Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8164
Gene name
LocationContig_515:7502..9079
Strand+
Gene length (bp)1577
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 3.6E-10 59 156
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 5.2E-10 54 128
PF13847 Methyltransf_31 Methyltransferase domain 2.6E-08 55 157
PF08241 Methyltransf_11 Methyltransferase domain 3.6E-07 60 158
PF08003 Methyltransf_9 Protein of unknown function (DUF1698) 2.3E-06 25 157

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URX7|ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt1 PE=1 SV=2 16 340 1.0E-147
sp|P38074|HMT1_YEAST Protein arginine N-methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMT1 PE=1 SV=1 6 339 2.0E-144
sp|A8IEF3|ANM1_CHLRE Protein arginine N-methyltransferase 1 OS=Chlamydomonas reinhardtii GN=PRMT1 PE=1 SV=1 16 323 1.0E-130
sp|Q28F07|ANM1_XENTR Protein arginine N-methyltransferase 1 OS=Xenopus tropicalis GN=prmt1 PE=2 SV=1 16 322 8.0E-130
sp|Q9SU94|ANM11_ARATH Protein arginine N-methyltransferase 1.1 OS=Arabidopsis thaliana GN=PRMT11 PE=1 SV=1 16 322 2.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URX7|ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt1 PE=1 SV=2 16 340 1.0E-147
sp|P38074|HMT1_YEAST Protein arginine N-methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMT1 PE=1 SV=1 6 339 2.0E-144
sp|A8IEF3|ANM1_CHLRE Protein arginine N-methyltransferase 1 OS=Chlamydomonas reinhardtii GN=PRMT1 PE=1 SV=1 16 323 1.0E-130
sp|Q28F07|ANM1_XENTR Protein arginine N-methyltransferase 1 OS=Xenopus tropicalis GN=prmt1 PE=2 SV=1 16 322 8.0E-130
sp|Q9SU94|ANM11_ARATH Protein arginine N-methyltransferase 1.1 OS=Arabidopsis thaliana GN=PRMT11 PE=1 SV=1 16 322 2.0E-129
sp|Q8AV13|ANM1A_XENLA Protein arginine N-methyltransferase 1-A OS=Xenopus laevis GN=prmt1-a PE=1 SV=1 16 323 3.0E-129
sp|Q6VRB0|ANM1B_XENLA Protein arginine N-methyltransferase 1-B OS=Xenopus laevis GN=prmt1-b PE=2 SV=1 16 322 5.0E-129
sp|Q99873|ANM1_HUMAN Protein arginine N-methyltransferase 1 OS=Homo sapiens GN=PRMT1 PE=1 SV=2 16 330 8.0E-129
sp|Q0J2C6|ANM1_ORYSJ Probable protein arginine N-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=PRMT1 PE=2 SV=1 16 322 8.0E-129
sp|A2Z0C0|ANM1_ORYSI Probable protein arginine N-methyltransferase 1 OS=Oryza sativa subsp. indica GN=PRMT1 PE=3 SV=1 16 322 8.0E-129
sp|Q63009|ANM1_RAT Protein arginine N-methyltransferase 1 OS=Rattus norvegicus GN=Prmt1 PE=1 SV=1 16 330 2.0E-128
sp|Q9JIF0|ANM1_MOUSE Protein arginine N-methyltransferase 1 OS=Mus musculus GN=Prmt1 PE=1 SV=1 16 330 4.0E-128
sp|Q54EF2|ANM1_DICDI Protein arginine N-methyltransferase 1 OS=Dictyostelium discoideum GN=prmt1 PE=3 SV=1 6 339 4.0E-128
sp|O82210|ANM12_ARATH Probable protein arginine N-methyltransferase 1.2 OS=Arabidopsis thaliana GN=PRMT12 PE=1 SV=1 16 323 4.0E-126
sp|Q6PAK3|ANM8_MOUSE Protein arginine N-methyltransferase 8 OS=Mus musculus GN=Prmt8 PE=1 SV=2 16 322 4.0E-124
sp|Q9NR22|ANM8_HUMAN Protein arginine N-methyltransferase 8 OS=Homo sapiens GN=PRMT8 PE=1 SV=2 16 322 5.0E-124
sp|Q5RGQ2|ANM8B_DANRE Protein arginine N-methyltransferase 8-B OS=Danio rerio GN=prmt8b PE=2 SV=2 16 323 6.0E-123
sp|O60678|ANM3_HUMAN Protein arginine N-methyltransferase 3 OS=Homo sapiens GN=PRMT3 PE=1 SV=3 20 316 3.0E-103
sp|O70467|ANM3_RAT Protein arginine N-methyltransferase 3 OS=Rattus norvegicus GN=Prmt3 PE=1 SV=1 20 314 1.0E-101
sp|Q922H1|ANM3_MOUSE Protein arginine N-methyltransferase 3 OS=Mus musculus GN=Prmt3 PE=1 SV=2 20 314 4.0E-99
sp|O13648|ANM3_SCHPO Ribosomal protein arginine N-methyltransferase rmt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmt3 PE=1 SV=3 16 323 3.0E-77
sp|Q08A71|ANM6_ARATH Probable protein arginine N-methyltransferase 6 OS=Arabidopsis thaliana GN=PRMT6 PE=2 SV=1 20 320 4.0E-76
sp|Q7XKC0|ANM61_ORYSJ Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. japonica GN=PRMT6.1 PE=3 SV=2 13 319 8.0E-75
sp|A2XYY8|ANM61_ORYSI Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. indica GN=PRMT6.1 PE=3 SV=1 13 319 4.0E-74
sp|Q75G68|ANM62_ORYSJ Probable protein arginine N-methyltransferase 6.2 OS=Oryza sativa subsp. japonica GN=PRMT6.2 PE=2 SV=1 20 320 3.0E-73
sp|A2Z8S0|ANM62_ORYSI Probable protein arginine N-methyltransferase 6.2 OS=Oryza sativa subsp. indica GN=PRMT6.2 PE=3 SV=2 20 320 3.0E-73
sp|A3BMN9|ANM3_ORYSJ Probable protein arginine N-methyltransferase 3 OS=Oryza sativa subsp. japonica GN=PRMT3 PE=2 SV=1 1 298 8.0E-68
sp|A2YP56|ANM3_ORYSI Probable protein arginine N-methyltransferase 3 OS=Oryza sativa subsp. indica GN=PRMT3 PE=3 SV=1 1 298 9.0E-68
sp|B0JYW5|ANM6_XENTR Protein arginine N-methyltransferase 6 OS=Xenopus tropicalis GN=prmt6 PE=2 SV=1 5 325 1.0E-65
sp|Q68EZ3|ANM6_XENLA Protein arginine N-methyltransferase 6 OS=Xenopus laevis GN=prmt6 PE=2 SV=1 5 325 7.0E-64
sp|Q6NWG4|ANM6_DANRE Protein arginine N-methyltransferase 6 OS=Danio rerio GN=prmt6 PE=2 SV=2 9 320 1.0E-63
sp|Q0WVD6|ANM3_ARATH Probable protein arginine N-methyltransferase 3 OS=Arabidopsis thaliana GN=PRMT3 PE=2 SV=1 18 292 2.0E-62
sp|Q6NZB1|ANM6_MOUSE Protein arginine N-methyltransferase 6 OS=Mus musculus GN=Prmt6 PE=1 SV=2 17 322 3.0E-62
sp|Q96LA8|ANM6_HUMAN Protein arginine N-methyltransferase 6 OS=Homo sapiens GN=PRMT6 PE=1 SV=1 7 322 2.0E-61
sp|P55345|ANM2_HUMAN Protein arginine N-methyltransferase 2 OS=Homo sapiens GN=PRMT2 PE=1 SV=1 17 324 3.0E-59
sp|Q5E9L5|ANM6_BOVIN Protein arginine N-methyltransferase 6 OS=Bos taurus GN=PRMT6 PE=2 SV=1 17 322 3.0E-58
sp|B3DLB3|ANM2_XENTR Protein arginine N-methyltransferase 2 OS=Xenopus tropicalis GN=prmt2 PE=2 SV=1 17 320 6.0E-58
sp|Q9R144|ANM2_MOUSE Protein arginine N-methyltransferase 2 OS=Mus musculus GN=Prmt2 PE=1 SV=1 17 298 6.0E-56
sp|Q9SNQ2|ANM10_ORYSJ Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. japonica GN=PRMT10 PE=2 SV=1 19 322 3.0E-55
sp|A2Y953|ANM10_ORYSI Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. indica GN=PRMT10 PE=3 SV=1 19 322 3.0E-55
sp|Q54HI0|ANM2_DICDI Protein arginine N-methyltransferase 2 OS=Dictyostelium discoideum GN=prmt2 PE=3 SV=1 15 259 2.0E-54
sp|D9IVE5|ANM2_XENLA Protein arginine N-methyltransferase 2 OS=Xenopus laevis GN=prmt2 PE=1 SV=2 17 320 6.0E-53
sp|Q86X55|CARM1_HUMAN Histone-arginine methyltransferase CARM1 OS=Homo sapiens GN=CARM1 PE=1 SV=3 14 316 4.0E-52
sp|Q9WVG6|CARM1_MOUSE Histone-arginine methyltransferase CARM1 OS=Mus musculus GN=Carm1 PE=1 SV=2 14 316 6.0E-52
sp|Q4AE70|CARM1_RAT Histone-arginine methyltransferase CARM1 OS=Rattus norvegicus GN=Carm1 PE=1 SV=1 14 316 1.0E-51
sp|Q5XK84|CARM1_XENLA Histone-arginine methyltransferase CARM1 OS=Xenopus laevis GN=carm1 PE=2 SV=1 14 316 8.0E-51
sp|B4PVH6|CARM1_DROYA Histone-arginine methyltransferase CARMER OS=Drosophila yakuba GN=Art4 PE=3 SV=1 14 321 2.0E-50
sp|Q29B63|CARM1_DROPS Histone-arginine methyltransferase CARMER OS=Drosophila pseudoobscura pseudoobscura GN=Art4 PE=3 SV=1 14 321 2.0E-50
sp|B4GZ20|CARM1_DROPE Histone-arginine methyltransferase CARMER OS=Drosophila persimilis GN=Art4 PE=3 SV=1 14 321 2.0E-50
sp|Q9VH48|CARM1_DROME Probable histone-arginine methyltransferase CARMER OS=Drosophila melanogaster GN=Art4 PE=1 SV=1 14 321 3.0E-50
sp|B4QVW6|CARM1_DROSI Histone-arginine methyltransferase CARMER OS=Drosophila simulans GN=Art4 PE=3 SV=1 14 321 3.0E-50
sp|B3M1E1|CARM1_DROAN Histone-arginine methyltransferase CARMER OS=Drosophila ananassae GN=Art4 PE=3 SV=1 14 321 3.0E-50
sp|B3P4N5|CARM1_DROER Histone-arginine methyltransferase CARMER OS=Drosophila erecta GN=Art4 PE=3 SV=1 14 321 3.0E-50
sp|B4HJC0|CARM1_DROSE Histone-arginine methyltransferase CARMER OS=Drosophila sechellia GN=Art4 PE=3 SV=1 14 321 3.0E-50
sp|B4JXV2|CARM1_DROGR Histone-arginine methyltransferase CARMER OS=Drosophila grimshawi GN=Art4 PE=3 SV=1 14 321 5.0E-50
sp|B4KA23|CARM1_DROMO Histone-arginine methyltransferase CARMER OS=Drosophila mojavensis GN=Art4 PE=3 SV=1 14 321 7.0E-50
sp|Q9MAT5|ANM10_ARATH Protein arginine N-methyltransferase PRMT10 OS=Arabidopsis thaliana GN=PRMT10 PE=1 SV=1 19 323 7.0E-50
sp|B4LVS8|CARM1_DROVI Histone-arginine methyltransferase CARMER OS=Drosophila virilis GN=Art4 PE=3 SV=1 14 321 8.0E-50
sp|B4NKI9|CARM1_DROWI Histone-arginine methyltransferase CARMER OS=Drosophila willistoni GN=Art4 PE=3 SV=1 14 321 1.0E-49
sp|Q6DC04|CARM1_DANRE Histone-arginine methyltransferase CARM1 OS=Danio rerio GN=carm1 PE=2 SV=1 14 316 1.0E-49
sp|Q7XI75|CARM1_ORYSJ Probable histone-arginine methyltransferase CARM1 OS=Oryza sativa subsp. japonica GN=CARM1 PE=2 SV=1 16 336 5.0E-49
sp|A2YPT7|CARM1_ORYSI Probable histone-arginine methyltransferase CARM1 OS=Oryza sativa subsp. indica GN=CARM1 PE=3 SV=2 16 336 5.0E-49
sp|B0W3L6|CARM1_CULQU Histone-arginine methyltransferase CARMER OS=Culex quinquefasciatus GN=Art4 PE=3 SV=1 9 321 4.0E-48
sp|Q7Q2B7|CARM1_ANOGA Histone-arginine methyltransferase CARMER OS=Anopheles gambiae GN=CARM1 PE=1 SV=5 9 321 6.0E-48
sp|A3KPF2|ANM14_ARATH Probable histone-arginine methyltransferase 1.4 OS=Arabidopsis thaliana GN=PRMT14 PE=1 SV=1 16 304 6.0E-48
sp|Q84W92|ANM13_ARATH Probable histone-arginine methyltransferase 1.3 OS=Arabidopsis thaliana GN=PRMT13 PE=2 SV=3 16 316 5.0E-47
sp|Q174R2|CARM1_AEDAE Histone-arginine methyltransferase CARMER OS=Aedes aegypti GN=CARM1 PE=3 SV=1 9 321 3.0E-46
sp|Q6PCI6|ANM7_XENLA Protein arginine N-methyltransferase 7 OS=Xenopus laevis GN=prmt7 PE=2 SV=1 24 296 2.0E-16
sp|Q582G4|ANM7_TRYB2 Protein arginine N-methyltransferase 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PRMT7 PE=1 SV=1 30 257 1.0E-15
sp|Q6P2P2|ANM9_HUMAN Putative protein arginine N-methyltransferase 9 OS=Homo sapiens GN=PRMT9 PE=2 SV=1 33 305 2.0E-15
sp|A0JMU5|ANM9_XENLA Putative protein arginine N-methyltransferase 9 OS=Xenopus laevis GN=prmt9 PE=2 SV=1 30 289 3.0E-14
sp|Q5VS72|ANM7_ORYSJ Protein arginine N-methyltransferase 7 OS=Oryza sativa subsp. japonica GN=PRMT7 PE=2 SV=1 32 333 1.0E-13
sp|A2Y8B9|ANM7_ORYSI Protein arginine N-methyltransferase 7 OS=Oryza sativa subsp. indica GN=PRMT7 PE=3 SV=3 32 333 1.0E-13
sp|Q3U3W5|ANM9_MOUSE Putative protein arginine N-methyltransferase 9 OS=Mus musculus GN=Prmt9 PE=2 SV=2 33 305 1.0E-13
sp|Q5U4E8|ANM7_RAT Protein arginine N-methyltransferase 7 OS=Rattus norvegicus GN=Prmt7 PE=2 SV=1 24 295 1.0E-13
sp|Q9NVM4|ANM7_HUMAN Protein arginine N-methyltransferase 7 OS=Homo sapiens GN=PRMT7 PE=1 SV=1 24 295 2.0E-13
sp|A2AV36|ANM7_DANRE Protein arginine N-methyltransferase 7 OS=Danio rerio GN=prmt7 PE=2 SV=1 13 298 2.0E-13
sp|Q922X9|ANM7_MOUSE Protein arginine N-methyltransferase 7 OS=Mus musculus GN=Prmt7 PE=1 SV=1 24 295 5.0E-13
sp|Q99MI9|ANM7_CRILO Protein arginine N-methyltransferase 7 OS=Cricetulus longicaudatus GN=Prmt7 PE=1 SV=3 24 295 3.0E-12
sp|A6QQV6|ANM7_BOVIN Protein arginine N-methyltransferase 7 OS=Bos taurus GN=PRMT7 PE=2 SV=1 24 295 5.0E-12
sp|B3MF31|ANM7_DROAN Protein arginine N-methyltransferase 7 OS=Drosophila ananassae GN=Art7 PE=3 SV=1 14 166 1.0E-11
sp|C3L3G5|PRMA_CLOB6 Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=prmA PE=3 SV=1 40 166 2.0E-11
sp|B3NP10|ANM7_DROER Protein arginine N-methyltransferase 7 OS=Drosophila erecta GN=Art7 PE=3 SV=1 14 292 7.0E-11
sp|B4I8G2|ANM7_DROSE Protein arginine N-methyltransferase 7 OS=Drosophila sechellia GN=Art7 PE=3 SV=1 14 292 1.0E-10
sp|Q5ZIB9|ANM7_CHICK Protein arginine N-methyltransferase 7 OS=Gallus gallus GN=PRMT7 PE=2 SV=1 24 299 2.0E-10
sp|Q9W1V1|ANM7_DROME Protein arginine N-methyltransferase 7 OS=Drosophila melanogaster GN=Art7 PE=2 SV=4 14 259 2.0E-10
sp|B4QI55|ANM7_DROSI Protein arginine N-methyltransferase 7 OS=Drosophila simulans GN=Art7 PE=3 SV=1 14 292 2.0E-10
sp|Q16NS8|ANM7_AEDAE Protein arginine N-methyltransferase 7 OS=Aedes aegypti GN=Art7 PE=3 SV=1 32 171 2.0E-10
sp|B4P925|ANM7_DROYA Protein arginine N-methyltransferase 7 OS=Drosophila yakuba GN=Art7 PE=3 SV=1 14 166 3.0E-10
sp|B4JWL5|ANM7_DROGR Protein arginine N-methyltransferase 7 OS=Drosophila grimshawi GN=Art7 PE=3 SV=1 14 259 4.0E-10
sp|A7GHH4|PRMA_CLOBL Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=prmA PE=3 SV=1 40 116 4.0E-10
sp|B1ILM1|PRMA_CLOBK Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=prmA PE=3 SV=1 40 116 4.0E-10
sp|C1FVT8|PRMA_CLOBJ Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=prmA PE=3 SV=1 40 116 4.0E-10
sp|A5I638|PRMA_CLOBH Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=prmA PE=3 SV=1 40 116 4.0E-10
sp|A7FXL3|PRMA_CLOB1 Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=prmA PE=3 SV=1 40 116 4.0E-10
sp|B1KZN5|PRMA_CLOBM Ribosomal protein L11 methyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=prmA PE=3 SV=1 40 116 4.0E-10
sp|B4MNL1|ANM7_DROWI Protein arginine N-methyltransferase 7 OS=Drosophila willistoni GN=Art7 PE=3 SV=1 32 166 1.0E-09
sp|Q7QIL2|ANM7_ANOGA Protein arginine N-methyltransferase 7 OS=Anopheles gambiae GN=Art7 PE=3 SV=4 40 171 6.0E-09
sp|Q9XW42|ANM7_CAEEL Protein arginine N-methyltransferase 7 OS=Caenorhabditis elegans GN=prmt-7 PE=1 SV=2 47 301 7.0E-09
sp|B5DZN7|ANM7_DROPS Protein arginine N-methyltransferase 7 OS=Drosophila pseudoobscura pseudoobscura GN=Art7 PE=3 SV=1 14 166 4.0E-08
sp|B4GA28|ANM7_DROPE Protein arginine N-methyltransferase 7 OS=Drosophila persimilis GN=Art7 PE=3 SV=1 14 166 4.0E-08
sp|B8I303|PRMA_CLOCE Ribosomal protein L11 methyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=prmA PE=3 SV=1 42 153 8.0E-08
sp|B0X4N1|ANM7_CULQU Protein arginine N-methyltransferase 7 OS=Culex quinquefasciatus GN=Art7 PE=3 SV=1 59 171 1.0E-07
sp|Q9CLW2|PRMA_PASMU Ribosomal protein L11 methyltransferase OS=Pasteurella multocida (strain Pm70) GN=prmA PE=3 SV=1 54 128 4.0E-07
sp|A5UIB7|PRMA_HAEIG Ribosomal protein L11 methyltransferase OS=Haemophilus influenzae (strain PittGG) GN=prmA PE=3 SV=1 54 128 5.0E-07
sp|A5UD93|PRMA_HAEIE Ribosomal protein L11 methyltransferase OS=Haemophilus influenzae (strain PittEE) GN=prmA PE=3 SV=1 54 128 5.0E-07
sp|A6VM22|PRMA_ACTSZ Ribosomal protein L11 methyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=prmA PE=3 SV=1 57 128 2.0E-06
sp|P44402|PRMA_HAEIN Ribosomal protein L11 methyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=prmA PE=3 SV=1 54 129 2.0E-06
sp|Q4QLT2|PRMA_HAEI8 Ribosomal protein L11 methyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=prmA PE=3 SV=1 54 128 3.0E-06
sp|A6LRN8|PRMA_CLOB8 Ribosomal protein L11 methyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=prmA PE=3 SV=1 40 128 3.0E-06
sp|A0Q1R2|PRMA_CLONN Ribosomal protein L11 methyltransferase OS=Clostridium novyi (strain NT) GN=prmA PE=3 SV=1 51 116 7.0E-06
sp|A3DF23|PRMA_CLOTH Ribosomal protein L11 methyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=prmA PE=3 SV=1 44 157 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8164
MEVEMAEEKMKALEHSEQHYFKSYDHHGIHEEMLKDEVRTRSYMNAIVQNKHLFKDKVVLDVGCGTAILSMFAVK
AGAKHVIGVDMSSIIFKAREIVKANGMADKITLIQGKMEEVQLPFPKVDIIISEWMGYFLLYESMLDTVLYARDR
YLEKDGLIFPDKATIFFAGIEDGDYKEEKIGFWDNVYGFDYTPLKETALSEPLVDTVELKTVVTDPTSVLTLDLY
TCTTADLAFTTPFKLSVKRDDFIHALVAWFDIDFTACHKPIRFSTGPHTKYTHWKQTVFYFKEVLTVQQGEEVQC
KLRVKPNAKNRRDLDIDFEYELETGDVTRSAAGKCEYHMC*
Coding >Hirsu2|8164
ATGGAGGTTGAGATGGCCGAGGAGAAGATGAAGGCGCTCGAGCACAGCGAGCAGCACTACTTCAAGAGCTACGAC
CACCATGGGATTCACGAGGAGATGCTGAAAGATGAAGTGCGCACGCGGTCGTACATGAACGCCATCGTCCAGAAC
AAGCACCTTTTCAAGGACAAGGTTGTCCTCGACGTCGGATGCGGCACCGCCATCCTGTCCATGTTCGCCGTCAAG
GCCGGTGCCAAACACGTCATCGGCGTCGACATGTCGTCCATCATCTTCAAGGCCCGCGAGATCGTCAAGGCCAAC
GGCATGGCCGACAAGATCACGCTCATCCAGGGCAAAATGGAGGAGGTGCAGCTGCCCTTCCCCAAGGTCGACATC
ATCATCTCCGAGTGGATGGGCTACTTCCTGCTCTACGAATCCATGCTCGACACCGTCCTCTATGCCCGCGACCGG
TACCTCGAAAAGGATGGCCTGATATTCCCCGACAAGGCCACCATCTTCTTCGCCGGCATCGAGGATGGCGACTAC
AAGGAGGAGAAGATTGGATTCTGGGACAACGTGTACGGGTTCGACTACACGCCCCTGAAGGAGACGGCCCTGTCG
GAGCCGCTGGTCGACACCGTCGAGCTCAAGACGGTCGTCACCGACCCCACCTCGGTCCTCACCCTGGACCTCTAC
ACGTGCACCACGGCCGACCTCGCCTTCACGACGCCCTTCAAGCTGTCGGTCAAGCGCGACGACTTCATCCACGCC
CTGGTCGCCTGGTTCGACATCGACTTCACCGCCTGCCACAAGCCAATCCGCTTCTCGACCGGCCCGCACACCAAG
TACACGCACTGGAAGCAGACCGTCTTCTACTTCAAGGAGGTCCTGACCGTCCAGCAGGGCGAGGAGGTGCAGTGC
AAGCTGCGCGTCAAGCCCAATGCCAAGAACCGGCGCGACCTCGACATCGACTTCGAGTACGAGCTCGAGACGGGC
GACGTCACCCGCTCGGCCGCCGGCAAGTGCGAGTATCACATGTGCTGA
Transcript >Hirsu2|8164
ATGGAGGTTGAGATGGCCGAGGAGAAGATGAAGGCGCTCGAGCACAGCGAGCAGCACTACTTCAAGAGCTACGAC
CACCATGGGATTCACGAGGAGATGCTGAAAGATGAAGTGCGCACGCGGTCGTACATGAACGCCATCGTCCAGAAC
AAGCACCTTTTCAAGGACAAGGTTGTCCTCGACGTCGGATGCGGCACCGCCATCCTGTCCATGTTCGCCGTCAAG
GCCGGTGCCAAACACGTCATCGGCGTCGACATGTCGTCCATCATCTTCAAGGCCCGCGAGATCGTCAAGGCCAAC
GGCATGGCCGACAAGATCACGCTCATCCAGGGCAAAATGGAGGAGGTGCAGCTGCCCTTCCCCAAGGTCGACATC
ATCATCTCCGAGTGGATGGGCTACTTCCTGCTCTACGAATCCATGCTCGACACCGTCCTCTATGCCCGCGACCGG
TACCTCGAAAAGGATGGCCTGATATTCCCCGACAAGGCCACCATCTTCTTCGCCGGCATCGAGGATGGCGACTAC
AAGGAGGAGAAGATTGGATTCTGGGACAACGTGTACGGGTTCGACTACACGCCCCTGAAGGAGACGGCCCTGTCG
GAGCCGCTGGTCGACACCGTCGAGCTCAAGACGGTCGTCACCGACCCCACCTCGGTCCTCACCCTGGACCTCTAC
ACGTGCACCACGGCCGACCTCGCCTTCACGACGCCCTTCAAGCTGTCGGTCAAGCGCGACGACTTCATCCACGCC
CTGGTCGCCTGGTTCGACATCGACTTCACCGCCTGCCACAAGCCAATCCGCTTCTCGACCGGCCCGCACACCAAG
TACACGCACTGGAAGCAGACCGTCTTCTACTTCAAGGAGGTCCTGACCGTCCAGCAGGGCGAGGAGGTGCAGTGC
AAGCTGCGCGTCAAGCCCAATGCCAAGAACCGGCGCGACCTCGACATCGACTTCGAGTACGAGCTCGAGACGGGC
GACGTCACCCGCTCGGCCGCCGGCAAGTGCGAGTATCACATGTGCTGA
Gene >Hirsu2|8164
ATGGAGGTTGAGATGGCCGAGGAGAAGATGAAGGCGCTCGAGCACAGCGAGCAGCACTACTTCAAGAGGTCAGCA
CATCCGCATCGCGCCCTGTGCCACTGAGACCTTCTTTCCGTTGGCCCTGGCCCCGCCGTATGTGTTGTCCACGAT
GCTGACTCGGAGGCGCTTGACGGCTGCAGCTACGACCACCATGGTACTTGACAATCTACTCGTCCTGAGACTTCA
AATAAGCAAACTGTTCGATCTGGACCGCGGCTAATCGTTGTCTTTCCATGCGACTCTGTACACGACCAAAAGGGA
TTCACGAGGAGATGCTGGTAAGCTTGCGCCCCCGTCCCCCGCCGCCGTGGGAAGAGCCAGAACGCCGGTCTTGAC
GACCGCCTGGCCTCGCCGTGTCGCATCTTGTCGCGCCTGCGAGGCAGTCTCCTGCGCTCGTCCTGGCCCATCTCG
GATGCTGACGCCGCTGGGTGACGCAGAAAGATGAAGTGCGCACGCGGTCGTACATGAACGCCATCGTCCAGAACA
AGCACCTTTTCAAGGACAAGGTTGTCCTCGACGTCGGATGCGGCACCGCCATCCTGTCCATGTACGTCGCCTCCT
CTGTTCCTCGGACGGCGGACCTTGTTCGCCCTTGTACTCCCCCCTTGCCAGACGCCCACACCGAACGCGTCGCTC
AACCGCCGCAGGTTCGCCGTCAAGGCCGGTGCCAAACACGTCATCGGCGTCGACATGTCGTCCATCATCTTCAAG
GCCCGCGAGATCGTCAAGGCCAACGGCATGGCCGACAAGATCACGCTCATCCAGGGCAAAATGGAGGAGGTGCAG
CTGCCCTTCCCCAAGGTCGACATCATCATCTCCGAGTGGATGGGCTACTTCCTGCTCTACGAATCCATGCTCGAC
ACCGTCCTCTATGCCCGCGACCGGTACCTCGAAAAGGATGGCCTGATATTCCCCGACAAGGCCACCATCTTCTTC
GCCGGCATCGAGGATGGCGACTACAAGGAGGAGAAGATTGGATGTGAGCGCGCCCCCCCCCCTCTCCGCCCTTGT
CTGTCCCCCCTCCGTCGGGGACCGGCCCGGCTGACCTGGACTCACCAGTCTGGGACAACGTGTACGGGTTCGACT
ACACGCCCCTGAAGGAGACGGCCCTGTCGGAGCCGCTGGTCGACACCGTCGAGCTCAAGACGGTCGTCACCGACC
CCACCTCGGTCCTCACCCTGGACCTCTACACGTGCACCACGGCCGACCTCGCCTTCACGACGCCCTTCAAGCTGT
CGGTCAAGCGCGACGACTTCATCCACGCCCTGGTCGCCTGGTTCGACATCGACTTCACCGCCTGCCACAAGCCAA
TCCGCTTCTCGACCGGCCCGCACACCAAGTACACGCACTGGAAGCAGACCGTCTTCTACTTCAAGGAGGTCCTGA
CCGTCCAGCAGGGCGAGGAGGTGCAGTGCAAGCTGCGCGTCAAGCCCAATGCCAAGAACCGGCGCGACCTCGACA
TCGACTTCGAGTACGAGCTCGAGACGGGCGACGTCACCCGCTCGGCCGCCGGCAAGTGCGAGTATCACATGTGCT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail