Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|816
Gene name
LocationContig_117:21356..22726
Strand-
Gene length (bp)1370
Transcript length (bp)1311
Coding sequence length (bp)1311
Protein length (aa) 437

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00240 ubiquitin Ubiquitin family 1.2E-20 16 86
PF00627 UBA UBA/TS-N domain 2.5E-06 395 431
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 1.0E-05 14 84

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10169|DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph1 PE=3 SV=1 13 225 4.0E-41
sp|P48510|DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSK2 PE=1 SV=2 13 233 2.0E-35
sp|P48510|DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSK2 PE=1 SV=2 331 433 9.0E-21
sp|Q10169|DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph1 PE=3 SV=1 383 433 2.0E-18
sp|Q9SII9|DSK2A_ARATH Ubiquitin domain-containing protein DSK2a OS=Arabidopsis thaliana GN=DSK2A PE=1 SV=2 13 217 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10169|DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph1 PE=3 SV=1 13 225 4.0E-41
sp|P48510|DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSK2 PE=1 SV=2 13 233 2.0E-35
sp|P48510|DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSK2 PE=1 SV=2 331 433 9.0E-21
sp|Q10169|DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph1 PE=3 SV=1 383 433 2.0E-18
sp|Q9SII9|DSK2A_ARATH Ubiquitin domain-containing protein DSK2a OS=Arabidopsis thaliana GN=DSK2A PE=1 SV=2 13 217 2.0E-15
sp|Q9SII8|DSK2B_ARATH Ubiquitin domain-containing protein DSK2b OS=Arabidopsis thaliana GN=DSK2B PE=1 SV=1 15 281 4.0E-11
sp|Q9NIF3|UBQL_DICDI Ubiquilin OS=Dictyostelium discoideum GN=ubqln PE=1 SV=1 13 217 6.0E-11
sp|Q9SII8|DSK2B_ARATH Ubiquitin domain-containing protein DSK2b OS=Arabidopsis thaliana GN=DSK2B PE=1 SV=1 388 434 4.0E-08
sp|Q9SII9|DSK2A_ARATH Ubiquitin domain-containing protein DSK2a OS=Arabidopsis thaliana GN=DSK2A PE=1 SV=2 388 434 1.0E-07
sp|Q05120|UBIL_NPVOP Ubiquitin-like protein OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=V-UBI PE=3 SV=1 17 84 1.0E-07
sp|P49633|RL40_ACACA Ubiquitin-60S ribosomal protein L40 OS=Acanthamoeba castellanii PE=2 SV=2 17 84 1.0E-07
sp|Q9UHD9|UBQL2_HUMAN Ubiquilin-2 OS=Homo sapiens GN=UBQLN2 PE=1 SV=2 366 434 2.0E-07
sp|P59272|RS27A_DAUCA Ubiquitin-40S ribosomal protein S27a (Fragment) OS=Daucus carota PE=2 SV=2 17 84 2.0E-07
sp|P0CH10|RL403_CHLRE Ubiquitin-60S ribosomal protein L40 OS=Chlamydomonas reinhardtii GN=UBI3 PE=1 SV=1 17 84 2.0E-07
sp|P0CH11|RL401_CHLRE Ubiquitin-60S ribosomal protein L40 OS=Chlamydomonas reinhardtii GN=UBI1 PE=1 SV=1 17 84 2.0E-07
sp|Q42202|RL40B_ARATH Ubiquitin-60S ribosomal protein L40-2 OS=Arabidopsis thaliana GN=RPL40B PE=1 SV=2 17 84 2.0E-07
sp|B9DHA6|RL40A_ARATH Ubiquitin-60S ribosomal protein L40-1 OS=Arabidopsis thaliana GN=RPL40A PE=1 SV=1 17 84 2.0E-07
sp|P49636|RL40_NICSY Ubiquitin-60S ribosomal protein L40 OS=Nicotiana sylvestris GN=UBICEP52-7 PE=2 SV=2 17 84 2.0E-07
sp|P51423|RL40_BRARP Ubiquitin-60S ribosomal protein L40 OS=Brassica rapa subsp. pekinensis PE=2 SV=2 17 84 2.0E-07
sp|P69317|UBIQ_LUPPO Ubiquitin OS=Lupinus polyphyllus PE=3 SV=2 17 84 2.0E-07
sp|P69313|UBIQ_HELAN Ubiquitin OS=Helianthus annuus PE=3 SV=2 17 84 2.0E-07
sp|P0CH35|RL40B_ORYSJ Ubiquitin-60S ribosomal protein L40-2 OS=Oryza sativa subsp. japonica GN=Ub-CEP52-2 PE=3 SV=1 17 84 2.0E-07
sp|P0CH34|RL40A_ORYSJ Ubiquitin-60S ribosomal protein L40-1 OS=Oryza sativa subsp. japonica GN=Ub-CEP52-1 PE=2 SV=1 17 84 2.0E-07
sp|P16709|UBIL_NPVAC Ubiquitin-like protein OS=Autographa californica nuclear polyhedrosis virus GN=V-UBI PE=3 SV=2 17 84 3.0E-07
sp|Q9QZM0|UBQL2_MOUSE Ubiquilin-2 OS=Mus musculus GN=Ubqln2 PE=1 SV=2 366 434 3.0E-07
sp|P69310|UBIQ_AVESA Ubiquitin OS=Avena sativa PE=1 SV=1 17 84 3.0E-07
sp|P0CH09|RL402_YEAST Ubiquitin-60S ribosomal protein L40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL40B PE=1 SV=1 17 84 3.0E-07
sp|P0CH07|RL402_SCHPO Ubiquitin-60S ribosomal protein L40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uep1 PE=1 SV=1 17 84 3.0E-07
sp|P0CH08|RL401_YEAST Ubiquitin-60S ribosomal protein L40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL40A PE=1 SV=1 17 84 3.0E-07
sp|P0CH06|RL401_SCHPO Ubiquitin-60S ribosomal protein L40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi1 PE=1 SV=1 17 84 3.0E-07
sp|P40909|RL40_CRYNJ Ubiquitin-60S ribosomal protein L40 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UBI1 PE=1 SV=2 17 84 4.0E-07
sp|P49632|RL40_CAEEL Ubiquitin-60S ribosomal protein L40 OS=Caenorhabditis elegans GN=ubq-2 PE=3 SV=2 17 84 4.0E-07
sp|P69326|UBIQ_WHEAT Ubiquitin OS=Triticum aestivum PE=3 SV=2 17 84 4.0E-07
sp|P18101|RL40_DROME Ubiquitin-60S ribosomal protein L40 OS=Drosophila melanogaster GN=RpL40 PE=1 SV=2 17 84 4.0E-07
sp|P0C276|RL40_SHEEP Ubiquitin-60S ribosomal protein L40 OS=Ovis aries GN=UBA52 PE=2 SV=2 17 84 4.0E-07
sp|P62986|RL40_RAT Ubiquitin-60S ribosomal protein L40 OS=Rattus norvegicus GN=Uba52 PE=1 SV=2 17 84 4.0E-07
sp|P0C275|RL40_PONPY Ubiquitin-60S ribosomal protein L40 OS=Pongo pygmaeus GN=UBA52 PE=2 SV=2 17 84 4.0E-07
sp|P63053|RL40_PIG Ubiquitin-60S ribosomal protein L40 OS=Sus scrofa GN=UBA52 PE=1 SV=2 17 84 4.0E-07
sp|P68205|RL40_OPHHA Ubiquitin-60S ribosomal protein L40 OS=Ophiophagus hannah PE=2 SV=2 17 84 4.0E-07
sp|P62984|RL40_MOUSE Ubiquitin-60S ribosomal protein L40 OS=Mus musculus GN=Uba52 PE=1 SV=2 17 84 4.0E-07
sp|P0C273|RL40_MACFA Ubiquitin-60S ribosomal protein L40 OS=Macaca fascicularis GN=UBA52 PE=2 SV=2 17 84 4.0E-07
sp|P62987|RL40_HUMAN Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens GN=UBA52 PE=1 SV=2 17 84 4.0E-07
sp|P63052|RL40_FELCA Ubiquitin-60S ribosomal protein L40 OS=Felis catus GN=UBA52 PE=2 SV=2 17 84 4.0E-07
sp|P63050|RL40_CANLF Ubiquitin-60S ribosomal protein L40 OS=Canis lupus familiaris GN=UBA52 PE=2 SV=2 17 84 4.0E-07
sp|P63048|RL40_BOVIN Ubiquitin-60S ribosomal protein L40 OS=Bos taurus GN=UBA52 PE=1 SV=2 17 84 4.0E-07
sp|P14795|RL40_TRYCR Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi GN=FUS1 PE=2 SV=2 17 84 5.0E-07
sp|P19848|UBIQ_COPCO Ubiquitin OS=Coprinellus congregatus PE=1 SV=1 17 84 6.0E-07
sp|P0C224|RL40_NEUCR Ubiquitin-60S ribosomal protein L40 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-79 PE=1 SV=2 17 84 7.0E-07
sp|Q9FHQ6|UBQ9_ARATH Polyubiquitin 9 OS=Arabidopsis thaliana GN=UBQ9 PE=3 SV=1 18 83 7.0E-07
sp|Q8R317|UBQL1_MOUSE Ubiquilin-1 OS=Mus musculus GN=Ubqln1 PE=1 SV=1 13 220 9.0E-07
sp|P59232|R27AB_ARATH Ubiquitin-40S ribosomal protein S27a-2 OS=Arabidopsis thaliana GN=RPS27AB PE=1 SV=2 17 84 1.0E-06
sp|P21899|RL40_TRYBB Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma brucei brucei PE=1 SV=2 17 84 1.0E-06
sp|P62981|RS27A_SOLTU Ubiquitin-40S ribosomal protein S27a OS=Solanum tuberosum GN=UBI3 PE=2 SV=2 17 84 1.0E-06
sp|P62980|RS27A_SOLLC Ubiquitin-40S ribosomal protein S27a OS=Solanum lycopersicum GN=UBI3 PE=3 SV=2 17 84 1.0E-06
sp|P0DJ25|RL40_TETTS Ubiquitin-60S ribosomal protein L40 OS=Tetrahymena thermophila (strain SB210) GN=RPL40 PE=1 SV=1 17 84 1.0E-06
sp|P33190|RL40_TETPY Ubiquitin-60S ribosomal protein L40 OS=Tetrahymena pyriformis GN=TUF11 PE=3 SV=2 17 84 1.0E-06
sp|P23324|UBIQP_EUPEU Polyubiquitin OS=Euplotes eurystomus PE=3 SV=2 17 84 1.0E-06
sp|P23324|UBIQP_EUPEU Polyubiquitin OS=Euplotes eurystomus PE=3 SV=2 17 84 1.0E-06
sp|P23324|UBIQP_EUPEU Polyubiquitin OS=Euplotes eurystomus PE=3 SV=2 17 84 1.0E-06
sp|P59233|R27AC_ARATH Ubiquitin-40S ribosomal protein S27a-3 OS=Arabidopsis thaliana GN=RPS27AC PE=1 SV=2 17 84 1.0E-06
sp|P62975|UBIQ_RABIT Ubiquitin OS=Oryctolagus cuniculus PE=1 SV=1 17 84 1.0E-06
sp|P68197|UBIQ_CERCA Ubiquitin OS=Ceratitis capitata PE=1 SV=1 17 84 1.0E-06
sp|Q865C5|UBIQ_CAMDR Ubiquitin OS=Camelus dromedarius PE=3 SV=2 17 84 1.0E-06
sp|P46575|RL40_EIMBO Ubiquitin-60S ribosomal protein L40 OS=Eimeria bovis PE=2 SV=2 17 84 1.0E-06
sp|P47905|RS27A_LUPAL Ubiquitin-40S ribosomal protein S27a OS=Lupinus albus PE=3 SV=2 17 84 2.0E-06
sp|P69061|RS27A_KLULA Ubiquitin-40S ribosomal protein S27a OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi3 PE=1 SV=2 17 105 2.0E-06
sp|Q9ARZ9|R27AA_ORYSJ Ubiquitin-40S ribosomal protein S27a-1 OS=Oryza sativa subsp. japonica GN=RPS27AA PE=2 SV=1 17 84 2.0E-06
sp|O74803|RHP23_SCHPO UV excision repair protein rhp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp23 PE=1 SV=1 35 175 2.0E-06
sp|P0CG86|RS271_HORVU Ubiquitin-40S ribosomal protein S27a OS=Hordeum vulgare GN=MUB1 PE=3 SV=1 17 84 2.0E-06
sp|P0CG87|RS272_HORVU Ubiquitin-40S ribosomal protein S27a OS=Hordeum vulgare GN=MUB2 PE=3 SV=1 17 84 2.0E-06
sp|P51431|R27AB_ORYSJ Ubiquitin-40S ribosomal protein S27a-2 OS=Oryza sativa subsp. japonica GN=RPS27AB PE=2 SV=3 17 84 2.0E-06
sp|Q8C5U9|UBQL3_MOUSE Ubiquilin-3 OS=Mus musculus GN=Ubqln3 PE=1 SV=1 10 229 2.0E-06
sp|P27923|RS27A_MAIZE Ubiquitin-40S ribosomal protein S27a OS=Zea mays GN=UBF9 PE=2 SV=2 17 84 2.0E-06
sp|P14794|RL40_DICDI Ubiquitin-60S ribosomal protein L40 OS=Dictyostelium discoideum GN=ubqB PE=1 SV=2 17 84 2.0E-06
sp|P59271|R27AA_ARATH Ubiquitin-40S ribosomal protein S27a-1 OS=Arabidopsis thaliana GN=RPS27AA PE=1 SV=2 17 84 3.0E-06
sp|A7X5R6|BAG6_ORNAN Large proline-rich protein BAG6 OS=Ornithorhynchus anatinus GN=BAG6 PE=3 SV=1 11 96 3.0E-06
sp|Q6MG49|BAG6_RAT Large proline-rich protein BAG6 OS=Rattus norvegicus GN=Bag6 PE=1 SV=2 13 140 3.0E-06
sp|Q8SWD4|UBIQ_ENCCU Ubiquitin OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0740i PE=1 SV=1 17 84 3.0E-06
sp|P69201|RL40_LEIMA Ubiquitin-60S ribosomal protein L40 OS=Leishmania major GN=UB-EP52 PE=3 SV=2 17 84 3.0E-06
sp|Q9SHE7|RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana GN=RUB1 PE=1 SV=3 17 84 4.0E-06
sp|P0C031|RUB2_ORYSJ Ubiquitin-NEDD8-like protein RUB2 OS=Oryza sativa subsp. japonica GN=RUB2 PE=2 SV=2 17 84 4.0E-06
sp|Q9JJP9|UBQL1_RAT Ubiquilin-1 OS=Rattus norvegicus GN=Ubqln1 PE=1 SV=1 13 220 4.0E-06
sp|Q3E7K8|UBQ12_ARATH Polyubiquitin 12 OS=Arabidopsis thaliana GN=UBQ12 PE=3 SV=1 17 84 4.0E-06
sp|P0C032|RUB3_ORYSJ Ubiquitin-like protein-NEDD8-like protein RUB3 OS=Oryza sativa subsp. japonica GN=RUB3 PE=3 SV=2 17 84 5.0E-06
sp|P0C030|RUB1_ORYSJ Ubiquitin-NEDD8-like protein RUB1 OS=Oryza sativa subsp. japonica GN=RUB1 PE=2 SV=2 17 84 5.0E-06
sp|P0C073|RUB1_DESAN Ubiquitin-NEDD8-like protein RUB1 OS=Deschampsia antarctica GN=RUB1 PE=2 SV=2 17 84 5.0E-06
sp|Q8RUC6|RUB2_ARATH Ubiquitin-NEDD8-like protein RUB2 OS=Arabidopsis thaliana GN=RUB2 PE=1 SV=3 17 84 5.0E-06
sp|A4IH17|BAG6_XENTR Large proline-rich protein bag6 OS=Xenopus tropicalis GN=Bag6 PE=2 SV=1 17 87 6.0E-06
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 17 84 7.0E-06
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 17 84 7.0E-06
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 17 84 7.0E-06
sp|P0CG83|UBIQP_HORVU Polyubiquitin (Fragment) OS=Hordeum vulgare PE=2 SV=1 17 84 7.0E-06
sp|P0CG83|UBIQP_HORVU Polyubiquitin (Fragment) OS=Hordeum vulgare PE=2 SV=1 17 84 7.0E-06
sp|P62982|RS27A_RAT Ubiquitin-40S ribosomal protein S27a OS=Rattus norvegicus GN=Rps27a PE=1 SV=2 17 102 8.0E-06
sp|P62983|RS27A_MOUSE Ubiquitin-40S ribosomal protein S27a OS=Mus musculus GN=Rps27a PE=1 SV=2 17 102 8.0E-06
sp|P15357|RS27A_DROME Ubiquitin-40S ribosomal protein S27a OS=Drosophila melanogaster GN=RpS27A PE=1 SV=2 17 84 8.0E-06
sp|P68200|RS27A_ICTPU Ubiquitin-40S ribosomal protein S27a OS=Ictalurus punctatus GN=rps27a PE=2 SV=2 17 102 9.0E-06
sp|P23398|UBIQP_STRPU Polyubiquitin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=2 17 84 9.0E-06
sp|P62979|RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 17 102 1.0E-05
sp|P79781|RS27A_CHICK Ubiquitin-40S ribosomal protein S27a OS=Gallus gallus GN=RPS27A PE=2 SV=3 17 84 1.0E-05
sp|P62978|RS27A_CAVPO Ubiquitin-40S ribosomal protein S27a OS=Cavia porcellus GN=RPS27A PE=1 SV=2 17 102 1.0E-05
sp|P62992|RS27A_BOVIN Ubiquitin-40S ribosomal protein S27a OS=Bos taurus GN=RPS27A PE=1 SV=2 17 102 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5756 0.7778 0.1578 0.087 0.2988 0.022 0.2707 0.0254 0.0496 0.0041

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4049
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2485
Ophiocordyceps australis map64 (Brazil) OphauB2|16
Ophiocordyceps camponoti-floridani Ophcf2|02690
Ophiocordyceps camponoti-rufipedis Ophun1|1694
Ophiocordyceps kimflemingae Ophio5|5233
Ophiocordyceps subramaniannii Hirsu2|816 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|816
MADNAEAGADAQITFKVKTSSDSTHTMTMAESATVLELKTKLSGQDLENIPVERQRLIYSGRVMKNDDTLASYKI
KPNNTIHMVKSAASNPSQPASTSTPTPQAIPSNMASGTANNPLAGLTGARYAGHQVNLPGMEMFGPDGGMGPPMD
EERLQHMMADPNIQQAMREALNNPDFVNMLIDSNPMLRNMPGAREFITSPGVQQMMSNPNMIRDAMRLQRMMGGG
DAAFPAPGATDTTPAGGAATDGSANPGTNDNQQNPLMNPFMMPGLMGAGAGAGAGPGGEGAINMRQMLQALGAMG
AANPFAPPSTAAGATPGQESRQGQGGPPTEGTTASQQGQDQQAANPFAALFPPQGGAQAGNPFAMNPEMMNQMMQ
MLGGAGAPAPADNRPPEERYAEQLRQLNDMGFYDFDRNVAALRRSGGSVQGAIEHLLSSTD*
Coding >Hirsu2|816
ATGGCGGACAACGCCGAGGCCGGCGCCGACGCCCAAATCACCTTCAAGGTCAAGACGTCGTCGGACAGCACGCAC
ACCATGACCATGGCCGAGTCGGCCACAGTCCTCGAGCTCAAGACCAAACTGTCGGGCCAGGACCTGGAGAACATC
CCCGTCGAGCGGCAACGCCTCATCTACTCGGGCCGCGTCATGAAGAACGACGACACGCTGGCCTCGTACAAGATC
AAGCCCAACAACACCATCCACATGGTCAAGAGCGCGGCCAGTAACCCCTCGCAACCCGCCTCCACCTCGACCCCG
ACCCCGCAGGCCATCCCCTCCAACATGGCCTCGGGCACCGCCAACAACCCCCTGGCTGGCCTCACCGGCGCTCGC
TATGCCGGCCACCAGGTCAATCTTCCGGGCATGGAAATGTTCGGCCCCGACGGCGGCATGGGCCCCCCCATGGAC
GAGGAGCGCCTGCAGCACATGATGGCTGACCCCAACATCCAACAGGCCATGCGCGAGGCCCTCAACAATCCCGAC
TTCGTCAACATGCTCATCGACTCGAACCCCATGCTGCGGAACATGCCTGGCGCCCGAGAGTTCATCACCTCCCCC
GGCGTGCAACAGATGATGAGCAACCCCAATATGATACGGGACGCCATGAGGTTACAGCGCATGATGGGAGGTGGT
GATGCCGCCTTTCCGGCTCCGGGCGCGACCGACACAACGCCCGCAGGCGGTGCGGCGACCGACGGAAGCGCCAAC
CCAGGGACCAACGACAACCAGCAGAACCCGCTCATGAACCCCTTTATGATGCCGGGCTTGATGGGCGCGGGCGCG
GGTGCAGGGGCTGGGCCCGGAGGCGAAGGAGCCATCAATATGAGACAGATGCTCCAGGCCCTCGGAGCCATGGGC
GCCGCCAACCCGTTTGCGCCTCCATCGACGGCCGCCGGTGCCACGCCCGGTCAGGAGTCGCGGCAAGGCCAGGGA
GGGCCGCCGACCGAAGGGACCACGGCGTCACAGCAGGGCCAGGACCAGCAGGCGGCGAACCCCTTCGCCGCCTTG
TTCCCGCCGCAAGGTGGCGCCCAGGCTGGCAATCCGTTCGCAATGAACCCCGAAATGATGAACCAGATGATGCAG
ATGCTGGGAGGTGCTGGCGCGCCGGCGCCCGCCGATAATCGCCCGCCCGAGGAGCGCTACGCCGAGCAGCTGCGG
CAGCTCAACGACATGGGCTTCTACGACTTTGACCGGAACGTGGCCGCTCTTAGGCGGAGCGGAGGAAGCGTCCAG
GGCGCCATCGAACACCTGCTTAGTTCGACGGACTAA
Transcript >Hirsu2|816
ATGGCGGACAACGCCGAGGCCGGCGCCGACGCCCAAATCACCTTCAAGGTCAAGACGTCGTCGGACAGCACGCAC
ACCATGACCATGGCCGAGTCGGCCACAGTCCTCGAGCTCAAGACCAAACTGTCGGGCCAGGACCTGGAGAACATC
CCCGTCGAGCGGCAACGCCTCATCTACTCGGGCCGCGTCATGAAGAACGACGACACGCTGGCCTCGTACAAGATC
AAGCCCAACAACACCATCCACATGGTCAAGAGCGCGGCCAGTAACCCCTCGCAACCCGCCTCCACCTCGACCCCG
ACCCCGCAGGCCATCCCCTCCAACATGGCCTCGGGCACCGCCAACAACCCCCTGGCTGGCCTCACCGGCGCTCGC
TATGCCGGCCACCAGGTCAATCTTCCGGGCATGGAAATGTTCGGCCCCGACGGCGGCATGGGCCCCCCCATGGAC
GAGGAGCGCCTGCAGCACATGATGGCTGACCCCAACATCCAACAGGCCATGCGCGAGGCCCTCAACAATCCCGAC
TTCGTCAACATGCTCATCGACTCGAACCCCATGCTGCGGAACATGCCTGGCGCCCGAGAGTTCATCACCTCCCCC
GGCGTGCAACAGATGATGAGCAACCCCAATATGATACGGGACGCCATGAGGTTACAGCGCATGATGGGAGGTGGT
GATGCCGCCTTTCCGGCTCCGGGCGCGACCGACACAACGCCCGCAGGCGGTGCGGCGACCGACGGAAGCGCCAAC
CCAGGGACCAACGACAACCAGCAGAACCCGCTCATGAACCCCTTTATGATGCCGGGCTTGATGGGCGCGGGCGCG
GGTGCAGGGGCTGGGCCCGGAGGCGAAGGAGCCATCAATATGAGACAGATGCTCCAGGCCCTCGGAGCCATGGGC
GCCGCCAACCCGTTTGCGCCTCCATCGACGGCCGCCGGTGCCACGCCCGGTCAGGAGTCGCGGCAAGGCCAGGGA
GGGCCGCCGACCGAAGGGACCACGGCGTCACAGCAGGGCCAGGACCAGCAGGCGGCGAACCCCTTCGCCGCCTTG
TTCCCGCCGCAAGGTGGCGCCCAGGCTGGCAATCCGTTCGCAATGAACCCCGAAATGATGAACCAGATGATGCAG
ATGCTGGGAGGTGCTGGCGCGCCGGCGCCCGCCGATAATCGCCCGCCCGAGGAGCGCTACGCCGAGCAGCTGCGG
CAGCTCAACGACATGGGCTTCTACGACTTTGACCGGAACGTGGCCGCTCTTAGGCGGAGCGGAGGAAGCGTCCAG
GGCGCCATCGAACACCTGCTTAGTTCGACGGACTAA
Gene >Hirsu2|816
ATGGCGGACAACGCCGAGGCCGGCGCCGACGCCCAAATCACCTTCAAGGTCAAGACGTCGTCGGACAGCACGCAC
ACCATGACCATGGCCGAGTCGGCCACAGTCCTCGAGCTCAAGACCAAACTGTCGGGCCAGGACCTGGAGAACATC
CCCGTCGAGCGGCAACGCCTCATCTACTCGGGCCGCGTCATGAAGAACGACGACACGCTGGCCTCGTACAAGATC
AAGCCCAACAACACCATCCACATGGTCAAGAGCGCGGCCAGTAACCCCTCGCAACCCGCCTCCACCTCGACCCCG
ACCCCGCAGGCCATCCCCTCCAACATGGCCTCGGGCACCGCCAACAACCCCCTGGCTGGCCTCACCGGCGCTCGC
TATGCCGGCCACCAGGTCAATCTTCCGGGCATGGAAATGTTCGGCCCCGACGGCGGCGTGAGCCTTCCTTGACTC
GGGCCCTGCTGCCTCTCCTGTGCTGACGACTTGTGCTACAGATGGGCCCCCCCATGGACGAGGAGCGCCTGCAGC
ACATGATGGCTGACCCCAACATCCAACAGGCCATGCGCGAGGCCCTCAACAATCCCGACTTCGTCAACATGCTCA
TCGACTCGAACCCCATGCTGCGGAACATGCCTGGCGCCCGAGAGTTCATCACCTCCCCCGGCGTGCAACAGATGA
TGAGCAACCCCAATATGATACGGGACGCCATGAGGTTACAGCGCATGATGGGAGGTGGTGATGCCGCCTTTCCGG
CTCCGGGCGCGACCGACACAACGCCCGCAGGCGGTGCGGCGACCGACGGAAGCGCCAACCCAGGGACCAACGACA
ACCAGCAGAACCCGCTCATGAACCCCTTTATGATGCCGGGCTTGATGGGCGCGGGCGCGGGTGCAGGGGCTGGGC
CCGGAGGCGAAGGAGCCATCAATATGAGACAGATGCTCCAGGCCCTCGGAGCCATGGGCGCCGCCAACCCGTTTG
CGCCTCCATCGACGGCCGCCGGTGCCACGCCCGGTCAGGAGTCGCGGCAAGGCCAGGGAGGGCCGCCGACCGAAG
GGACCACGGCGTCACAGCAGGGCCAGGACCAGCAGGCGGCGAACCCCTTCGCCGCCTTGTTCCCGCCGCAAGGTG
GCGCCCAGGCTGGCAATCCGTTCGCAATGAACCCCGAAATGATGAACCAGATGATGCAGATGCTGGGAGGTGCTG
GCGCGCCGGCGCCCGCCGATAATCGCCCGCCCGAGGAGCGCTACGCCGAGCAGCTGCGGCAGCTCAACGACATGG
GCTTCTACGACTTTGACCGGAACGTGGCCGCTCTTAGGCGGAGCGGAGGAAGCGTCCAGGGCGCCATCGAACACC
TGCTTAGTTCGACGGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail