAGCCCTGGCCGCGCGCCTCAAGATCGACCTGGCCGGCCCGGCCCGCGTCGTC
TACGGCCGCGACACGCGCCCCTCGGGCCACGGCCTCGTCGCCGCCCTCGCCGACGCCCTGGACGCCGCCAACGCC
GAATACACCGACTACAAGATCCTGACGACGCCCCAGCTGCACTACCTGACCCGATGTGTCAACACCGAGGGCACC
CCCAAGTCGTACGGCCAGGCCACCGAGGCCGGCTACTACCAAAAGTTCGCCGACGCCTTCGTCCACGCCCTGCGC
GGCAGGAAGATCCAGGGCCAGCTGACCGTGGACTGCGCCAACGGTGTGGGGGGCCCCAAGCTGGCCGAGATGCTC
AAGGTCCTGCCCAAGCCCGACACGGGCTTCGACGTCAAGATCGTCAACGACGACGTCCTCCGGCCCGAGGTGCTC
AACCTGGAGTGCGGTGCCGACTACGTCAAGACGAAGCAGCGGACGCCCCAGAACCCAAAGCCCGTCCCGGGCGCG
CGATGCTGCTCCTTCGACGGCGACGCCGACCGTCTCATCTACTACTGGATCGACCCTGACACCGGCTTCTTCATG
CTCGACGGCGACCGCATCTCGTCCCTCAGCGCCTCCTTCATCGGGGACCTCGTCCGCGCCGCCGGCCTCGAGGAC
GACCTCCGCATCGGCGTCGTGCAGACGGCCTACGCCAACGGCGCCAGCACGAGCTACATCGAGAAGCACCTGCGG
CTGCCCGTCGTCTGCACCCCCACCGGCGTCAAGCACCTGCACCACGCGGCTTGCCAGTTCGACATTGGCGTCTAC
TTCGAGGCCAACGGCCATGGGACCGTCGTCTTCTCGCAGGAGGCCATGCGCGTCTTCCGCGACAAGGAGCCCCAG
TCGCCCGCGCAAAAGGACGCGCTCGAGACGCTCACGGCCGTCGGCGAGCTCATCAACCAGACGGTCGGCGACGCC
ATCACCGACATGCTCCTGGTCGAGGTCATCCTCGCCCACAAGGGCTGGACGCTCAAGGACTGGGCCATGACGTAC
ACGGACCTGCCCAACCGCCTCGTGCGCGTCGAGGTCGGCAACAAGGACCTCTTCAAGGCCACCGACGCCGAGCGT
CGCCTCAGCCACCCGGCCCGCGCCCAGGACGCGATCGACCAGGTGGTGCGCAAGTACACGACGGCCCGCTCCTTC
GCGCGCGCCAGCGGCACCGAGAACGCGTGCCGCGTCTACGCCGAGGCGGCGACCCGGTCCGAGGCCGACGAGCTG
GCCAACAAGGTGGCCCAGATCGTCAAGCAATTCGGCTCATAA
Transcript >Hirsu2|8165
ATGGACGACAAGATTCTCGCCGCCTCGGCCAGGCACCCCATCACGGCCGGCCACGCTTACAAGTATGGCACGGCC
GGCTTCCGCATGAGGGCCGACCTGCTGCCCGGCGTCTCGTTCCGCGTCGGCCTCGTCGCCGCCCTGCGCAGCCGC
AAGCTCAACGGCCAGGCCATTGGCGTCATGGTCACCGCCAGCCACAACCCGGCCGCCGACAACGGCGTCAAGATC
GTCGACCCCATGGGCGAGATGCTGGAGCAGGAGTGGGAGGTCTACGCCACCCACCTCGTCAACTGCCCCTCCGAC
CAGGCCCTGCTCGACGGCTACAAAGCCCTGGCCGCGCGCCTCAAGATCGACCTGGCCGGCCCGGCCCGCGTCGTC
TACGGCCGCGACACGCGCCCCTCGGGCCACGGCCTCGTCGCCGCCCTCGCCGACGCCCTGGACGCCGCCAACGCC
GAATACACCGACTACAAGATCCTGACGACGCCCCAGCTGCACTACCTGACCCGATGTGTCAACACCGAGGGCACC
CCCAAGTCGTACGGCCAGGCCACCGAGGCCGGCTACTACCAAAAGTTCGCCGACGCCTTCGTCCACGCCCTGCGC
GGCAGGAAGATCCAGGGCCAGCTGACCGTGGACTGCGCCAACGGTGTGGGGGGCCCCAAGCTGGCCGAGATGCTC
AAGGTCCTGCCCAAGCCCGACACGGGCTTCGACGTCAAGATCGTCAACGACGACGTCCTCCGGCCCGAGGTGCTC
AACCTGGAGTGCGGTGCCGACTACGTCAAGACGAAGCAGCGGACGCCCCAGAACCCAAAGCCCGTCCCGGGCGCG
CGATGCTGCTCCTTCGACGGCGACGCCGACCGTCTCATCTACTACTGGATCGACCCTGACACCGGCTTCTTCATG
CTCGACGGCGACCGCATCTCGTCCCTCAGCGCCTCCTTCATCGGGGACCTCGTCCGCGCCGCCGGCCTCGAGGAC
GACCTCCGCATCGGCGTCGTGCAGACGGCCTACGCCAACGGCGCCAGCACGAGCTACATCGAGAAGCACCTGCGG
CTGCCCGTCGTCTGCACCCCCACCGGCGTCAAGCACCTGCACCACGCGGCTTGCCAGTTCGACATTGGCGTCTAC
TTCGAGGCCAACGGCCATGGGACCGTCGTCTTCTCGCAGGAGGCCATGCGCGTCTTCCGCGACAAGGAGCCCCAG
TCGCCCGCGCAAAAGGACGCGCTCGAGACGCTCACGGCCGTCGGCGAGCTCATCAACCAGACGGTCGGCGACGCC
ATCACCGACATGCTCCTGGTCGAGGTCATCCTCGCCCACAAGGGCTGGACGCTCAAGGACTGGGCCATGACGTAC
ACGGACCTGCCCAACCGCCTCGTGCGCGTCGAGGTCGGCAACAAGGACCTCTTCAAGGCCACCGACGCCGAGCGT
CGCCTCAGCCACCCGGCCCGCGCCCAGGACGCGATCGACCAGGTGGTGCGCAAGTACACGACGGCCCGCTCCTTC
GCGCGCGCCAGCGGCACCGAGAACGCGTGCCGCGTCTACGCCGAGGCGGCGACCCGGTCCGAGGCCGACGAGCTG
GCCAACAAGGTGGCCCAGATCGTCAAGCAATTCGGCTCATAA
Gene >Hirsu2|8165
ATGGACGACAAGATTCTCGCCGCCTCGGCCAGGCACCCCATCACGGCCGGCCACGCTTACAAGTATGGCACGGCC
GGCTTCCGCATGAGGGCCGACCTGCTGCCCGGCGTCTCGTTCCGCGTCGGCCTCGTCGCCGCCCTGCGCAGCCGC
AAGCTCAACGGCCAGGCCATTGGCGTCATGGTCACCGCCAGCCACAACCCGGCCGCCGACAACGGCGTCAAGATC
GTCGACCCCATGGGCGAGATGCTGGAGCAGGAGTGGGAGGTCTACGCCACCCACCTCGTCAACTGCCCCTCCGAC
CAGGCCCTGCTCGACGGCTACAAAGCCCTGGCCGCGCGCCTCAAGATCGACCTGGCCGGCCCGGCCCGCGTCGTC
TACGGCCGCGACACGCGCCCCTCGGGCCACGGCCTCGTCGCCGCCCTCGCCGACGCCCTGGACGCCGCCAACGCC
GAATACACCGACTACAAGATCCTGACGACGCCCCAGCTGCACTACCTGACCCGATGTGTCAACACCGAGGGCACC
CCCAAGTCGTACGGCCAGGCCACCGAGGCCGGCTACTACCAAAAGTTCGCCGACGCCTTCGTCCACGCCCTGCGC
GGCAGGAAGATCCAGGGCCAGCTGACCGTGGACTGCGCCAACGGTGTGGGGGGCCCCAAGCTGGCCGAGATGCTC
AAGGTCCTGCCCAAGCCCGACACGGGCTTCGACGTCAAGATCGTCAACGACGACGTCCTCCGGCCCGAGGTGCTC
AACCTGGAGGTGAGTGAGACGCAGGACGTCGGCCATGGCAACCTTTGCGCTGACCACGTCCGGCCGTGCAGTGCG
GTGCCGACTACGTCAAGACGAAGCAGCGGACGCCCCAGAACCCAAAGCCCGTCCCGGGCGCGCGATGCTGCTCCT
TCGACGGCGACGCCGACCGTCTCATCTACTACTGGATCGACCCTGACACCGGCTTCTTCATGCTCGACGGCGACC
GCATCTCGTCCCTCAGCGCCTCCTTCATCGGGGACCTCGTCCGCGCCGCCGGCCTCGAGGACGACCTCCGCATCG
GCGTCGTGCAGACGGCCTACGCCAACGGCGCCAGCACGAGCTACATCGAGAAGCACCTGCGGCTGCCCGTCGTCT
GCACCCCCACCGGCGTCAAGCACCTGCACCACGCGGCTTGCCAGTTCGACATTGGCGTCTACTTCGAGGCCAACG
GCCATGGGACCGTCGTCTTCTCGCAGGAGGCCATGCGCGTCTTCCGCGACAAGGAGCCCCAGTCGCCCGCGCAAA
AGGACGCGCTCGAGACGCTCACGGCCGTCGGCGAGCTCATCAACCAGACGGTCGGCGACGCCATCACCGACATGC
TCCTGGTCGAGGTCATCCTCGCCCACAAGGGCTGGACGCTCAAGGACTGGGCCATGACGTACACGGACCTGCCCA
ACCGCCTCGTGCGCGTCGAGGTCGGCAACAAGGACCTCTTCAAGGCCACCGACGCCGAGCGTCGCCTCAGCCACC
CGGCCCGCGCCCAGGACGCGATCGACCAGGTGGTGCGCAAGTACACGACGGCCCGCTCCTTCGCGCGCGCCAGCG
GCACCGAGAACGCGTGCCGCGTCTACGCCGAGGCGGCGACCCGGTCCGAGGCCGACGAGCTGGCCAACAAGGTGG
CCCAGATCGTCAAGCAATTCGGCTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail