Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|815
Gene name
LocationContig_117:17672..19414
Strand-
Gene length (bp)1742
Transcript length (bp)1335
Coding sequence length (bp)1335
Protein length (aa) 445

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 3.6E-09 41 101

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 111 128 17
2 147 169 22
3 196 218 22
4 225 247 22
5 272 294 22
6 307 329 22
7 349 371 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|815
MRLGLRTCLVAAAVFAGLCECFDHEFFIRATDTSPLAAAPAKYPACSRDCLSQKFAASSCNDAACLCGNRTFEKD
LKDCVMPVCPIYDSMAVKNLTDKACHRPRRDKSGKFSALSIALCSITYVLVAVRIVYKQFFGHRRRLSVDDWIIM
VTVAIGIPCTVLNVHGLAANGIGKDVWTLQPQTVSNFQLYFYVLEIFYVTMMALIRVALCFFYLHIFPGVRIRRV
LWGTVVFNALFGFAAAIATIFQCTPIRYFWVMYKERFPRGHCINMNVLGWVHGALNIAINLWLISIALNQVRKLD
LHWKKKLSVSLMFLTGIFDTVVSVLRLHSLIHFANSWNPTWDQFGVAWWSTIEIEVGLLCTCMPTLRIILVRMFP
RLLGTDRSSKESPNPGSDASGGIMVQKQIRVDSVDNHADPDAAAQDRAKLWELGSEGAAAEGPHAEAYS*
Coding >Hirsu2|815
ATGAGGCTTGGACTGAGGACATGTCTTGTCGCCGCTGCCGTCTTCGCCGGCCTCTGCGAGTGCTTCGACCATGAG
TTCTTCATCCGGGCCACCGACACGTCTCCGCTTGCCGCGGCGCCGGCCAAGTATCCCGCCTGCTCCCGCGACTGC
CTGTCGCAGAAATTCGCGGCCTCGAGCTGCAATGACGCGGCATGCTTGTGTGGCAATCGGACCTTCGAGAAGGAC
CTCAAGGATTGCGTCATGCCTGTGTGCCCTATCTACGATTCCATGGCCGTCAAGAACCTGACGGACAAGGCCTGC
CACCGGCCTCGGCGGGACAAGAGCGGCAAGTTCTCGGCACTGAGCATCGCGCTGTGCTCCATCACGTACGTGCTG
GTGGCGGTGCGGATCGTGTACAAGCAGTTCTTCGGGCACCGGCGGCGGCTGAGCGTCGACGACTGGATCATCATG
GTGACGGTGGCCATCGGCATCCCCTGCACCGTCCTCAACGTGCACGGGCTGGCGGCCAACGGCATCGGCAAGGAC
GTCTGGACGCTGCAGCCGCAGACGGTCAGCAACTTCCAGCTCTACTTCTACGTGCTCGAGATCTTCTACGTCACC
ATGATGGCCCTCATCCGCGTCGCCCTCTGCTTCTTCTACCTGCACATCTTCCCGGGCGTCCGCATCCGGCGCGTG
CTCTGGGGCACCGTCGTCTTCAACGCGCTCTTCGGCTTCGCCGCCGCCATCGCCACCATCTTCCAGTGCACGCCC
ATCCGCTACTTCTGGGTCATGTACAAGGAGCGCTTCCCGCGCGGCCACTGCATCAACATGAACGTCCTCGGCTGG
GTCCACGGCGCGCTCAACATCGCCATCAACCTGTGGCTCATCTCCATCGCCCTGAACCAGGTGCGCAAGCTCGAC
CTCCACTGGAAGAAGAAGCTGAGCGTCAGCCTCATGTTCCTGACGGGCATCTTCGACACGGTCGTGTCCGTCCTG
CGGCTTCATTCCCTCATCCACTTCGCCAACTCGTGGAACCCGACGTGGGACCAGTTCGGCGTCGCCTGGTGGTCC
ACCATCGAGATCGAGGTCGGCCTGCTCTGCACCTGCATGCCGACCCTGCGCATCATCCTCGTCCGCATGTTCCCC
CGCCTGCTCGGCACCGACCGGAGCTCCAAGGAGTCGCCCAACCCGGGCTCCGACGCCAGCGGCGGCATCATGGTG
CAGAAGCAGATCCGCGTCGACAGCGTCGACAACCACGCCGACCCCGACGCCGCCGCCCAGGACCGGGCCAAGCTG
TGGGAGCTCGGCTCCGAAGGGGCTGCCGCCGAGGGACCCCACGCCGAGGCGTACTCGTAG
Transcript >Hirsu2|815
ATGAGGCTTGGACTGAGGACATGTCTTGTCGCCGCTGCCGTCTTCGCCGGCCTCTGCGAGTGCTTCGACCATGAG
TTCTTCATCCGGGCCACCGACACGTCTCCGCTTGCCGCGGCGCCGGCCAAGTATCCCGCCTGCTCCCGCGACTGC
CTGTCGCAGAAATTCGCGGCCTCGAGCTGCAATGACGCGGCATGCTTGTGTGGCAATCGGACCTTCGAGAAGGAC
CTCAAGGATTGCGTCATGCCTGTGTGCCCTATCTACGATTCCATGGCCGTCAAGAACCTGACGGACAAGGCCTGC
CACCGGCCTCGGCGGGACAAGAGCGGCAAGTTCTCGGCACTGAGCATCGCGCTGTGCTCCATCACGTACGTGCTG
GTGGCGGTGCGGATCGTGTACAAGCAGTTCTTCGGGCACCGGCGGCGGCTGAGCGTCGACGACTGGATCATCATG
GTGACGGTGGCCATCGGCATCCCCTGCACCGTCCTCAACGTGCACGGGCTGGCGGCCAACGGCATCGGCAAGGAC
GTCTGGACGCTGCAGCCGCAGACGGTCAGCAACTTCCAGCTCTACTTCTACGTGCTCGAGATCTTCTACGTCACC
ATGATGGCCCTCATCCGCGTCGCCCTCTGCTTCTTCTACCTGCACATCTTCCCGGGCGTCCGCATCCGGCGCGTG
CTCTGGGGCACCGTCGTCTTCAACGCGCTCTTCGGCTTCGCCGCCGCCATCGCCACCATCTTCCAGTGCACGCCC
ATCCGCTACTTCTGGGTCATGTACAAGGAGCGCTTCCCGCGCGGCCACTGCATCAACATGAACGTCCTCGGCTGG
GTCCACGGCGCGCTCAACATCGCCATCAACCTGTGGCTCATCTCCATCGCCCTGAACCAGGTGCGCAAGCTCGAC
CTCCACTGGAAGAAGAAGCTGAGCGTCAGCCTCATGTTCCTGACGGGCATCTTCGACACGGTCGTGTCCGTCCTG
CGGCTTCATTCCCTCATCCACTTCGCCAACTCGTGGAACCCGACGTGGGACCAGTTCGGCGTCGCCTGGTGGTCC
ACCATCGAGATCGAGGTCGGCCTGCTCTGCACCTGCATGCCGACCCTGCGCATCATCCTCGTCCGCATGTTCCCC
CGCCTGCTCGGCACCGACCGGAGCTCCAAGGAGTCGCCCAACCCGGGCTCCGACGCCAGCGGCGGCATCATGGTG
CAGAAGCAGATCCGCGTCGACAGCGTCGACAACCACGCCGACCCCGACGCCGCCGCCCAGGACCGGGCCAAGCTG
TGGGAGCTCGGCTCCGAAGGGGCTGCCGCCGAGGGACCCCACGCCGAGGCGTACTCGTAG
Gene >Hirsu2|815
ATGAGGCTTGGACTGAGGACATGTCTTGTCGCCGCTGCCGTCTTCGCCGGCCTCTGCGAGTGCTTCGACCATGAG
TTCTTCATCCGGGCCACCGACACGTCTCCGCTTGCCGCGGCGCCGGCCAAGTATCCCGCCTGCTCCGTAAGGGCT
CTTCTGCTTCCTCGACGGGGGGATTGCGTGTGTGTTGATGATGGCTTGTCTGCCCCTTGTCCAGCGCGACTGCCT
GTCGCAGAAATTCGCGGCCTCGAGCTGCAATGACGCGGCATGCTTGTGTGGCAATCGGACCTTCGAGAAGGACCT
CAAGGATTGCGTCATGCCTGTGTGCCCTATCTACGATTCCATGGGTATGTCCTCTCTTGCTCCTTGCTCACACTT
CCGCGCGACGCCTTGTTTTTTTCTCTTTCTGTCATTCCATCTTGCTTGGCGTGTCGGTATCCAACCTCGCCTTTA
TTGTCTCTCTGAAAGTCCGCTTTGACACCGGGACGTGGTGAGGCTGACGGGAAGAAACCGACACTGCAGCCGTCA
AGAACCTGACGGACAAGGCCTGCCACCGGCCTCGGCGGGACAAGAGCGGCAAGTTCTCGGCACTGAGCATCGCGC
TGTGCTCCATCACGTACGTGCTGGTGGCGGTGCGGATCGTGTACAAGCAGTTCTTCGGGCACCGGCGGCGGCTGA
GCGTCGACGACTGGATCATCATGGTGACGGTGGCCATCGGCATCCCCTGCACCGTCCTCAACGTGCACGGGCTGG
CGGCCAACGGCATCGGCAAGGACGTCTGGACGCTGCAGCCGCAGACGGTCAGCAACTTCCAGCTCTACTTCTACG
TGCTCGAGATCTTCTACGTCACCATGATGGCCCTCATCCGCGTCGCCCTCTGCTTCTTCTACCTGCACATCTTCC
CGGGCGTCCGCATCCGGCGCGTGCTCTGGGGCACCGTCGTCTTCAACGCGCTCTTCGGCTTCGCCGCCGCCATCG
CCACCATCTTCCAGTGCACGCCCATCCGCTACTTCTGGGTCATGTACAAGGAGCGCTTCCCGCGCGGCCACTGCA
TCAACATGAACGTCCTCGGCTGGGTCCACGGCGCGCTCAACATCGCCATCAACCTGTGGCTCATCTCCATCGCCC
TGAACCAGGTGCGCAAGCTCGACCTCCACTGGAAGAAGAAGCTGAGCGTCAGCCTCATGTTCCTGACGGGCATCT
TGTGAGTCGACCGCGAGAGAGAGAAAGAGAGAGAGAGGAGAAAGGGGGAAGAGAGAAAGGGAGAGACAGAGAGAA
TCGTTGGTCGTCTGTCGACGAAGCGAGCGACGTCGATGTCGGGGAGAACGCGCGATCGGCTGACCACATGGCGGC
TCACAAACAGCGACACGGTCGTGTCCGTCCTGCGGCTTCATTCCCTCATCCACTTCGCCAACTCGTGGAACCCGA
CGTGGGACCAGTTCGGCGTCGCCTGGTGGTCCACCATCGAGATCGAGGTCGGCCTGCTCTGCACCTGCATGCCGA
CCCTGCGCATCATCCTCGTCCGCATGTTCCCCCGCCTGCTCGGCACCGACCGGAGCTCCAAGGAGTCGCCCAACC
CGGGCTCCGACGCCAGCGGCGGCATCATGGTGCAGAAGCAGATCCGCGTCGACAGCGTCGACAACCACGCCGACC
CCGACGCCGCCGCCCAGGACCGGGCCAAGCTGTGGGAGCTCGGCTCCGAAGGGGCTGCCGCCGAGGGACCCCACG
CCGAGGCGTACTCGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail