Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8159
Gene name
LocationContig_514:6309..12775
Strand+
Gene length (bp)6466
Transcript length (bp)6339
Coding sequence length (bp)6339
Protein length (aa) 2113

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00310 GATase_2 Glutamine amidotransferases class-II 9.1E-182 54 486
PF01645 Glu_synthase Conserved region in glutamate synthase 2.8E-155 868 1238
PF04898 Glu_syn_central Glutamate synthase central domain 8.6E-111 524 807
PF01493 GXGXG GXGXG motif 7.1E-86 1319 1505
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.9E-22 1750 2060
PF14691 Fer4_20 Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster 4.0E-21 1626 1735
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.6E-08 1753 1786
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 2.6E-06 1759 1786

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9T0P4|GLTB2_ARATH Ferredoxin-dependent glutamate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=GLU2 PE=1 SV=2 29 1544 0.0E+00
sp|Q9C102|GLT1_SCHPO Putative glutamate synthase [NADPH] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glt1 PE=2 SV=1 23 2100 0.0E+00
sp|O19906|GLTB_CYACA Ferredoxin-dependent glutamate synthase OS=Cyanidium caldarium GN=gltB PE=3 SV=1 50 1544 0.0E+00
sp|Q05755|GLTB_AZOBR Glutamate synthase [NADPH] large chain OS=Azospirillum brasilense GN=gltB PE=1 SV=1 45 1552 0.0E+00
sp|P09831|GLTB_ECOLI Glutamate synthase [NADPH] large chain OS=Escherichia coli (strain K12) GN=gltB PE=1 SV=3 44 1559 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9T0P4|GLTB2_ARATH Ferredoxin-dependent glutamate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=GLU2 PE=1 SV=2 29 1544 0.0E+00
sp|Q9C102|GLT1_SCHPO Putative glutamate synthase [NADPH] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glt1 PE=2 SV=1 23 2100 0.0E+00
sp|O19906|GLTB_CYACA Ferredoxin-dependent glutamate synthase OS=Cyanidium caldarium GN=gltB PE=3 SV=1 50 1544 0.0E+00
sp|Q05755|GLTB_AZOBR Glutamate synthase [NADPH] large chain OS=Azospirillum brasilense GN=gltB PE=1 SV=1 45 1552 0.0E+00
sp|P09831|GLTB_ECOLI Glutamate synthase [NADPH] large chain OS=Escherichia coli (strain K12) GN=gltB PE=1 SV=3 44 1559 0.0E+00
sp|P55038|GLTS_SYNY3 Ferredoxin-dependent glutamate synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gltS PE=1 SV=2 50 1544 0.0E+00
sp|Q06434|GLTB_ANTSP Ferredoxin-dependent glutamate synthase OS=Antithamnion sp. GN=gltB PE=3 SV=1 50 1544 0.0E+00
sp|Q1XDB2|GLTB_PYRYE Ferredoxin-dependent glutamate synthase OS=Pyropia yezoensis GN=gltB PE=3 SV=1 50 1544 0.0E+00
sp|Q43155|GLTB_SPIOL Ferredoxin-dependent glutamate synthase, chloroplastic OS=Spinacia oleracea GN=FdGOGAT PE=1 SV=3 54 1560 0.0E+00
sp|Q9ZNZ7|GLTB1_ARATH Ferredoxin-dependent glutamate synthase 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=GLU1 PE=1 SV=3 39 1561 0.0E+00
sp|Q69RJ0|GLTB_ORYSJ Ferredoxin-dependent glutamate synthase, chloroplastic OS=Oryza sativa subsp. japonica GN=GLU PE=2 SV=2 50 1562 0.0E+00
sp|Q9LV03|GLUT1_ARATH Glutamate synthase 1 [NADH], chloroplastic OS=Arabidopsis thaliana GN=GLT1 PE=2 SV=2 37 2087 0.0E+00
sp|Q12680|GLT1_YEAST Glutamate synthase [NADH] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLT1 PE=1 SV=2 33 2099 0.0E+00
sp|Q03460|GLSN_MEDSA Glutamate synthase [NADH], amyloplastic OS=Medicago sativa PE=1 SV=1 37 2084 0.0E+00
sp|P51375|GLTB_PORPU Ferredoxin-dependent glutamate synthase OS=Porphyra purpurea GN=gltB PE=3 SV=1 31 1559 0.0E+00
sp|Q0DG35|GLT2_ORYSJ Glutamate synthase 2 [NADH], chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0555600 PE=2 SV=2 43 2086 0.0E+00
sp|Q0JKD0|GLT1_ORYSJ Glutamate synthase 1 [NADH], chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0681900 PE=2 SV=1 43 2087 0.0E+00
sp|P55037|GLTB_SYNY3 Ferredoxin-dependent glutamate synthase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gltB PE=1 SV=1 39 1552 0.0E+00
sp|P96218|GLTB_MYCTU Glutamate synthase [NADPH] large chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gltB PE=1 SV=3 39 1552 0.0E+00
sp|P39812|GLTA_BACSU Glutamate synthase [NADPH] large chain OS=Bacillus subtilis (strain 168) GN=gltA PE=2 SV=3 38 1559 0.0E+00
sp|P23225|GLTB_MAIZE Ferredoxin-dependent glutamate synthase, chloroplastic OS=Zea mays GN=GLSF PE=1 SV=1 50 1562 0.0E+00
sp|O34399|GLTB_BACSU Glutamate synthase [NADPH] small chain OS=Bacillus subtilis (strain 168) GN=gltB PE=2 SV=2 1604 2091 3.0E-170
sp|P9WN19|GLTD_MYCTU Glutamate synthase [NADPH] small chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gltD PE=1 SV=1 1609 2101 4.0E-138
sp|P9WN18|GLTD_MYCTO Glutamate synthase [NADPH] small chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gltD PE=3 SV=1 1609 2101 4.0E-138
sp|Q08258|GLTB_HORVU Ferredoxin-dependent glutamate synthase (Fragment) OS=Hordeum vulgare PE=1 SV=2 54 487 3.0E-96
sp|Q05756|GLTD_AZOBR Glutamate synthase [NADPH] small chain OS=Azospirillum brasilense GN=gltD PE=1 SV=3 1609 2083 5.0E-74
sp|P09832|GLTD_ECOLI Glutamate synthase [NADPH] small chain OS=Escherichia coli (strain K12) GN=gltD PE=1 SV=3 1610 2085 4.0E-72
sp|P37127|AEGA_ECOLI Protein AegA OS=Escherichia coli (strain K12) GN=aegA PE=3 SV=2 1603 2084 5.0E-61
sp|B9KBQ2|AGLUS_THENN Archaeal-type glutamate synthase [NADPH] OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=gltB PE=3 SV=1 939 1251 1.0E-56
sp|B1L993|AGLUS_THESQ Archaeal-type glutamate synthase [NADPH] OS=Thermotoga sp. (strain RQ2) GN=gltB PE=3 SV=1 939 1251 2.0E-56
sp|Q9WYM8|AGLUS_THEMA Archaeal-type glutamate synthase [NADPH] OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gltB PE=3 SV=1 939 1251 2.0E-56
sp|O29309|AGLUS_ARCFU Archaeal glutamate synthase [NADPH] OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gltB PE=3 SV=1 910 1251 3.0E-56
sp|Q46820|YGFT_ECOLI Uncharacterized protein YgfT OS=Escherichia coli (strain K12) GN=ygfT PE=3 SV=2 1614 2080 2.0E-52
sp|Q3Z7F6|AGLUS_DEHM1 Archaeal-type glutamate synthase [NADPH] OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=gltB PE=3 SV=1 914 1246 2.0E-52
sp|Q58746|AGLUS_METJA Archaeal glutamate synthase [NADPH] OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1351 PE=3 SV=1 940 1269 7.0E-51
sp|O08340|GLTD_RHOSH Putative glutamate synthase [NADPH] small chain OS=Rhodobacter sphaeroides GN=gltD PE=3 SV=1 1687 2086 2.0E-49
sp|Q8U195|SUDHA_PYRFU Sulfide dehydrogenase subunit alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=sudA PE=1 SV=1 1621 2087 3.0E-49
sp|Q74FU5|SFRB_GEOSL NADPH-Fe(3+) oxidoreductase subunit beta OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=sfrB PE=1 SV=1 1603 2086 3.0E-26
sp|D7AF64|SFRB_GEOSK NADPH-Fe(3+) oxidoreductase subunit beta OS=Geobacter sulfurreducens (strain DL-1 / KN400) GN=sfrB PE=3 SV=1 1603 2086 3.0E-26
sp|Q8Z5A6|PRET_SALTI NAD-dependent dihydropyrimidine dehydrogenase subunit PreT homolog OS=Salmonella typhi GN=preT PE=3 SV=1 1645 2089 6.0E-25
sp|Q8ZNL8|PRET_SALTY NAD-dependent dihydropyrimidine dehydrogenase subunit PreT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=preT PE=3 SV=1 1645 2089 4.0E-24
sp|P76440|PRET_ECOLI NAD-dependent dihydropyrimidine dehydrogenase subunit PreT OS=Escherichia coli (strain K12) GN=preT PE=1 SV=1 1645 2085 5.0E-23
sp|O34849|YERD_BACSU Glutamate synthase large subunit-like protein YerD OS=Bacillus subtilis (strain 168) GN=yerD PE=3 SV=1 939 1208 5.0E-23
sp|Q8X645|PRET_ECO57 NAD-dependent dihydropyrimidine dehydrogenase subunit PreT OS=Escherichia coli O157:H7 GN=preT PE=3 SV=1 1645 2085 8.0E-23
sp|Q55FT1|DPYD_DICDI Dihydropyrimidine dehydrogenase [NADP(+)] OS=Dictyostelium discoideum GN=pyd1 PE=2 SV=1 1635 1918 1.0E-20
sp|Q8XD75|YGFK_ECO57 Uncharacterized protein YgfK OS=Escherichia coli O157:H7 GN=ygfK PE=3 SV=1 1651 2077 7.0E-20
sp|Q46811|YGFK_ECOLI Uncharacterized protein YgfK OS=Escherichia coli (strain K12) GN=ygfK PE=3 SV=1 1651 2077 2.0E-19
sp|Q6NYG8|DPYD_DANRE Dihydropyrimidine dehydrogenase [NADP(+)] OS=Danio rerio GN=dpyd PE=2 SV=1 1635 1917 1.0E-16
sp|Q8CHR6|DPYD_MOUSE Dihydropyrimidine dehydrogenase [NADP(+)] OS=Mus musculus GN=Dpyd PE=1 SV=1 1645 1917 9.0E-15
sp|Q18164|DPYD_CAEEL Dihydropyrimidine dehydrogenase [NADP(+)] OS=Caenorhabditis elegans GN=dpyd-1 PE=3 SV=2 1635 1918 1.0E-14
sp|A8XKG6|DPYD_CAEBR Probable dihydropyrimidine dehydrogenase [NADP(+)] OS=Caenorhabditis briggsae GN=dpyd-1 PE=3 SV=2 1635 1918 2.0E-13
sp|Q28943|DPYD_PIG Dihydropyrimidine dehydrogenase [NADP(+)] OS=Sus scrofa GN=DPYD PE=1 SV=1 1645 1917 4.0E-13
sp|Q8W3L1|MFDR_ARATH NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Arabidopsis thaliana GN=MFDR PE=1 SV=1 1751 1868 2.0E-07
sp|Q8VQF5|CINB_CITBR Cindoxin reductase OS=Citrobacter braakii GN=cinB PE=3 SV=1 1750 1925 3.0E-07
sp|O87392|GLXD_RHIME Glutamate synthase large subunit-like protein OS=Rhizobium meliloti (strain 1021) GN=glxD PE=3 SV=2 940 1243 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors Yes
GO:0006807 nitrogen compound metabolic process Yes
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity Yes
GO:0015930 glutamate synthase activity Yes
GO:0006537 glutamate biosynthetic process Yes
GO:0016053 organic acid biosynthetic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:0019752 carboxylic acid metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0043650 dicarboxylic acid biosynthetic process No
GO:0003674 molecular_function No
GO:0043436 oxoacid metabolic process No
GO:0044238 primary metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0006536 glutamate metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0044283 small molecule biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0006082 organic acid metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0009064 glutamine family amino acid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0003824 catalytic activity No
GO:0043648 dicarboxylic acid metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8159
MGLLEDFDDRQISLEAEQQEYKPYEYQTDNNGSWAGALPVKQGLYDPSYEKDACGVGFACHIKGKASHKIVSDAR
NLLCNMTHRGAVGSDARDGDGAGVMTSIPHWFFIKNFEREQGIKLPPPGQYAVGNLFFKPDEETLLESQRQLEDV
AESLGLRVLGWRRPPVDSSLLGPAARSREPIIAQPFVVLASAYGPGDAPDMTDPARFDDRLFERQLYVLRKRATH
TIGLKNWFYLCSLSNKNIVYKGQLAPVQVYSYYHDLVNADYEAHFALVHSRFSTNTFPSWDRAQPLRWAAHNGEI
NTLRGNKNWMRAREGVMHSDIFKEDLELMYPIVEDGGSDSAAFDNVLELLTINGVLSLPEAVMLMVPEAWQGNEH
MDPQKAAFYEWAACQMEPWDGPALFTFADGRYCGANLDRNGLRPCRFYVMDDDRIICASEVGTIPVEPETVVQKG
RLQPGRMLLVDTQAGRIIDDKELKNAVSSRHDFRAWLDRELITMPKVVESLESSMDLEAKPDAILLQEDPLLLSF
GYTHEQVSLLLAPMAADEKEALGSMGNDAPLACLTQAPRLLYDYFRQLFAQVTNPPIDPIRESIVMSLECYVGPQ
GNLLEMDSSQCGRLMLPSPILSMPEFNAMVNMSSVHPEWTVKTIDLTFPKSQGVQGYLDHLDEICNEATAAIEAG
DRLIVLSDRKTSAERVPVSAALASGMVHHHLVSNKWRSMAALVVETAEAREVHHMCVLLGYGADAVNPYLAMECI
LKLNREGLIKKKLSDEALIRNYKHSCDGGILKVMSKMGISTLASYKGAQIFEALGLDEAVVDRCFKGTASRIQGL
TFDLIAEDAFRFHERGFPSRYTVGIQGLPESGEYHWRDGGEAHVNDPTSIANIQDAVRSKNDKSYEAYSRSEYEQ
IKNCTLRGLLDFKFEDCTPVPIDQVEPWTEIVRRFCTGAMSYGSISMESHSTLAVAMNRLGGKSNTGEGGEDPER
SQRMPNGDTMRSAIKQVASGRFGVTSAYLADSDELQIKMAQGAKPGEGGELPGHKVSKSIARTRHSTPGVGLISP
PPHHDIYSIEDLKQLIYDLKCSSPRSRVSVKLVSEVGVGIVASGVAKAKADHILISGHDGGTGASRWTGIKYAGL
PWELGLAETHQTLVLNDLRGRVVVQTDGQLRTGRDIAIACLLGAEEWGFATAPLIAMGCIMMRKCHLNSCPVGIA
TQDPELRQKFQGTPEHVINFFYYLANELRAIMAQLGFRTINEMVGHVEVLKLRDDLRTKKTANVDLSLLLTPAHK
LRPGVATFNVRKQDHKLYIRLDNKLISEAELTLDKGLPSRIECDIINTDRAMGTSLSYQISKRYGEAGLPLDTVH
VNIKGSAGQSFGAFLAPGVTLELEGDANDYVGKGLSGGRLIIYPPRAAVFKAEENILVGNVCLYGATSGTCFFRG
VAAERFAVRNSGATAVVEGVGDHGCEYMTGGRILVLGSTGRNFAAGMSGGIAYVLDVQRDFHSKLNTEMVEAGPL
EDPAEIAYLRGLIEDHHHYTGSERAARILVDFNRALPRFVKVLPVDYKRVLEEEAAKAAAAKRAEYNLPVVPSAK
QKGDEAAKLQDMEEAFGDKAAEKKRALVLDKTKGFMKYARRSEKYRSANTRIKDWAELSSRLNEDELKYQSARCM
DCGVPFCQSETGCPISNIIPKWNELVFQNQWKDALNRLLMTNNFPEFTGRVCPAPCEGACVLGINEDPVGIKSIE
CAIIDRGFEMGWMVPQPPKVRTGKAVAIIGSGPAGLACADQLNRAGHTVTVYERADRLGGLLMYGIPNMKLDKRI
VKRRTDFMAAEGVNFETGVAIGEDGQLSLDDLRGKNDAVVIATGATVARDLPIKGRALDGIHFAMEFLHKNTKSL
LDSELADKSYITAKDKHVVVIGGGDTGNDCIGTSVRHGATSVTNFELLPQPPPERARDNPWPQWPRIYRVDYGHT
EVRQHTGKDPREYCIMSEEFVDDGSGKVKGINTIRVEWTKSPSGGWDMKKVDGSQQFFPADLVLLAMGFLGPESR
VLGEEIEKDARKNVKTPAGKYCTNLDGVFAAGDARRGQSLIVWGINEGRMAAREVDMYLEKSTNLPVTGGIVKRT
AQEILSRVVEAQ*
Coding >Hirsu2|8159
ATGGGCCTGCTCGAGGATTTTGACGACCGACAAATCTCTCTCGAAGCGGAACAGCAGGAATACAAGCCTTACGAG
TACCAGACCGACAACAATGGCTCCTGGGCTGGCGCCCTGCCGGTGAAGCAGGGTCTCTACGACCCGTCCTATGAA
AAGGATGCATGCGGTGTCGGCTTTGCCTGCCATATCAAGGGCAAGGCCAGCCACAAAATCGTCAGCGATGCGCGC
AATCTCCTCTGCAACATGACCCACCGCGGTGCCGTGGGTTCCGACGCTCGAGATGGCGACGGCGCCGGCGTCATG
ACCTCCATCCCCCACTGGTTCTTCATCAAGAACTTCGAGAGGGAGCAGGGCATCAAACTGCCGCCCCCCGGCCAG
TATGCCGTGGGCAACCTGTTCTTCAAGCCCGACGAGGAGACGCTCCTCGAGTCCCAGAGGCAGCTGGAAGATGTT
GCCGAGTCGCTGGGCTTGCGCGTCCTGGGCTGGCGCCGCCCCCCCGTCGACTCGTCCCTGCTCGGCCCCGCCGCC
AGGTCGCGCGAGCCCATCATTGCCCAGCCCTTCGTCGTCCTGGCCTCGGCCTACGGCCCCGGCGACGCCCCGGAC
ATGACGGACCCGGCCCGCTTCGACGACCGCTTGTTCGAGCGCCAGCTCTACGTCTTGCGGAAGCGCGCCACCCAC
ACCATCGGCCTCAAGAACTGGTTCTACCTGTGCTCGCTCTCCAACAAGAACATCGTCTACAAGGGACAGCTTGCC
CCCGTGCAGGTCTACTCCTACTACCACGACCTTGTCAACGCCGACTACGAGGCTCACTTTGCTCTAGTCCACTCT
CGCTTCTCCACCAACACCTTCCCCTCATGGGACCGAGCCCAGCCGCTGCGCTGGGCCGCTCACAATGGCGAGATC
AACACGCTGCGTGGCAACAAGAACTGGATGCGCGCCCGCGAGGGCGTCATGCATTCCGACATCTTCAAGGAGGAC
CTTGAGCTGATGTACCCCATCGTCGAGGACGGCGGCTCCGACTCGGCTGCCTTCGACAACGTCCTCGAGCTGCTC
ACCATCAACGGTGTGCTGTCCCTGCCCGAGGCCGTCATGCTCATGGTGCCCGAGGCCTGGCAGGGCAACGAGCAC
ATGGACCCCCAGAAGGCCGCCTTCTACGAGTGGGCGGCCTGCCAGATGGAGCCCTGGGACGGCCCGGCTCTCTTC
ACCTTTGCCGACGGCCGCTACTGCGGCGCCAACCTCGACCGGAACGGACTGCGGCCCTGCCGCTTCTACGTCATG
GACGACGACCGCATCATCTGCGCCTCCGAGGTCGGCACCATCCCCGTCGAGCCCGAGACCGTCGTTCAGAAGGGT
CGGCTGCAGCCGGGACGCATGCTGCTGGTCGATACCCAGGCCGGCCGCATCATCGACGACAAGGAGCTCAAGAAC
GCCGTCTCGAGCCGCCACGACTTCCGCGCTTGGCTCGACCGGGAGCTCATCACCATGCCCAAGGTCGTCGAGTCC
CTCGAGTCCTCGATGGACCTCGAGGCCAAGCCCGACGCCATCCTCCTCCAGGAGGACCCACTGCTCCTCTCCTTC
GGCTACACCCACGAGCAGGTCAGCTTGCTGCTGGCCCCCATGGCGGCCGACGAGAAGGAGGCGTTGGGATCCATG
GGCAACGATGCGCCCCTGGCATGCCTGACGCAGGCGCCCCGCCTCCTCTACGACTACTTCCGCCAGCTCTTCGCC
CAGGTCACCAACCCGCCCATCGACCCCATCCGGGAGTCCATTGTCATGTCTCTCGAGTGCTATGTTGGCCCCCAG
GGCAACCTGCTCGAGATGGACTCGTCCCAGTGCGGTCGTCTGATGCTCCCTAGCCCTATCCTGTCCATGCCCGAG
TTCAACGCCATGGTCAACATGTCCTCCGTCCACCCGGAGTGGACCGTCAAGACCATTGACCTGACCTTCCCCAAG
TCTCAGGGCGTCCAGGGCTACCTGGATCACCTGGACGAGATCTGTAACGAGGCCACGGCGGCCATCGAGGCTGGA
GACCGTCTCATCGTCCTGTCTGACCGCAAGACTTCCGCCGAACGCGTTCCCGTCTCCGCCGCGCTCGCCTCGGGC
ATGGTCCACCACCATCTCGTCAGCAATAAATGGCGATCCATGGCCGCTCTCGTCGTCGAGACTGCCGAAGCCCGC
GAGGTCCACCACATGTGCGTGCTGCTCGGCTATGGCGCCGACGCCGTGAACCCGTACCTGGCCATGGAGTGCATC
CTGAAGCTGAACCGGGAGGGCTTGATCAAGAAGAAGCTGTCCGACGAGGCTCTGATCCGTAATTACAAGCACTCC
TGCGATGGTGGCATCCTCAAGGTGATGAGTAAGATGGGCATCTCGACCTTGGCGTCGTACAAGGGCGCCCAAATC
TTCGAGGCCCTCGGCCTTGACGAGGCCGTCGTCGACCGCTGCTTCAAGGGCACGGCCTCGCGCATCCAGGGCCTC
ACCTTTGACCTCATTGCCGAGGACGCCTTCCGATTCCACGAGCGCGGCTTCCCTTCGCGATACACCGTCGGCATC
CAAGGCCTCCCCGAGTCGGGCGAGTACCACTGGCGTGACGGTGGCGAGGCTCACGTCAACGATCCGACCTCGATT
GCCAATATTCAGGACGCCGTCCGCTCCAAGAACGACAAGTCGTACGAGGCCTATTCGCGGTCCGAGTACGAGCAG
ATCAAGAACTGCACCCTCCGTGGCCTCTTGGATTTCAAGTTTGAGGATTGCACGCCTGTGCCCATCGACCAGGTT
GAGCCGTGGACCGAGATCGTCCGACGATTCTGCACCGGAGCCATGTCGTACGGATCCATCTCCATGGAGTCGCAC
TCCACCCTGGCTGTGGCCATGAACAGGCTGGGCGGCAAGTCCAACACGGGCGAGGGTGGCGAGGACCCCGAACGC
TCGCAGCGTATGCCCAACGGAGACACGATGAGGTCTGCCATCAAGCAGGTCGCGTCCGGCCGTTTCGGCGTCACC
TCCGCCTATCTCGCCGACTCGGACGAGCTGCAGATCAAGATGGCCCAGGGCGCCAAGCCTGGCGAAGGCGGCGAG
CTGCCCGGCCACAAGGTGTCCAAGTCCATCGCCCGCACGCGCCACTCGACTCCCGGTGTCGGTCTTATCTCGCCG
CCTCCTCACCACGACATCTACTCGATCGAAGATCTCAAACAGCTGATCTACGACCTGAAGTGCTCCAGTCCCCGA
TCGCGCGTCTCGGTCAAACTCGTCTCCGAGGTCGGCGTCGGCATCGTCGCTTCGGGCGTGGCCAAGGCCAAGGCC
GACCACATCCTCATCTCCGGCCACGACGGCGGCACAGGCGCCTCGCGATGGACCGGCATCAAGTATGCCGGTCTT
CCGTGGGAATTGGGTCTGGCCGAGACCCACCAGACACTGGTTCTGAACGATCTGCGCGGTCGTGTCGTGGTACAG
ACGGACGGCCAGCTGAGGACCGGCAGGGACATTGCCATCGCCTGTCTGCTCGGGGCCGAGGAATGGGGGTTTGCC
ACGGCTCCTCTCATCGCCATGGGCTGCATTATGATGCGAAAATGCCACCTCAACTCTTGCCCTGTCGGCATTGCC
ACTCAGGATCCCGAGCTCCGACAGAAGTTCCAGGGAACCCCTGAGCACGTCATCAACTTCTTCTACTATCTCGCC
AACGAGCTCCGCGCCATCATGGCCCAGCTTGGCTTCCGTACGATCAACGAAATGGTCGGCCACGTCGAAGTTCTC
AAGCTACGGGATGACCTGCGCACGAAGAAGACCGCCAACGTCGACCTTTCCCTGCTCCTGACCCCGGCGCATAAG
CTCCGTCCTGGCGTCGCTACTTTCAACGTCCGCAAGCAGGATCATAAGCTGTACATCCGCCTCGACAACAAATTG
ATTTCCGAGGCTGAGTTGACCCTCGACAAGGGGCTCCCGTCCCGGATCGAGTGTGACATCATCAATACCGACCGG
GCCATGGGCACGTCCTTGTCGTACCAGATCTCGAAGCGATACGGCGAGGCCGGTCTGCCCCTGGACACGGTTCAT
GTCAATATCAAGGGGTCGGCTGGCCAGTCCTTCGGCGCCTTCCTTGCCCCTGGCGTCACTTTGGAACTGGAGGGT
GATGCCAACGACTATGTTGGCAAGGGCCTGTCCGGTGGCCGTCTCATCATCTATCCGCCCCGTGCCGCAGTCTTC
AAAGCCGAGGAGAACATACTGGTTGGCAACGTCTGTCTGTACGGCGCTACGAGCGGAACCTGCTTCTTCCGAGGC
GTCGCTGCCGAGCGTTTCGCCGTCCGCAACTCGGGTGCCACGGCGGTTGTTGAAGGGGTCGGCGACCACGGTTGC
GAGTACATGACTGGCGGCCGCATCCTCGTGCTCGGGAGCACTGGGCGAAACTTCGCTGCCGGCATGTCGGGAGGC
ATTGCTTACGTGCTCGACGTTCAGCGTGACTTCCACTCCAAGCTCAACACGGAGATGGTTGAGGCGGGACCGCTT
GAGGATCCGGCCGAGATTGCCTATCTCCGCGGGCTGATCGAGGACCACCACCACTACACCGGCTCTGAGCGGGCG
GCTCGTATCCTCGTCGACTTCAACCGTGCACTCCCTCGCTTCGTCAAGGTTTTGCCCGTCGACTACAAGCGGGTC
TTGGAAGAGGAGGCTGCCAAAGCGGCGGCCGCCAAGCGGGCTGAGTACAACCTCCCGGTTGTTCCCAGCGCCAAG
CAGAAGGGCGACGAGGCCGCCAAGCTCCAGGACATGGAGGAGGCTTTCGGTGACAAGGCTGCCGAGAAGAAACGA
GCTTTGGTTCTTGACAAGACCAAGGGCTTCATGAAGTACGCGCGGCGCTCGGAGAAGTATCGCTCTGCCAATACG
CGCATCAAGGACTGGGCCGAGCTTAGCTCCCGCCTGAACGAGGACGAGCTCAAGTATCAGTCGGCTCGCTGCATG
GACTGCGGTGTGCCCTTCTGTCAGTCCGAGACCGGCTGCCCCATCTCCAACATCATTCCCAAGTGGAACGAGCTC
GTTTTCCAGAACCAATGGAAGGACGCGCTCAACCGCCTCCTCATGACCAACAACTTCCCCGAGTTTACTGGCCGC
GTCTGCCCTGCCCCCTGCGAAGGCGCATGCGTTCTGGGCATCAACGAGGACCCTGTCGGAATTAAGTCGATCGAG
TGTGCCATTATCGACCGCGGTTTCGAGATGGGCTGGATGGTTCCGCAGCCGCCCAAGGTCCGCACGGGTAAGGCG
GTCGCCATCATCGGATCCGGGCCGGCTGGACTGGCCTGCGCCGACCAGCTCAACCGAGCTGGCCACACGGTGACT
GTCTACGAGCGCGCGGATCGCCTCGGCGGGCTGCTCATGTACGGCATCCCGAACATGAAGCTGGACAAGCGAATC
GTCAAGCGCCGCACCGACTTCATGGCAGCGGAGGGCGTCAACTTCGAGACTGGCGTTGCGATTGGCGAGGACGGC
CAACTGAGCCTGGATGATCTCAGGGGCAAGAACGACGCCGTCGTCATTGCTACGGGCGCCACGGTTGCTCGCGAC
CTGCCCATCAAGGGCCGAGCTCTGGATGGCATCCACTTTGCCATGGAGTTCCTGCACAAGAATACCAAGTCTCTG
CTCGACTCGGAGCTGGCTGACAAGTCGTACATCACGGCCAAGGACAAGCACGTGGTCGTCATCGGCGGCGGCGAC
ACGGGCAACGACTGCATCGGCACGTCGGTTCGCCATGGCGCTACGTCGGTCACCAACTTCGAGCTGCTGCCTCAG
CCGCCGCCGGAGCGTGCTCGCGACAACCCCTGGCCACAGTGGCCTCGGATCTACCGCGTCGACTACGGCCACACG
GAGGTGCGCCAACACACGGGTAAAGACCCCCGTGAGTACTGCATCATGTCGGAGGAGTTTGTCGACGACGGCAGC
GGCAAGGTCAAGGGCATCAACACGATCCGCGTGGAGTGGACCAAGTCGCCCAGCGGCGGCTGGGACATGAAGAAG
GTGGACGGCTCCCAGCAGTTCTTCCCCGCCGACCTCGTCCTCTTGGCCATGGGATTCCTGGGGCCCGAGTCTCGC
GTGCTGGGCGAGGAGATCGAGAAGGACGCCCGCAAAAATGTCAAGACGCCGGCGGGCAAGTACTGCACGAACCTG
GACGGCGTGTTTGCCGCGGGCGATGCCCGCCGTGGGCAGTCTTTGATTGTCTGGGGAATTAACGAAGGGCGCATG
GCAGCGCGTGAGGTGGACATGTACCTCGAGAAAAGCACCAACCTCCCGGTGACGGGCGGCATCGTGAAGCGCACG
GCCCAGGAGATTTTGAGCAGGGTCGTCGAGGCCCAGTAA
Transcript >Hirsu2|8159
ATGGGCCTGCTCGAGGATTTTGACGACCGACAAATCTCTCTCGAAGCGGAACAGCAGGAATACAAGCCTTACGAG
TACCAGACCGACAACAATGGCTCCTGGGCTGGCGCCCTGCCGGTGAAGCAGGGTCTCTACGACCCGTCCTATGAA
AAGGATGCATGCGGTGTCGGCTTTGCCTGCCATATCAAGGGCAAGGCCAGCCACAAAATCGTCAGCGATGCGCGC
AATCTCCTCTGCAACATGACCCACCGCGGTGCCGTGGGTTCCGACGCTCGAGATGGCGACGGCGCCGGCGTCATG
ACCTCCATCCCCCACTGGTTCTTCATCAAGAACTTCGAGAGGGAGCAGGGCATCAAACTGCCGCCCCCCGGCCAG
TATGCCGTGGGCAACCTGTTCTTCAAGCCCGACGAGGAGACGCTCCTCGAGTCCCAGAGGCAGCTGGAAGATGTT
GCCGAGTCGCTGGGCTTGCGCGTCCTGGGCTGGCGCCGCCCCCCCGTCGACTCGTCCCTGCTCGGCCCCGCCGCC
AGGTCGCGCGAGCCCATCATTGCCCAGCCCTTCGTCGTCCTGGCCTCGGCCTACGGCCCCGGCGACGCCCCGGAC
ATGACGGACCCGGCCCGCTTCGACGACCGCTTGTTCGAGCGCCAGCTCTACGTCTTGCGGAAGCGCGCCACCCAC
ACCATCGGCCTCAAGAACTGGTTCTACCTGTGCTCGCTCTCCAACAAGAACATCGTCTACAAGGGACAGCTTGCC
CCCGTGCAGGTCTACTCCTACTACCACGACCTTGTCAACGCCGACTACGAGGCTCACTTTGCTCTAGTCCACTCT
CGCTTCTCCACCAACACCTTCCCCTCATGGGACCGAGCCCAGCCGCTGCGCTGGGCCGCTCACAATGGCGAGATC
AACACGCTGCGTGGCAACAAGAACTGGATGCGCGCCCGCGAGGGCGTCATGCATTCCGACATCTTCAAGGAGGAC
CTTGAGCTGATGTACCCCATCGTCGAGGACGGCGGCTCCGACTCGGCTGCCTTCGACAACGTCCTCGAGCTGCTC
ACCATCAACGGTGTGCTGTCCCTGCCCGAGGCCGTCATGCTCATGGTGCCCGAGGCCTGGCAGGGCAACGAGCAC
ATGGACCCCCAGAAGGCCGCCTTCTACGAGTGGGCGGCCTGCCAGATGGAGCCCTGGGACGGCCCGGCTCTCTTC
ACCTTTGCCGACGGCCGCTACTGCGGCGCCAACCTCGACCGGAACGGACTGCGGCCCTGCCGCTTCTACGTCATG
GACGACGACCGCATCATCTGCGCCTCCGAGGTCGGCACCATCCCCGTCGAGCCCGAGACCGTCGTTCAGAAGGGT
CGGCTGCAGCCGGGACGCATGCTGCTGGTCGATACCCAGGCCGGCCGCATCATCGACGACAAGGAGCTCAAGAAC
GCCGTCTCGAGCCGCCACGACTTCCGCGCTTGGCTCGACCGGGAGCTCATCACCATGCCCAAGGTCGTCGAGTCC
CTCGAGTCCTCGATGGACCTCGAGGCCAAGCCCGACGCCATCCTCCTCCAGGAGGACCCACTGCTCCTCTCCTTC
GGCTACACCCACGAGCAGGTCAGCTTGCTGCTGGCCCCCATGGCGGCCGACGAGAAGGAGGCGTTGGGATCCATG
GGCAACGATGCGCCCCTGGCATGCCTGACGCAGGCGCCCCGCCTCCTCTACGACTACTTCCGCCAGCTCTTCGCC
CAGGTCACCAACCCGCCCATCGACCCCATCCGGGAGTCCATTGTCATGTCTCTCGAGTGCTATGTTGGCCCCCAG
GGCAACCTGCTCGAGATGGACTCGTCCCAGTGCGGTCGTCTGATGCTCCCTAGCCCTATCCTGTCCATGCCCGAG
TTCAACGCCATGGTCAACATGTCCTCCGTCCACCCGGAGTGGACCGTCAAGACCATTGACCTGACCTTCCCCAAG
TCTCAGGGCGTCCAGGGCTACCTGGATCACCTGGACGAGATCTGTAACGAGGCCACGGCGGCCATCGAGGCTGGA
GACCGTCTCATCGTCCTGTCTGACCGCAAGACTTCCGCCGAACGCGTTCCCGTCTCCGCCGCGCTCGCCTCGGGC
ATGGTCCACCACCATCTCGTCAGCAATAAATGGCGATCCATGGCCGCTCTCGTCGTCGAGACTGCCGAAGCCCGC
GAGGTCCACCACATGTGCGTGCTGCTCGGCTATGGCGCCGACGCCGTGAACCCGTACCTGGCCATGGAGTGCATC
CTGAAGCTGAACCGGGAGGGCTTGATCAAGAAGAAGCTGTCCGACGAGGCTCTGATCCGTAATTACAAGCACTCC
TGCGATGGTGGCATCCTCAAGGTGATGAGTAAGATGGGCATCTCGACCTTGGCGTCGTACAAGGGCGCCCAAATC
TTCGAGGCCCTCGGCCTTGACGAGGCCGTCGTCGACCGCTGCTTCAAGGGCACGGCCTCGCGCATCCAGGGCCTC
ACCTTTGACCTCATTGCCGAGGACGCCTTCCGATTCCACGAGCGCGGCTTCCCTTCGCGATACACCGTCGGCATC
CAAGGCCTCCCCGAGTCGGGCGAGTACCACTGGCGTGACGGTGGCGAGGCTCACGTCAACGATCCGACCTCGATT
GCCAATATTCAGGACGCCGTCCGCTCCAAGAACGACAAGTCGTACGAGGCCTATTCGCGGTCCGAGTACGAGCAG
ATCAAGAACTGCACCCTCCGTGGCCTCTTGGATTTCAAGTTTGAGGATTGCACGCCTGTGCCCATCGACCAGGTT
GAGCCGTGGACCGAGATCGTCCGACGATTCTGCACCGGAGCCATGTCGTACGGATCCATCTCCATGGAGTCGCAC
TCCACCCTGGCTGTGGCCATGAACAGGCTGGGCGGCAAGTCCAACACGGGCGAGGGTGGCGAGGACCCCGAACGC
TCGCAGCGTATGCCCAACGGAGACACGATGAGGTCTGCCATCAAGCAGGTCGCGTCCGGCCGTTTCGGCGTCACC
TCCGCCTATCTCGCCGACTCGGACGAGCTGCAGATCAAGATGGCCCAGGGCGCCAAGCCTGGCGAAGGCGGCGAG
CTGCCCGGCCACAAGGTGTCCAAGTCCATCGCCCGCACGCGCCACTCGACTCCCGGTGTCGGTCTTATCTCGCCG
CCTCCTCACCACGACATCTACTCGATCGAAGATCTCAAACAGCTGATCTACGACCTGAAGTGCTCCAGTCCCCGA
TCGCGCGTCTCGGTCAAACTCGTCTCCGAGGTCGGCGTCGGCATCGTCGCTTCGGGCGTGGCCAAGGCCAAGGCC
GACCACATCCTCATCTCCGGCCACGACGGCGGCACAGGCGCCTCGCGATGGACCGGCATCAAGTATGCCGGTCTT
CCGTGGGAATTGGGTCTGGCCGAGACCCACCAGACACTGGTTCTGAACGATCTGCGCGGTCGTGTCGTGGTACAG
ACGGACGGCCAGCTGAGGACCGGCAGGGACATTGCCATCGCCTGTCTGCTCGGGGCCGAGGAATGGGGGTTTGCC
ACGGCTCCTCTCATCGCCATGGGCTGCATTATGATGCGAAAATGCCACCTCAACTCTTGCCCTGTCGGCATTGCC
ACTCAGGATCCCGAGCTCCGACAGAAGTTCCAGGGAACCCCTGAGCACGTCATCAACTTCTTCTACTATCTCGCC
AACGAGCTCCGCGCCATCATGGCCCAGCTTGGCTTCCGTACGATCAACGAAATGGTCGGCCACGTCGAAGTTCTC
AAGCTACGGGATGACCTGCGCACGAAGAAGACCGCCAACGTCGACCTTTCCCTGCTCCTGACCCCGGCGCATAAG
CTCCGTCCTGGCGTCGCTACTTTCAACGTCCGCAAGCAGGATCATAAGCTGTACATCCGCCTCGACAACAAATTG
ATTTCCGAGGCTGAGTTGACCCTCGACAAGGGGCTCCCGTCCCGGATCGAGTGTGACATCATCAATACCGACCGG
GCCATGGGCACGTCCTTGTCGTACCAGATCTCGAAGCGATACGGCGAGGCCGGTCTGCCCCTGGACACGGTTCAT
GTCAATATCAAGGGGTCGGCTGGCCAGTCCTTCGGCGCCTTCCTTGCCCCTGGCGTCACTTTGGAACTGGAGGGT
GATGCCAACGACTATGTTGGCAAGGGCCTGTCCGGTGGCCGTCTCATCATCTATCCGCCCCGTGCCGCAGTCTTC
AAAGCCGAGGAGAACATACTGGTTGGCAACGTCTGTCTGTACGGCGCTACGAGCGGAACCTGCTTCTTCCGAGGC
GTCGCTGCCGAGCGTTTCGCCGTCCGCAACTCGGGTGCCACGGCGGTTGTTGAAGGGGTCGGCGACCACGGTTGC
GAGTACATGACTGGCGGCCGCATCCTCGTGCTCGGGAGCACTGGGCGAAACTTCGCTGCCGGCATGTCGGGAGGC
ATTGCTTACGTGCTCGACGTTCAGCGTGACTTCCACTCCAAGCTCAACACGGAGATGGTTGAGGCGGGACCGCTT
GAGGATCCGGCCGAGATTGCCTATCTCCGCGGGCTGATCGAGGACCACCACCACTACACCGGCTCTGAGCGGGCG
GCTCGTATCCTCGTCGACTTCAACCGTGCACTCCCTCGCTTCGTCAAGGTTTTGCCCGTCGACTACAAGCGGGTC
TTGGAAGAGGAGGCTGCCAAAGCGGCGGCCGCCAAGCGGGCTGAGTACAACCTCCCGGTTGTTCCCAGCGCCAAG
CAGAAGGGCGACGAGGCCGCCAAGCTCCAGGACATGGAGGAGGCTTTCGGTGACAAGGCTGCCGAGAAGAAACGA
GCTTTGGTTCTTGACAAGACCAAGGGCTTCATGAAGTACGCGCGGCGCTCGGAGAAGTATCGCTCTGCCAATACG
CGCATCAAGGACTGGGCCGAGCTTAGCTCCCGCCTGAACGAGGACGAGCTCAAGTATCAGTCGGCTCGCTGCATG
GACTGCGGTGTGCCCTTCTGTCAGTCCGAGACCGGCTGCCCCATCTCCAACATCATTCCCAAGTGGAACGAGCTC
GTTTTCCAGAACCAATGGAAGGACGCGCTCAACCGCCTCCTCATGACCAACAACTTCCCCGAGTTTACTGGCCGC
GTCTGCCCTGCCCCCTGCGAAGGCGCATGCGTTCTGGGCATCAACGAGGACCCTGTCGGAATTAAGTCGATCGAG
TGTGCCATTATCGACCGCGGTTTCGAGATGGGCTGGATGGTTCCGCAGCCGCCCAAGGTCCGCACGGGTAAGGCG
GTCGCCATCATCGGATCCGGGCCGGCTGGACTGGCCTGCGCCGACCAGCTCAACCGAGCTGGCCACACGGTGACT
GTCTACGAGCGCGCGGATCGCCTCGGCGGGCTGCTCATGTACGGCATCCCGAACATGAAGCTGGACAAGCGAATC
GTCAAGCGCCGCACCGACTTCATGGCAGCGGAGGGCGTCAACTTCGAGACTGGCGTTGCGATTGGCGAGGACGGC
CAACTGAGCCTGGATGATCTCAGGGGCAAGAACGACGCCGTCGTCATTGCTACGGGCGCCACGGTTGCTCGCGAC
CTGCCCATCAAGGGCCGAGCTCTGGATGGCATCCACTTTGCCATGGAGTTCCTGCACAAGAATACCAAGTCTCTG
CTCGACTCGGAGCTGGCTGACAAGTCGTACATCACGGCCAAGGACAAGCACGTGGTCGTCATCGGCGGCGGCGAC
ACGGGCAACGACTGCATCGGCACGTCGGTTCGCCATGGCGCTACGTCGGTCACCAACTTCGAGCTGCTGCCTCAG
CCGCCGCCGGAGCGTGCTCGCGACAACCCCTGGCCACAGTGGCCTCGGATCTACCGCGTCGACTACGGCCACACG
GAGGTGCGCCAACACACGGGTAAAGACCCCCGTGAGTACTGCATCATGTCGGAGGAGTTTGTCGACGACGGCAGC
GGCAAGGTCAAGGGCATCAACACGATCCGCGTGGAGTGGACCAAGTCGCCCAGCGGCGGCTGGGACATGAAGAAG
GTGGACGGCTCCCAGCAGTTCTTCCCCGCCGACCTCGTCCTCTTGGCCATGGGATTCCTGGGGCCCGAGTCTCGC
GTGCTGGGCGAGGAGATCGAGAAGGACGCCCGCAAAAATGTCAAGACGCCGGCGGGCAAGTACTGCACGAACCTG
GACGGCGTGTTTGCCGCGGGCGATGCCCGCCGTGGGCAGTCTTTGATTGTCTGGGGAATTAACGAAGGGCGCATG
GCAGCGCGTGAGGTGGACATGTACCTCGAGAAAAGCACCAACCTCCCGGTGACGGGCGGCATCGTGAAGCGCACG
GCCCAGGAGATTTTGAGCAGGGTCGTCGAGGCCCAGTAA
Gene >Hirsu2|8159
ATGGGCCTGCTCGAGGATTTTGACGACCGACAAATCTCTCTCGAAGCGGAACAGCAGGAATACAAGCCTTACGAG
TACCAGACCGACAACAATGGCTCCTGGGCTGGCGCCCTGCCGGTGAAGCAGGGTCTCTACGACCCGTCCTATGAA
AAGGATGCATGCGGTGTCGGCTTTGCCTGGTGAGTCCGCCCCTTCCGTCCTGGCCGCCGCGCCCTGGCTGACGCT
CGGGCAGCCATATCAAGGGCAAGGCCAGCCACAAAATCGTCAGCGATGCGCGCAATCTCCTCTGCAACATGACCC
ACCGCGGTGCCGTGGGTTCCGACGCTCGAGATGGCGACGGCGCCGGCGTCATGACCTCCATCCCCCACTGGTTCT
TCATCAAGAACTTCGAGAGGGAGCAGGGCATCAAACTGCCGCCCCCCGGCCAGTATGCCGTGGGCAACCTGTTCT
TCAAGCCCGACGAGGAGACGCTCCTCGAGTCCCAGAGGCAGCTGGAAGATGTTGCCGAGTCGCTGGGCTTGCGCG
TCCTGGGCTGGCGCCGCCCCCCCGTCGACTCGTCCCTGCTCGGCCCCGCCGCCAGGTCGCGCGAGCCCATCATTG
CCCAGCCCTTCGTCGTCCTGGCCTCGGCCTACGGCCCCGGCGACGCCCCGGACATGACGGACCCGGCCCGCTTCG
ACGACCGCTTGTTCGAGCGCCAGCTCTACGTCTTGCGGAAGCGCGCCACCCACACCATCGGCCTCAAGAACTGGT
TCTACCTGTGCTCGCTCTCCAACAAGAACATCGTCTACAAGGGACAGCTTGCCCCCGTGCAGGTCTACTCCTACT
ACCACGACCTTGTCAACGCCGACTACGAGGCTCACTTTGCTCTAGTCCACTCTCGCTTCTCCACCAACACCTTCC
CCTCATGGGACCGAGCCCAGCCGCTGCGCTGGGCCGCTCACAATGGCGAGATCAACACGCTGCGTGGCAACAAGA
ACTGGATGCGCGCCCGCGAGGGCGTCATGCATTCCGACATCTTCAAGGAGGACCTTGAGCTGATGTACCCCATCG
TCGAGGACGGCGGCTCCGACTCGGCTGCCTTCGACAACGTCCTCGAGCTGCTCACCATCAACGGTGTGCTGTCCC
TGCCCGAGGCCGTCATGCTCATGGTGCCCGAGGCCTGGCAGGGCAACGAGCACATGGACCCCCAGAAGGCCGCCT
TCTACGAGTGGGCGGCCTGCCAGATGGAGCCCTGGGACGGCCCGGCTCTCTTCACCTTTGCCGACGGCCGCTACT
GCGGCGCCAACCTCGACCGGAACGGACTGCGGCCCTGCCGCTTCTACGTCATGGACGACGACCGCATCATCTGCG
CCTCCGAGGTCGGCACCATCCCCGTCGAGCCCGAGACCGTCGTTCAGAAGGGTCGGCTGCAGCCGGGACGCATGC
TGCTGGTCGATACCCAGGCCGGCCGCATCATCGACGACAAGGAGCTCAAGAACGCCGTCTCGAGCCGCCACGACT
TCCGCGCTTGGCTCGACCGGGAGCTCATCACCATGCCCAAGGTCGTCGAGTCCCTCGAGTCCTCGATGGACCTCG
AGGCCAAGCCCGACGCCATCCTCCTCCAGGAGGACCCACTGCTCCTCTCCTTCGGCTACACCCACGAGCAGGTCA
GCTTGCTGCTGGCCCCCATGGCGGCCGACGAGAAGGAGGCGTTGGGATCCATGGGCAACGATGCGCCCCTGGCAT
GCCTGACGCAGGCGCCCCGCCTCCTCTACGACTACTTCCGCCAGCTCTTCGCCCAGGTCACCAACCCGCCCATCG
ACCCCATCCGGGAGTCCATTGTCATGTCTCTCGAGTGCTATGTTGGCCCCCAGGGCAACCTGCTCGAGATGGACT
CGTCCCAGTGCGGTCGTCTGATGCTCCCTAGCCCTATCCTGTCCATGCCCGAGTTCAACGCCATGGTCAACATGT
CCTCCGTCCACCCGGAGTGGACCGTCAAGACCATTGACCTGACCTTCCCCAAGTCTCAGGGCGTCCAGGGCTACC
TGGATCACCTGGACGAGATCTGTAACGAGGCCACGGCGGCCATCGAGGCTGGAGACCGTCTCATCGTCCTGTCTG
ACCGCAAGACTTCCGCCGAACGCGTTCCCGTCTCCGCCGCGCTCGCCTCGGGCATGGTCCACCACCATCTCGTCA
GCAATAAATGGCGATCCATGGCCGCTCTCGTCGTCGAGACTGCCGAAGCCCGCGAGGTCCACCACATGTGCGTGC
TGCTCGGCTATGGCGCCGACGCCGTGAACCCGTACCTGGCCATGGAGTGCATCCTGAAGCTGAACCGGGAGGGCT
TGATCAAGAAGAAGCTGTCCGACGAGGCTCTGATCCGTAATTACAAGCACTCCTGCGATGGTGGCATCCTCAAGG
TGATGAGTAAGATGGGCATCTCGACCTTGGCGTCGTACAAGGGCGCCCAAATCTTCGAGGCCCTCGGCCTTGACG
AGGCCGTCGTCGACCGCTGCTTCAAGGGCACGGCCTCGCGCATCCAGGGCCTCACCTTTGACCTCATTGCCGAGG
ACGCCTTCCGATTCCACGAGCGCGGCTTCCCTTCGCGATACACCGTCGGCATCCAAGGCCTCCCCGAGTCGGGCG
AGTACCACTGGCGTGACGGTGGCGAGGCTCACGTCAACGATCCGACCTCGATTGCCAATATTCAGGACGCCGTCC
GCTCCAAGAACGACAAGTCGTACGAGGCCTATTCGCGGTCCGAGTACGAGCAGATCAAGAACTGCACCCTCCGTG
GCCTCTTGGATTTCAAGTTTGAGGATTGCACGCCTGTGCCCATCGACCAGGTTGAGCCGTGGACCGAGATCGTCC
GACGATTCTGCACCGGAGCCATGTCGTACGGATCCATCTCCATGGAGTCGCACTCCACCCTGGCTGTGGCCATGA
ACAGGCTGGGCGGCAAGTCCAACACGGGCGAGGGTGGCGAGGACCCCGAACGCTCGCAGCGTATGCCCAACGGAG
ACACGATGAGGTCTGCCATCAAGCAGGTCGCGTCCGGCCGTTTCGGCGTCACCTCCGCCTATCTCGCCGACTCGG
ACGAGCTGCAGATCAAGATGGCCCAGGGCGCCAAGCCTGGCGAAGGCGGCGAGCTGCCCGGCCACAAGGTGTCCA
AGTCCATCGCCCGCACGCGCCACTCGACTCCCGGTGTCGGTCTTATCTCGCCGCCTCCTCACCACGACATCTACT
CGATCGAAGATCTCAAACAGCTGATCTACGACCTGAAGTGCTCCAGTCCCCGATCGCGCGTCTCGGTCAAACTCG
TCTCCGAGGTCGGCGTCGGCATCGTCGCTTCGGGCGTGGCCAAGGCCAAGGCCGACCACATCCTCATCTCCGGCC
ACGACGGCGGCACAGGCGCCTCGCGATGGACCGGCATCAAGTATGCCGGTCTTCCGTGGGAATTGGGTCTGGCCG
AGACCCACCAGACACTGGTTCTGAACGATCTGCGCGGTCGTGTCGTGGTACAGACGGACGGCCAGCTGAGGACCG
GCAGGGACATTGCCATCGCCTGTCTGCTCGGGGCCGAGGAATGGGGGTTTGCCACGGCTCCTCTCATCGCCATGG
GCTGCATTATGATGCGAAAATGCCACCTCAACTCTTGCCCTGTCGGCATTGCCACTCAGGATCCCGAGCTCCGAC
AGAAGTTCCAGGGAACCCCTGAGCACGTCATCAACTTCTTCTACTATCTCGCCAACGAGCTCCGCGCCATCATGG
CCCAGCTTGGCTTCCGTACGATCAACGAAATGGTCGGCCACGTCGAAGTTCTCAAGCTACGGGATGACCTGCGCA
CGAAGAAGACCGCCAACGTCGACCTTTCCCTGCTCCTGACCCCGGCGCATAAGCTCCGTCCTGGCGTCGCTACTT
TCAACGTCCGCAAGCAGGATCATAAGCTGTACATCCGCCTCGACAACAAATTGATTTCCGAGGCTGAGTTGACCC
TCGACAAGGGGCTCCCGTCCCGGATCGAGTGTGACATCATCAATACCGACCGGGCCATGGGCACGTCCTTGTCGT
ACCAGATCTCGAAGCGATACGGCGAGGCCGGTCTGCCCCTGGACACGGTTCATGTCAATATCAAGGGGTCGGCTG
GCCAGTCCTTCGGCGCCTTCCTTGCCCCTGGCGTCACTTTGGAACTGGAGGGTGATGCCAACGACTATGTTGGCA
AGGGCCTGTCCGGTGGCCGTCTCATCATCTATCCGCCCCGTGCCGCAGTCTTCAAAGCCGAGGAGAACATACTGG
TTGGCAACGTCTGTCTGTACGGCGCTACGAGCGGAACCTGCTTCTTCCGAGGCGTCGCTGCCGAGCGTTTCGCCG
TCCGCAACTCGGGTGCCACGGCGGTTGTTGAAGGGGTCGGCGACCACGGTTGCGAGTACATGACTGGCGGCCGCA
TCCTCGTGCTCGGGAGCACTGGGCGAAACTTCGCTGCCGGCATGTCGGGAGGCATTGCTTACGTGCTCGACGTTC
AGCGTGACTTCCACTCCAAGCTCAACACGGAGATGGTTGAGGCGGGACCGCTTGAGGATCCGGCCGAGATTGCCT
ATCTCCGCGGGCTGATCGAGGACCACCACCACTACACCGGCTCTGAGCGGGCGGCTCGTATCCTCGTCGACTTCA
ACCGTGCACTCCCTCGCTTCGTCAAGGTTTTGCCCGTCGACTACAAGCGGGTCTTGGAAGAGGAGGCTGCCAAAG
CGGCGGCCGCCAAGCGGGCTGAGTACAACCTCCCGGTTGTTCCCAGCGCCAAGCAGAAGGGCGACGAGGCCGCCA
AGCTCCAGGACATGGAGGAGGCTTTCGGTGACAAGGCTGCCGAGAAGAAACGAGCTTTGGTTCTTGACAAGACCA
AGGGCTTCATGAAGTACGCGCGGCGCTCGGAGAAGTATCGCTCTGCCAATACGCGCATCAAGGACTGGGCCGAGC
TTAGCTCCCGCCTGAACGAGGACGAGCTCAAGTATCAGTCGGCTCGCTGCATGGACTGCGGTGTGCCCTTCTGTC
AGTCCGAGACCGGCTGCCCCATCTCCAACATCATTCCCAAGTGGAACGAGCTCGTTTTCCAGAACCAATGGAAGG
ACGCGCTCAACCGCCTCCTCATGACCAACAACTTCCCCGAGTTTACTGGCCGCGTCTGCCCTGCCCCCTGCGAAG
GCGCATGCGTTCTGGGCATCAACGAGGACCCTGTCGGAATTAAGTCGATCGAGTGTGCCATTATCGACCGCGGTT
TCGAGATGGGCTGGATGGTTCCGCAGCCGCCCAAGGTCCGCACGGGTAAGGCGGTCGCCATCATCGGATCCGGGC
CGGCTGGACTGGCCTGCGCCGACCAGCTCAACCGAGCTGGCCACACGGTGACTGTCTACGAGCGCGCGGATCGCC
TCGGCGGGCTGCTCATGTACGGCATCCCGAACATGAAGCTGGACAAGCGAATCGTCAAGCGCCGCACCGACTTCA
TGGCAGCGGAGGGCGTCAACTTCGAGACTGGCGTTGCGATTGGCGAGGACGGCCAACTGAGCCTGGATGATCTCA
GGGGCAAGAACGACGCCGTCGTCATTGCTACGGGCGCCACGGTTGCTCGCGACCTGCCCATCAAGGGCCGAGCTC
TGGATGGCATCCACTTTGCCATGGAGTTCCTGCACAAGAATACCAAGTCTCTGCTCGACTCGGAGCTGGCTGACA
AGTCGTACATCACGGCCAAGGACAAGCACGTGGTCGTCATCGGCGGCGGCGACACGGGCAACGACTGCATCGGCA
CGTCGGTTCGCCATGGCGCTACGTCGGTCACCAACTTCGAGCTGCTGCCTCAGCCGCCGCCGGAGCGTGCTCGCG
ACAACCCCTGGCCACAGTGGCCTCGGATCTACCGCGTCGACTACGGCCACACGGAGGTGCGCCAACACACGGGTA
AAGACCCCCGTGAGTACTGCATCATGTCGGAGGAGTTTGTCGACGACGGCAGCGGCAAGGTCAAGGGCATCAACA
CGATCCGCGTGGAGTGGACCAAGTCGCCCAGCGGCGGCTGGGACATGAAGAAGGTGGACGGCTCCCAGCAGTTCT
TCCCCGCCGACCTCGTCCTCTTGGCCATGGGATTCCTGGGGCCCGAGTCTCGCGTGCTGGGCGAGGAGATCGAGA
AGGACGCCCGCAAAAATGTCAAGACGCCGGCGGGCAAGTACTGCACGAACCTGGACGGCGTGTTTGCCGCGGGCG
ATGCCCGCCGTGGGCAGTCTTTGATTGTCTGGTAAGTCATCGGACGAGAATGCAGTCCACGAATGCTTTCCCCAC
ACGGAACGGCTTGCTGACGATGACGCTCAGGGGAATTAACGAAGGGCGCATGGCAGCGCGTGAGGTGGACATGTA
CCTCGAGAAAAGCACCAACCTCCCGGTGACGGGCGGCATCGTGAAGCGCACGGCCCAGGAGATTTTGAGCAGGGT
CGTCGAGGCCCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail