Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|816
Gene name
LocationContig_117:21356..22726
Strand-
Gene length (bp)1370
Transcript length (bp)1311
Coding sequence length (bp)1311
Protein length (aa) 437

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00240 ubiquitin Ubiquitin family 1.1E-20 16 86
PF00627 UBA UBA/TS-N domain 2.4E-06 395 431
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 1.4E-05 14 84

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10169|DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph1 PE=3 SV=1 13 225 4.0E-41
sp|P48510|DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSK2 PE=1 SV=2 13 233 2.0E-35
sp|P48510|DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSK2 PE=1 SV=2 331 433 9.0E-21
sp|Q10169|DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph1 PE=3 SV=1 383 433 2.0E-18
sp|Q9SII9|DSK2A_ARATH Ubiquitin domain-containing protein DSK2a OS=Arabidopsis thaliana GN=DSK2A PE=1 SV=2 13 217 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10169|DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph1 PE=3 SV=1 13 225 4.0E-41
sp|P48510|DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSK2 PE=1 SV=2 13 233 2.0E-35
sp|P48510|DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSK2 PE=1 SV=2 331 433 9.0E-21
sp|Q10169|DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph1 PE=3 SV=1 383 433 2.0E-18
sp|Q9SII9|DSK2A_ARATH Ubiquitin domain-containing protein DSK2a OS=Arabidopsis thaliana GN=DSK2A PE=1 SV=2 13 217 2.0E-15
sp|Q9SII8|DSK2B_ARATH Ubiquitin domain-containing protein DSK2b OS=Arabidopsis thaliana GN=DSK2B PE=1 SV=1 15 281 4.0E-11
sp|Q9NIF3|UBQL_DICDI Ubiquilin OS=Dictyostelium discoideum GN=ubqln PE=1 SV=1 13 217 6.0E-11
sp|Q9SII8|DSK2B_ARATH Ubiquitin domain-containing protein DSK2b OS=Arabidopsis thaliana GN=DSK2B PE=1 SV=1 388 434 4.0E-08
sp|Q9SII9|DSK2A_ARATH Ubiquitin domain-containing protein DSK2a OS=Arabidopsis thaliana GN=DSK2A PE=1 SV=2 388 434 1.0E-07
sp|Q05120|UBIL_NPVOP Ubiquitin-like protein OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=V-UBI PE=3 SV=1 17 84 1.0E-07
sp|P49633|RL40_ACACA Ubiquitin-60S ribosomal protein L40 OS=Acanthamoeba castellanii PE=2 SV=2 17 84 1.0E-07
sp|Q9UHD9|UBQL2_HUMAN Ubiquilin-2 OS=Homo sapiens GN=UBQLN2 PE=1 SV=2 366 434 2.0E-07
sp|P59272|RS27A_DAUCA Ubiquitin-40S ribosomal protein S27a (Fragment) OS=Daucus carota PE=2 SV=2 17 84 2.0E-07
sp|P0CH10|RL403_CHLRE Ubiquitin-60S ribosomal protein L40 OS=Chlamydomonas reinhardtii GN=UBI3 PE=1 SV=1 17 84 2.0E-07
sp|P0CH11|RL401_CHLRE Ubiquitin-60S ribosomal protein L40 OS=Chlamydomonas reinhardtii GN=UBI1 PE=1 SV=1 17 84 2.0E-07
sp|Q42202|RL40B_ARATH Ubiquitin-60S ribosomal protein L40-2 OS=Arabidopsis thaliana GN=RPL40B PE=1 SV=2 17 84 2.0E-07
sp|B9DHA6|RL40A_ARATH Ubiquitin-60S ribosomal protein L40-1 OS=Arabidopsis thaliana GN=RPL40A PE=1 SV=1 17 84 2.0E-07
sp|P49636|RL40_NICSY Ubiquitin-60S ribosomal protein L40 OS=Nicotiana sylvestris GN=UBICEP52-7 PE=2 SV=2 17 84 2.0E-07
sp|P51423|RL40_BRARP Ubiquitin-60S ribosomal protein L40 OS=Brassica rapa subsp. pekinensis PE=2 SV=2 17 84 2.0E-07
sp|P69317|UBIQ_LUPPO Ubiquitin OS=Lupinus polyphyllus PE=3 SV=2 17 84 2.0E-07
sp|P69313|UBIQ_HELAN Ubiquitin OS=Helianthus annuus PE=3 SV=2 17 84 2.0E-07
sp|P0CH35|RL40B_ORYSJ Ubiquitin-60S ribosomal protein L40-2 OS=Oryza sativa subsp. japonica GN=Ub-CEP52-2 PE=3 SV=1 17 84 2.0E-07
sp|P0CH34|RL40A_ORYSJ Ubiquitin-60S ribosomal protein L40-1 OS=Oryza sativa subsp. japonica GN=Ub-CEP52-1 PE=2 SV=1 17 84 2.0E-07
sp|P16709|UBIL_NPVAC Ubiquitin-like protein OS=Autographa californica nuclear polyhedrosis virus GN=V-UBI PE=3 SV=2 17 84 3.0E-07
sp|Q9QZM0|UBQL2_MOUSE Ubiquilin-2 OS=Mus musculus GN=Ubqln2 PE=1 SV=2 366 434 3.0E-07
sp|P69310|UBIQ_AVESA Ubiquitin OS=Avena sativa PE=1 SV=1 17 84 3.0E-07
sp|P0CH09|RL402_YEAST Ubiquitin-60S ribosomal protein L40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL40B PE=1 SV=1 17 84 3.0E-07
sp|P0CH07|RL402_SCHPO Ubiquitin-60S ribosomal protein L40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uep1 PE=1 SV=1 17 84 3.0E-07
sp|P0CH08|RL401_YEAST Ubiquitin-60S ribosomal protein L40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL40A PE=1 SV=1 17 84 3.0E-07
sp|P0CH06|RL401_SCHPO Ubiquitin-60S ribosomal protein L40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi1 PE=1 SV=1 17 84 3.0E-07
sp|P40909|RL40_CRYNJ Ubiquitin-60S ribosomal protein L40 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UBI1 PE=1 SV=2 17 84 4.0E-07
sp|P49632|RL40_CAEEL Ubiquitin-60S ribosomal protein L40 OS=Caenorhabditis elegans GN=ubq-2 PE=3 SV=2 17 84 4.0E-07
sp|P69326|UBIQ_WHEAT Ubiquitin OS=Triticum aestivum PE=3 SV=2 17 84 4.0E-07
sp|P18101|RL40_DROME Ubiquitin-60S ribosomal protein L40 OS=Drosophila melanogaster GN=RpL40 PE=1 SV=2 17 84 4.0E-07
sp|P0C276|RL40_SHEEP Ubiquitin-60S ribosomal protein L40 OS=Ovis aries GN=UBA52 PE=2 SV=2 17 84 4.0E-07
sp|P62986|RL40_RAT Ubiquitin-60S ribosomal protein L40 OS=Rattus norvegicus GN=Uba52 PE=1 SV=2 17 84 4.0E-07
sp|P0C275|RL40_PONPY Ubiquitin-60S ribosomal protein L40 OS=Pongo pygmaeus GN=UBA52 PE=2 SV=2 17 84 4.0E-07
sp|P63053|RL40_PIG Ubiquitin-60S ribosomal protein L40 OS=Sus scrofa GN=UBA52 PE=1 SV=2 17 84 4.0E-07
sp|P68205|RL40_OPHHA Ubiquitin-60S ribosomal protein L40 OS=Ophiophagus hannah PE=2 SV=2 17 84 4.0E-07
sp|P62984|RL40_MOUSE Ubiquitin-60S ribosomal protein L40 OS=Mus musculus GN=Uba52 PE=1 SV=2 17 84 4.0E-07
sp|P0C273|RL40_MACFA Ubiquitin-60S ribosomal protein L40 OS=Macaca fascicularis GN=UBA52 PE=2 SV=2 17 84 4.0E-07
sp|P62987|RL40_HUMAN Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens GN=UBA52 PE=1 SV=2 17 84 4.0E-07
sp|P63052|RL40_FELCA Ubiquitin-60S ribosomal protein L40 OS=Felis catus GN=UBA52 PE=2 SV=2 17 84 4.0E-07
sp|P63050|RL40_CANLF Ubiquitin-60S ribosomal protein L40 OS=Canis lupus familiaris GN=UBA52 PE=2 SV=2 17 84 4.0E-07
sp|P63048|RL40_BOVIN Ubiquitin-60S ribosomal protein L40 OS=Bos taurus GN=UBA52 PE=1 SV=2 17 84 4.0E-07
sp|P14795|RL40_TRYCR Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi GN=FUS1 PE=2 SV=2 17 84 5.0E-07
sp|P19848|UBIQ_COPCO Ubiquitin OS=Coprinellus congregatus PE=1 SV=1 17 84 6.0E-07
sp|P0C224|RL40_NEUCR Ubiquitin-60S ribosomal protein L40 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-79 PE=1 SV=2 17 84 7.0E-07
sp|Q9FHQ6|UBQ9_ARATH Polyubiquitin 9 OS=Arabidopsis thaliana GN=UBQ9 PE=3 SV=1 18 83 7.0E-07
sp|Q8R317|UBQL1_MOUSE Ubiquilin-1 OS=Mus musculus GN=Ubqln1 PE=1 SV=1 13 220 9.0E-07
sp|P59232|R27AB_ARATH Ubiquitin-40S ribosomal protein S27a-2 OS=Arabidopsis thaliana GN=RPS27AB PE=1 SV=2 17 84 1.0E-06
sp|P21899|RL40_TRYBB Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma brucei brucei PE=1 SV=2 17 84 1.0E-06
sp|P62981|RS27A_SOLTU Ubiquitin-40S ribosomal protein S27a OS=Solanum tuberosum GN=UBI3 PE=2 SV=2 17 84 1.0E-06
sp|P62980|RS27A_SOLLC Ubiquitin-40S ribosomal protein S27a OS=Solanum lycopersicum GN=UBI3 PE=3 SV=2 17 84 1.0E-06
sp|P0DJ25|RL40_TETTS Ubiquitin-60S ribosomal protein L40 OS=Tetrahymena thermophila (strain SB210) GN=RPL40 PE=1 SV=1 17 84 1.0E-06
sp|P33190|RL40_TETPY Ubiquitin-60S ribosomal protein L40 OS=Tetrahymena pyriformis GN=TUF11 PE=3 SV=2 17 84 1.0E-06
sp|P23324|UBIQP_EUPEU Polyubiquitin OS=Euplotes eurystomus PE=3 SV=2 17 84 1.0E-06
sp|P23324|UBIQP_EUPEU Polyubiquitin OS=Euplotes eurystomus PE=3 SV=2 17 84 1.0E-06
sp|P23324|UBIQP_EUPEU Polyubiquitin OS=Euplotes eurystomus PE=3 SV=2 17 84 1.0E-06
sp|P59233|R27AC_ARATH Ubiquitin-40S ribosomal protein S27a-3 OS=Arabidopsis thaliana GN=RPS27AC PE=1 SV=2 17 84 1.0E-06
sp|P62975|UBIQ_RABIT Ubiquitin OS=Oryctolagus cuniculus PE=1 SV=1 17 84 1.0E-06
sp|P68197|UBIQ_CERCA Ubiquitin OS=Ceratitis capitata PE=1 SV=1 17 84 1.0E-06
sp|Q865C5|UBIQ_CAMDR Ubiquitin OS=Camelus dromedarius PE=3 SV=2 17 84 1.0E-06
sp|P46575|RL40_EIMBO Ubiquitin-60S ribosomal protein L40 OS=Eimeria bovis PE=2 SV=2 17 84 1.0E-06
sp|P47905|RS27A_LUPAL Ubiquitin-40S ribosomal protein S27a OS=Lupinus albus PE=3 SV=2 17 84 2.0E-06
sp|P69061|RS27A_KLULA Ubiquitin-40S ribosomal protein S27a OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi3 PE=1 SV=2 17 105 2.0E-06
sp|Q9ARZ9|R27AA_ORYSJ Ubiquitin-40S ribosomal protein S27a-1 OS=Oryza sativa subsp. japonica GN=RPS27AA PE=2 SV=1 17 84 2.0E-06
sp|O74803|RHP23_SCHPO UV excision repair protein rhp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp23 PE=1 SV=1 35 175 2.0E-06
sp|P0CG86|RS271_HORVU Ubiquitin-40S ribosomal protein S27a OS=Hordeum vulgare GN=MUB1 PE=3 SV=1 17 84 2.0E-06
sp|P0CG87|RS272_HORVU Ubiquitin-40S ribosomal protein S27a OS=Hordeum vulgare GN=MUB2 PE=3 SV=1 17 84 2.0E-06
sp|P51431|R27AB_ORYSJ Ubiquitin-40S ribosomal protein S27a-2 OS=Oryza sativa subsp. japonica GN=RPS27AB PE=2 SV=3 17 84 2.0E-06
sp|Q8C5U9|UBQL3_MOUSE Ubiquilin-3 OS=Mus musculus GN=Ubqln3 PE=1 SV=1 10 229 2.0E-06
sp|P27923|RS27A_MAIZE Ubiquitin-40S ribosomal protein S27a OS=Zea mays GN=UBF9 PE=2 SV=2 17 84 2.0E-06
sp|P14794|RL40_DICDI Ubiquitin-60S ribosomal protein L40 OS=Dictyostelium discoideum GN=ubqB PE=1 SV=2 17 84 2.0E-06
sp|P59271|R27AA_ARATH Ubiquitin-40S ribosomal protein S27a-1 OS=Arabidopsis thaliana GN=RPS27AA PE=1 SV=2 17 84 3.0E-06
sp|A7X5R6|BAG6_ORNAN Large proline-rich protein BAG6 OS=Ornithorhynchus anatinus GN=BAG6 PE=3 SV=1 11 96 3.0E-06
sp|Q6MG49|BAG6_RAT Large proline-rich protein BAG6 OS=Rattus norvegicus GN=Bag6 PE=1 SV=2 13 140 3.0E-06
sp|Q8SWD4|UBIQ_ENCCU Ubiquitin OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0740i PE=1 SV=1 17 84 3.0E-06
sp|P69201|RL40_LEIMA Ubiquitin-60S ribosomal protein L40 OS=Leishmania major GN=UB-EP52 PE=3 SV=2 17 84 3.0E-06
sp|Q9SHE7|RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana GN=RUB1 PE=1 SV=3 17 84 4.0E-06
sp|P0C031|RUB2_ORYSJ Ubiquitin-NEDD8-like protein RUB2 OS=Oryza sativa subsp. japonica GN=RUB2 PE=2 SV=2 17 84 4.0E-06
sp|Q9JJP9|UBQL1_RAT Ubiquilin-1 OS=Rattus norvegicus GN=Ubqln1 PE=1 SV=1 13 220 4.0E-06
sp|Q3E7K8|UBQ12_ARATH Polyubiquitin 12 OS=Arabidopsis thaliana GN=UBQ12 PE=3 SV=1 17 84 4.0E-06
sp|P0C032|RUB3_ORYSJ Ubiquitin-like protein-NEDD8-like protein RUB3 OS=Oryza sativa subsp. japonica GN=RUB3 PE=3 SV=2 17 84 5.0E-06
sp|P0C030|RUB1_ORYSJ Ubiquitin-NEDD8-like protein RUB1 OS=Oryza sativa subsp. japonica GN=RUB1 PE=2 SV=2 17 84 5.0E-06
sp|P0C073|RUB1_DESAN Ubiquitin-NEDD8-like protein RUB1 OS=Deschampsia antarctica GN=RUB1 PE=2 SV=2 17 84 5.0E-06
sp|Q8RUC6|RUB2_ARATH Ubiquitin-NEDD8-like protein RUB2 OS=Arabidopsis thaliana GN=RUB2 PE=1 SV=3 17 84 5.0E-06
sp|A4IH17|BAG6_XENTR Large proline-rich protein bag6 OS=Xenopus tropicalis GN=Bag6 PE=2 SV=1 17 87 6.0E-06
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 17 84 7.0E-06
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 17 84 7.0E-06
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 17 84 7.0E-06
sp|P0CG83|UBIQP_HORVU Polyubiquitin (Fragment) OS=Hordeum vulgare PE=2 SV=1 17 84 7.0E-06
sp|P0CG83|UBIQP_HORVU Polyubiquitin (Fragment) OS=Hordeum vulgare PE=2 SV=1 17 84 7.0E-06
sp|P62982|RS27A_RAT Ubiquitin-40S ribosomal protein S27a OS=Rattus norvegicus GN=Rps27a PE=1 SV=2 17 102 8.0E-06
sp|P62983|RS27A_MOUSE Ubiquitin-40S ribosomal protein S27a OS=Mus musculus GN=Rps27a PE=1 SV=2 17 102 8.0E-06
sp|P15357|RS27A_DROME Ubiquitin-40S ribosomal protein S27a OS=Drosophila melanogaster GN=RpS27A PE=1 SV=2 17 84 8.0E-06
sp|P68200|RS27A_ICTPU Ubiquitin-40S ribosomal protein S27a OS=Ictalurus punctatus GN=rps27a PE=2 SV=2 17 102 9.0E-06
sp|P23398|UBIQP_STRPU Polyubiquitin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=2 17 84 9.0E-06
sp|P62979|RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 17 102 1.0E-05
sp|P79781|RS27A_CHICK Ubiquitin-40S ribosomal protein S27a OS=Gallus gallus GN=RPS27A PE=2 SV=3 17 84 1.0E-05
sp|P62978|RS27A_CAVPO Ubiquitin-40S ribosomal protein S27a OS=Cavia porcellus GN=RPS27A PE=1 SV=2 17 102 1.0E-05
sp|P62992|RS27A_BOVIN Ubiquitin-40S ribosomal protein S27a OS=Bos taurus GN=RPS27A PE=1 SV=2 17 102 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|816
MADNAEAGADAQITFKVKTSSDSTHTMTMAESATVLELKTKLSGQDLENIPVERQRLIYSGRVMKNDDTLASYKI
KPNNTIHMVKSAASNPSQPASTSTPTPQAIPSNMASGTANNPLAGLTGARYAGHQVNLPGMEMFGPDGGMGPPMD
EERLQHMMADPNIQQAMREALNNPDFVNMLIDSNPMLRNMPGAREFITSPGVQQMMSNPNMIRDAMRLQRMMGGG
DAAFPAPGATDTTPAGGAATDGSANPGTNDNQQNPLMNPFMMPGLMGAGAGAGAGPGGEGAINMRQMLQALGAMG
AANPFAPPSTAAGATPGQESRQGQGGPPTEGTTASQQGQDQQAANPFAALFPPQGGAQAGNPFAMNPEMMNQMMQ
MLGGAGAPAPADNRPPEERYAEQLRQLNDMGFYDFDRNVAALRRSGGSVQGAIEHLLSSTD*
Coding >Hirsu2|816
ATGGCGGACAACGCCGAGGCCGGCGCCGACGCCCAAATCACCTTCAAGGTCAAGACGTCGTCGGACAGCACGCAC
ACCATGACCATGGCCGAGTCGGCCACAGTCCTCGAGCTCAAGACCAAACTGTCGGGCCAGGACCTGGAGAACATC
CCCGTCGAGCGGCAACGCCTCATCTACTCGGGCCGCGTCATGAAGAACGACGACACGCTGGCCTCGTACAAGATC
AAGCCCAACAACACCATCCACATGGTCAAGAGCGCGGCCAGTAACCCCTCGCAACCCGCCTCCACCTCGACCCCG
ACCCCGCAGGCCATCCCCTCCAACATGGCCTCGGGCACCGCCAACAACCCCCTGGCTGGCCTCACCGGCGCTCGC
TATGCCGGCCACCAGGTCAATCTTCCGGGCATGGAAATGTTCGGCCCCGACGGCGGCATGGGCCCCCCCATGGAC
GAGGAGCGCCTGCAGCACATGATGGCTGACCCCAACATCCAACAGGCCATGCGCGAGGCCCTCAACAATCCCGAC
TTCGTCAACATGCTCATCGACTCGAACCCCATGCTGCGGAACATGCCTGGCGCCCGAGAGTTCATCACCTCCCCC
GGCGTGCAACAGATGATGAGCAACCCCAATATGATACGGGACGCCATGAGGTTACAGCGCATGATGGGAGGTGGT
GATGCCGCCTTTCCGGCTCCGGGCGCGACCGACACAACGCCCGCAGGCGGTGCGGCGACCGACGGAAGCGCCAAC
CCAGGGACCAACGACAACCAGCAGAACCCGCTCATGAACCCCTTTATGATGCCGGGCTTGATGGGCGCGGGCGCG
GGTGCAGGGGCTGGGCCCGGAGGCGAAGGAGCCATCAATATGAGACAGATGCTCCAGGCCCTCGGAGCCATGGGC
GCCGCCAACCCGTTTGCGCCTCCATCGACGGCCGCCGGTGCCACGCCCGGTCAGGAGTCGCGGCAAGGCCAGGGA
GGGCCGCCGACCGAAGGGACCACGGCGTCACAGCAGGGCCAGGACCAGCAGGCGGCGAACCCCTTCGCCGCCTTG
TTCCCGCCGCAAGGTGGCGCCCAGGCTGGCAATCCGTTCGCAATGAACCCCGAAATGATGAACCAGATGATGCAG
ATGCTGGGAGGTGCTGGCGCGCCGGCGCCCGCCGATAATCGCCCGCCCGAGGAGCGCTACGCCGAGCAGCTGCGG
CAGCTCAACGACATGGGCTTCTACGACTTTGACCGGAACGTGGCCGCTCTTAGGCGGAGCGGAGGAAGCGTCCAG
GGCGCCATCGAACACCTGCTTAGTTCGACGGACTAA
Transcript >Hirsu2|816
ATGGCGGACAACGCCGAGGCCGGCGCCGACGCCCAAATCACCTTCAAGGTCAAGACGTCGTCGGACAGCACGCAC
ACCATGACCATGGCCGAGTCGGCCACAGTCCTCGAGCTCAAGACCAAACTGTCGGGCCAGGACCTGGAGAACATC
CCCGTCGAGCGGCAACGCCTCATCTACTCGGGCCGCGTCATGAAGAACGACGACACGCTGGCCTCGTACAAGATC
AAGCCCAACAACACCATCCACATGGTCAAGAGCGCGGCCAGTAACCCCTCGCAACCCGCCTCCACCTCGACCCCG
ACCCCGCAGGCCATCCCCTCCAACATGGCCTCGGGCACCGCCAACAACCCCCTGGCTGGCCTCACCGGCGCTCGC
TATGCCGGCCACCAGGTCAATCTTCCGGGCATGGAAATGTTCGGCCCCGACGGCGGCATGGGCCCCCCCATGGAC
GAGGAGCGCCTGCAGCACATGATGGCTGACCCCAACATCCAACAGGCCATGCGCGAGGCCCTCAACAATCCCGAC
TTCGTCAACATGCTCATCGACTCGAACCCCATGCTGCGGAACATGCCTGGCGCCCGAGAGTTCATCACCTCCCCC
GGCGTGCAACAGATGATGAGCAACCCCAATATGATACGGGACGCCATGAGGTTACAGCGCATGATGGGAGGTGGT
GATGCCGCCTTTCCGGCTCCGGGCGCGACCGACACAACGCCCGCAGGCGGTGCGGCGACCGACGGAAGCGCCAAC
CCAGGGACCAACGACAACCAGCAGAACCCGCTCATGAACCCCTTTATGATGCCGGGCTTGATGGGCGCGGGCGCG
GGTGCAGGGGCTGGGCCCGGAGGCGAAGGAGCCATCAATATGAGACAGATGCTCCAGGCCCTCGGAGCCATGGGC
GCCGCCAACCCGTTTGCGCCTCCATCGACGGCCGCCGGTGCCACGCCCGGTCAGGAGTCGCGGCAAGGCCAGGGA
GGGCCGCCGACCGAAGGGACCACGGCGTCACAGCAGGGCCAGGACCAGCAGGCGGCGAACCCCTTCGCCGCCTTG
TTCCCGCCGCAAGGTGGCGCCCAGGCTGGCAATCCGTTCGCAATGAACCCCGAAATGATGAACCAGATGATGCAG
ATGCTGGGAGGTGCTGGCGCGCCGGCGCCCGCCGATAATCGCCCGCCCGAGGAGCGCTACGCCGAGCAGCTGCGG
CAGCTCAACGACATGGGCTTCTACGACTTTGACCGGAACGTGGCCGCTCTTAGGCGGAGCGGAGGAAGCGTCCAG
GGCGCCATCGAACACCTGCTTAGTTCGACGGACTAA
Gene >Hirsu2|816
ATGGCGGACAACGCCGAGGCCGGCGCCGACGCCCAAATCACCTTCAAGGTCAAGACGTCGTCGGACAGCACGCAC
ACCATGACCATGGCCGAGTCGGCCACAGTCCTCGAGCTCAAGACCAAACTGTCGGGCCAGGACCTGGAGAACATC
CCCGTCGAGCGGCAACGCCTCATCTACTCGGGCCGCGTCATGAAGAACGACGACACGCTGGCCTCGTACAAGATC
AAGCCCAACAACACCATCCACATGGTCAAGAGCGCGGCCAGTAACCCCTCGCAACCCGCCTCCACCTCGACCCCG
ACCCCGCAGGCCATCCCCTCCAACATGGCCTCGGGCACCGCCAACAACCCCCTGGCTGGCCTCACCGGCGCTCGC
TATGCCGGCCACCAGGTCAATCTTCCGGGCATGGAAATGTTCGGCCCCGACGGCGGCGTGAGCCTTCCTTGACTC
GGGCCCTGCTGCCTCTCCTGTGCTGACGACTTGTGCTACAGATGGGCCCCCCCATGGACGAGGAGCGCCTGCAGC
ACATGATGGCTGACCCCAACATCCAACAGGCCATGCGCGAGGCCCTCAACAATCCCGACTTCGTCAACATGCTCA
TCGACTCGAACCCCATGCTGCGGAACATGCCTGGCGCCCGAGAGTTCATCACCTCCCCCGGCGTGCAACAGATGA
TGAGCAACCCCAATATGATACGGGACGCCATGAGGTTACAGCGCATGATGGGAGGTGGTGATGCCGCCTTTCCGG
CTCCGGGCGCGACCGACACAACGCCCGCAGGCGGTGCGGCGACCGACGGAAGCGCCAACCCAGGGACCAACGACA
ACCAGCAGAACCCGCTCATGAACCCCTTTATGATGCCGGGCTTGATGGGCGCGGGCGCGGGTGCAGGGGCTGGGC
CCGGAGGCGAAGGAGCCATCAATATGAGACAGATGCTCCAGGCCCTCGGAGCCATGGGCGCCGCCAACCCGTTTG
CGCCTCCATCGACGGCCGCCGGTGCCACGCCCGGTCAGGAGTCGCGGCAAGGCCAGGGAGGGCCGCCGACCGAAG
GGACCACGGCGTCACAGCAGGGCCAGGACCAGCAGGCGGCGAACCCCTTCGCCGCCTTGTTCCCGCCGCAAGGTG
GCGCCCAGGCTGGCAATCCGTTCGCAATGAACCCCGAAATGATGAACCAGATGATGCAGATGCTGGGAGGTGCTG
GCGCGCCGGCGCCCGCCGATAATCGCCCGCCCGAGGAGCGCTACGCCGAGCAGCTGCGGCAGCTCAACGACATGG
GCTTCTACGACTTTGACCGGAACGTGGCCGCTCTTAGGCGGAGCGGAGGAAGCGTCCAGGGCGCCATCGAACACC
TGCTTAGTTCGACGGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail