Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8162
Gene name
LocationContig_515:1085..1933
Strand+
Gene length (bp)848
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01201 Ribosomal_S8e Ribosomal protein S8e 6.1E-43 35 259

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6S4J2|NSA2_BOTFB Ribosome biogenesis protein nsa2 OS=Botryotinia fuckeliana (strain B05.10) GN=nsa2 PE=3 SV=1 7 260 1.0E-156
sp|Q5B954|NSA2_EMENI Ribosome biogenesis protein nsa2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nsa2 PE=3 SV=2 1 260 3.0E-155
sp|Q0UV95|NSA2_PHANO Ribosome biogenesis protein NSA2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NSA2 PE=3 SV=1 1 260 4.0E-154
sp|Q7SGE1|NSA2_NEUCR Ribosome biogenesis protein nsa2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nsa2 PE=3 SV=1 1 260 2.0E-152
sp|A6R3Q6|NSA2_AJECN Ribosome biogenesis protein NSA2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=NSA2 PE=3 SV=1 1 260 2.0E-151
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6S4J2|NSA2_BOTFB Ribosome biogenesis protein nsa2 OS=Botryotinia fuckeliana (strain B05.10) GN=nsa2 PE=3 SV=1 7 260 1.0E-156
sp|Q5B954|NSA2_EMENI Ribosome biogenesis protein nsa2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nsa2 PE=3 SV=2 1 260 3.0E-155
sp|Q0UV95|NSA2_PHANO Ribosome biogenesis protein NSA2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NSA2 PE=3 SV=1 1 260 4.0E-154
sp|Q7SGE1|NSA2_NEUCR Ribosome biogenesis protein nsa2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nsa2 PE=3 SV=1 1 260 2.0E-152
sp|A6R3Q6|NSA2_AJECN Ribosome biogenesis protein NSA2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=NSA2 PE=3 SV=1 1 260 2.0E-151
sp|A1CJS8|NSA2_ASPCL Ribosome biogenesis protein nsa2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nsa2 PE=3 SV=1 5 260 5.0E-150
sp|A1D7P0|NSA2_NEOFI Ribosome biogenesis protein nsa2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nsa2 PE=3 SV=2 4 260 1.0E-149
sp|Q4WX36|NSA2_ASPFU Ribosome biogenesis protein nsa2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nsa2 PE=3 SV=2 4 260 4.0E-149
sp|Q1DQ27|NSA2_COCIM Ribosome biogenesis protein NSA2 OS=Coccidioides immitis (strain RS) GN=NSA2 PE=3 SV=2 1 260 8.0E-149
sp|Q4P3S7|NSA2_USTMA Ribosome biogenesis protein NSA2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NSA2 PE=3 SV=2 1 260 7.0E-130
sp|Q9UU79|NSA2_SCHPO Ribosome biogenesis protein nsa2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nsa2 PE=1 SV=1 1 260 2.0E-128
sp|Q6C6D1|NSA2_YARLI Ribosome biogenesis protein NSA2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NSA2 PE=3 SV=1 1 260 9.0E-127
sp|A5DZE1|NSA2_LODEL Ribosome biogenesis protein NSA2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NSA2 PE=3 SV=1 1 260 2.0E-125
sp|A5DCN7|NSA2_PICGU Ribosome biogenesis protein NSA2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NSA2 PE=3 SV=2 1 260 1.0E-124
sp|P0CQ60|NSA2_CRYNJ Ribosome biogenesis protein NSA2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NSA2 PE=3 SV=1 7 260 2.0E-124
sp|P0CQ61|NSA2_CRYNB Ribosome biogenesis protein NSA2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NSA2 PE=3 SV=1 7 260 2.0E-124
sp|A3LQ06|NSA2_PICST Ribosome biogenesis protein NSA2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NSA2 PE=3 SV=1 1 260 7.0E-124
sp|A7TIZ1|NSA2_VANPO Ribosome biogenesis protein NSA2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NSA2 PE=3 SV=1 1 260 1.0E-123
sp|Q6CNC5|NSA2_KLULA Ribosome biogenesis protein NSA2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NSA2 PE=3 SV=1 1 260 3.0E-123
sp|Q5A2Y7|NSA2_CANAL Ribosome biogenesis protein NSA2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NSA2 PE=3 SV=1 1 260 9.0E-123
sp|Q6BU14|NSA2_DEBHA Ribosome biogenesis protein NSA2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NSA2 PE=3 SV=1 1 260 1.0E-122
sp|Q75CG9|NSA2_ASHGO Ribosome biogenesis protein NSA2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NSA2 PE=3 SV=1 1 260 1.0E-122
sp|P40078|NSA2_YEAST Ribosome biogenesis protein NSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSA2 PE=1 SV=1 1 260 1.0E-121
sp|A6ZR80|NSA2_YEAS7 Ribosome biogenesis protein NSA2 OS=Saccharomyces cerevisiae (strain YJM789) GN=NSA2 PE=3 SV=1 1 260 1.0E-121
sp|O95478|NSA2_HUMAN Ribosome biogenesis protein NSA2 homolog OS=Homo sapiens GN=NSA2 PE=1 SV=1 1 260 1.0E-119
sp|Q3SX11|NSA2_BOVIN Ribosome biogenesis protein NSA2 homolog OS=Bos taurus GN=NSA2 PE=2 SV=1 1 260 2.0E-119
sp|Q9CR47|NSA2_MOUSE Ribosome biogenesis protein NSA2 homolog OS=Mus musculus GN=Nsa2 PE=2 SV=1 1 260 2.0E-119
sp|Q6FN72|NSA2_CANGA Ribosome biogenesis protein NSA2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NSA2 PE=3 SV=1 1 260 2.0E-119
sp|Q9QYU7|NSA2_RAT Ribosome biogenesis protein NSA2 homolog OS=Rattus norvegicus GN=Nsa2 PE=2 SV=2 1 260 5.0E-118
sp|Q54GN8|NSA2_DICDI Ribosome biogenesis protein NSA2 homolog OS=Dictyostelium discoideum GN=nsa2 PE=3 SV=1 1 260 2.0E-116
sp|Q6L0D3|RS8E_PICTO 30S ribosomal protein S8e OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps8e PE=3 SV=2 158 259 2.0E-06
sp|A2BK08|RS8E_HYPBU 30S ribosomal protein S8e OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps8e PE=3 SV=1 139 259 4.0E-06
sp|Q0W1L5|RS8E_METAR 30S ribosomal protein S8e OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps8e PE=3 SV=1 176 259 7.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3411 0.6554 0.0352 0.0404 0.1562 0.0179 0.0654 0.019 0.0018 0.0004

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5665
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2818
Ophiocordyceps australis map64 (Brazil) OphauB2|7783
Ophiocordyceps camponoti-floridani Ophcf2|07362
Ophiocordyceps kimflemingae Ophio5|7078
Ophiocordyceps subramaniannii Hirsu2|8162 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8162
MPQNEYMERWRKLHGRRLDHEERARKRTAREGHKASKDAQNLRGLRAKLYQKKRHNDKIQMKKTIRAHEERNVKA
ASEREPSTPMPAYLLDRNQPSAAKALSSAIKDKRAEKAARFSVPLPKVRGISEEEMFKVVKTGKKVQKKAWKRMV
TKPTFVGPDFTRRNPKYERFIRPMGLRYKKANVTHPQLAVTVQLPIISVKKNPQNPLYTQLGVLTKGTVIEVNVS
ELGLVTAGGKVVWGRYAQVTNNPENEGCINSVLLV*
Coding >Hirsu2|8162
ATGCCTCAGAACGAGTACATGGAGAGGTGGCGCAAGCTGCACGGGCGGCGGCTGGACCACGAGGAACGGGCTCGC
AAGCGCACGGCGCGAGAGGGCCACAAGGCGTCCAAGGACGCGCAGAACCTGCGCGGGCTGCGGGCGAAGCTGTAC
CAGAAGAAGCGGCACAACGACAAGATCCAGATGAAGAAGACGATACGGGCGCACGAGGAGCGCAACGTCAAGGCG
GCGTCGGAGCGCGAGCCGTCGACGCCGATGCCGGCGTACCTGCTGGACCGCAACCAGCCGTCGGCGGCCAAGGCG
CTGAGCAGCGCCATCAAGGACAAGCGGGCGGAGAAGGCGGCGCGGTTCAGCGTGCCGCTGCCCAAGGTGCGCGGC
ATCAGCGAGGAGGAGATGTTCAAGGTGGTCAAGACGGGCAAGAAGGTGCAGAAGAAGGCGTGGAAGCGGATGGTG
ACGAAGCCGACCTTTGTCGGGCCCGACTTCACCCGCCGCAACCCCAAGTACGAGCGCTTCATCCGCCCCATGGGC
CTGCGCTACAAGAAGGCCAACGTCACCCACCCGCAGCTGGCCGTCACCGTCCAGCTGCCCATCATCAGCGTCAAG
AAGAACCCGCAGAACCCGCTCTACACCCAGCTCGGCGTCCTGACCAAGGGCACCGTCATCGAGGTCAACGTCAGC
GAGCTCGGCCTCGTCACCGCCGGCGGCAAGGTCGTCTGGGGCCGCTACGCCCAGGTCACCAACAACCCGGAGAAC
GAGGGCTGCATCAACAGCGTGCTGCTGGTGTGA
Transcript >Hirsu2|8162
ATGCCTCAGAACGAGTACATGGAGAGGTGGCGCAAGCTGCACGGGCGGCGGCTGGACCACGAGGAACGGGCTCGC
AAGCGCACGGCGCGAGAGGGCCACAAGGCGTCCAAGGACGCGCAGAACCTGCGCGGGCTGCGGGCGAAGCTGTAC
CAGAAGAAGCGGCACAACGACAAGATCCAGATGAAGAAGACGATACGGGCGCACGAGGAGCGCAACGTCAAGGCG
GCGTCGGAGCGCGAGCCGTCGACGCCGATGCCGGCGTACCTGCTGGACCGCAACCAGCCGTCGGCGGCCAAGGCG
CTGAGCAGCGCCATCAAGGACAAGCGGGCGGAGAAGGCGGCGCGGTTCAGCGTGCCGCTGCCCAAGGTGCGCGGC
ATCAGCGAGGAGGAGATGTTCAAGGTGGTCAAGACGGGCAAGAAGGTGCAGAAGAAGGCGTGGAAGCGGATGGTG
ACGAAGCCGACCTTTGTCGGGCCCGACTTCACCCGCCGCAACCCCAAGTACGAGCGCTTCATCCGCCCCATGGGC
CTGCGCTACAAGAAGGCCAACGTCACCCACCCGCAGCTGGCCGTCACCGTCCAGCTGCCCATCATCAGCGTCAAG
AAGAACCCGCAGAACCCGCTCTACACCCAGCTCGGCGTCCTGACCAAGGGCACCGTCATCGAGGTCAACGTCAGC
GAGCTCGGCCTCGTCACCGCCGGCGGCAAGGTCGTCTGGGGCCGCTACGCCCAGGTCACCAACAACCCGGAGAAC
GAGGGCTGCATCAACAGCGTGCTGCTGGTGTGA
Gene >Hirsu2|8162
ATGGTAAGATTCTCGTCCGACAAATGCGCGCTACTCGAGGATGGCGCCGGTGCTGATTTCCTCGACAGCCTCAGA
ACGAGTACATGGAGAGGTGGCGCAAGCTGCACGGGCGGCGGCTGGACCACGAGGAACGGGCTCGCAAGCGCACGG
CGCGAGAGGGCCACAAGGCGTCCAAGGACGCGCAGAACCTGCGCGGGCTGCGGGCGAAGCTGTACCAGAAGAAGC
GGCACAACGACAAGATCCAGATGAAGAAGACGATACGGGCGCACGAGGAGCGCAACGTCAAGGCGGCGTCGGAGC
GCGAGCCGTCGACGCCGATGCCGGCGTACCTGCTGGACCGCAACCAGCCGTCGGCGGCCAAGGCGCTGAGCAGCG
CCATCAAGGACAAGCGGGCGGAGAAGGCGGCGCGGTTCAGCGTGCCGCTGCCCAAGGTGCGCGGCATCAGCGAGG
AGGAGATGTTCAAGGTGGTCAAGACGGGCAAGAAGGTGCAGAAGAAGGCGTGGAAGCGGATGGTGACGAAGCCGA
CCTTTGTCGGGCCCGACTTCACCCGCCGCAACCCCAAGTACGAGCGCTTCATCCGCCCCATGGGCCTGCGCTACA
AGAAGGCCAACGTCACCCACCCGCAGCTGGCCGTCACCGTCCAGCTGCCCATCATCAGCGTCAAGAAGAACCCGC
AGAACCCGCTCTACACCCAGCTCGGCGTCCTGACCAAGGGCACCGTCATCGAGGTCAACGTCAGCGAGCTCGGCC
TCGTCACCGCCGGCGGCAAGGTCGTCTGGGGCCGCTACGCCCAGGTCACCAACAACCCGGAGAACGAGGGCTGCA
TCAACAGCGTGCTGCTGGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail