Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8141
Gene name
LocationContig_512:1717..2602
Strand+
Gene length (bp)885
Transcript length (bp)885
Coding sequence length (bp)885
Protein length (aa) 295

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01988 VIT1 VIT family 6.0E-57 13 281

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6MWE5|VIT11_ORYSJ Vacuolar iron transporter 1.1 OS=Oryza sativa subsp. japonica GN=VIT1.1 PE=2 SV=1 13 277 4.0E-25
sp|Q6ERE5|VIT12_ORYSJ Vacuolar iron transporter 1.2 OS=Oryza sativa subsp. japonica GN=VIT1.2 PE=3 SV=2 13 277 2.0E-21
sp|P47818|CCC1_YEAST Protein CCC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCC1 PE=1 SV=1 11 248 3.0E-21
sp|Q9ZUA5|VIT1_ARATH Vacuolar iron transporter 1 OS=Arabidopsis thaliana GN=VIT1 PE=2 SV=1 11 284 1.0E-20

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 193 215 22
2 222 244 22
3 264 286 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8141
MVKTRCPSLSRFLSDFTLGFSDGLTVPFALTAGLSSLGRADTVIYAGLAELCAGSISMGIGGYLSAADEIPSAPV
RKRSLGGGGGGGLGEGDGDEEELRAMLHDESATSGSGSGSESPACDSLGHREKGLPSADEALVRRHLQPLDLPAP
LVSDVVMALRRSPDGLAQAALQLQQRQDHEPPPPDPSAGPLPVWPVACGLSISLGYVVGGIVPLSPYFFAPTVGL
GLGWSIGLCLVALMAFGSVKSWLLSGRQATWGRCLLQGFQMLVLGSLAAGAAVLCVNLVGGGGSSQSAG*
Coding >Hirsu2|8141
ATGGTCAAGACACGATGTCCCAGCCTGAGCCGCTTCCTCTCCGACTTCACCCTCGGCTTCTCCGATGGCCTGACG
GTCCCCTTTGCCCTCACCGCCGGCCTCAGCTCCCTGGGCCGCGCCGATACCGTCATCTACGCCGGCCTCGCCGAG
CTCTGCGCCGGAAGCATCAGCATGGGCATCGGCGGCTACCTGTCCGCTGCCGACGAGATCCCCTCGGCCCCGGTT
CGCAAGCGCAGCCTCGGCGGCGGCGGCGGCGGCGGCCTCGGCGAAGGTGACGGCGACGAGGAGGAGCTGCGAGCC
ATGCTCCACGACGAGTCCGCCACCAGCGGCTCCGGCTCCGGCAGCGAAAGCCCTGCCTGCGACAGCCTGGGTCAC
CGCGAAAAGGGGCTCCCCTCGGCGGACGAGGCTCTGGTTCGCCGTCACCTCCAGCCCCTGGATCTGCCCGCCCCT
CTCGTCTCCGATGTCGTCATGGCTCTGCGCCGCAGTCCAGACGGCCTTGCCCAAGCTGCTCTCCAGCTCCAGCAG
CGGCAAGACCACGAGCCTCCGCCGCCCGACCCCTCCGCCGGGCCGCTGCCCGTCTGGCCCGTCGCCTGCGGTCTC
TCCATCTCGCTGGGCTACGTCGTCGGCGGCATCGTCCCGCTCTCCCCGTACTTCTTCGCTCCCACCGTCGGCCTC
GGCCTCGGCTGGAGCATCGGCCTTTGCCTCGTCGCCCTCATGGCCTTTGGCTCCGTCAAGAGCTGGTTGTTGAGC
GGTCGTCAAGCCACCTGGGGCCGCTGCCTGCTGCAGGGCTTTCAGATGCTCGTCTTGGGCAGTCTGGCCGCTGGT
GCCGCCGTCTTGTGCGTCAACCTTGTCGGAGGAGGCGGCTCGTCGCAGTCGGCGGGATGA
Transcript >Hirsu2|8141
ATGGTCAAGACACGATGTCCCAGCCTGAGCCGCTTCCTCTCCGACTTCACCCTCGGCTTCTCCGATGGCCTGACG
GTCCCCTTTGCCCTCACCGCCGGCCTCAGCTCCCTGGGCCGCGCCGATACCGTCATCTACGCCGGCCTCGCCGAG
CTCTGCGCCGGAAGCATCAGCATGGGCATCGGCGGCTACCTGTCCGCTGCCGACGAGATCCCCTCGGCCCCGGTT
CGCAAGCGCAGCCTCGGCGGCGGCGGCGGCGGCGGCCTCGGCGAAGGTGACGGCGACGAGGAGGAGCTGCGAGCC
ATGCTCCACGACGAGTCCGCCACCAGCGGCTCCGGCTCCGGCAGCGAAAGCCCTGCCTGCGACAGCCTGGGTCAC
CGCGAAAAGGGGCTCCCCTCGGCGGACGAGGCTCTGGTTCGCCGTCACCTCCAGCCCCTGGATCTGCCCGCCCCT
CTCGTCTCCGATGTCGTCATGGCTCTGCGCCGCAGTCCAGACGGCCTTGCCCAAGCTGCTCTCCAGCTCCAGCAG
CGGCAAGACCACGAGCCTCCGCCGCCCGACCCCTCCGCCGGGCCGCTGCCCGTCTGGCCCGTCGCCTGCGGTCTC
TCCATCTCGCTGGGCTACGTCGTCGGCGGCATCGTCCCGCTCTCCCCGTACTTCTTCGCTCCCACCGTCGGCCTC
GGCCTCGGCTGGAGCATCGGCCTTTGCCTCGTCGCCCTCATGGCCTTTGGCTCCGTCAAGAGCTGGTTGTTGAGC
GGTCGTCAAGCCACCTGGGGCCGCTGCCTGCTGCAGGGCTTTCAGATGCTCGTCTTGGGCAGTCTGGCCGCTGGT
GCCGCCGTCTTGTGCGTCAACCTTGTCGGAGGAGGCGGCTCGTCGCAGTCGGCGGGATGA
Gene >Hirsu2|8141
ATGGTCAAGACACGATGTCCCAGCCTGAGCCGCTTCCTCTCCGACTTCACCCTCGGCTTCTCCGATGGCCTGACG
GTCCCCTTTGCCCTCACCGCCGGCCTCAGCTCCCTGGGCCGCGCCGATACCGTCATCTACGCCGGCCTCGCCGAG
CTCTGCGCCGGAAGCATCAGCATGGGCATCGGCGGCTACCTGTCCGCTGCCGACGAGATCCCCTCGGCCCCGGTT
CGCAAGCGCAGCCTCGGCGGCGGCGGCGGCGGCGGCCTCGGCGAAGGTGACGGCGACGAGGAGGAGCTGCGAGCC
ATGCTCCACGACGAGTCCGCCACCAGCGGCTCCGGCTCCGGCAGCGAAAGCCCTGCCTGCGACAGCCTGGGTCAC
CGCGAAAAGGGGCTCCCCTCGGCGGACGAGGCTCTGGTTCGCCGTCACCTCCAGCCCCTGGATCTGCCCGCCCCT
CTCGTCTCCGATGTCGTCATGGCTCTGCGCCGCAGTCCAGACGGCCTTGCCCAAGCTGCTCTCCAGCTCCAGCAG
CGGCAAGACCACGAGCCTCCGCCGCCCGACCCCTCCGCCGGGCCGCTGCCCGTCTGGCCCGTCGCCTGCGGTCTC
TCCATCTCGCTGGGCTACGTCGTCGGCGGCATCGTCCCGCTCTCCCCGTACTTCTTCGCTCCCACCGTCGGCCTC
GGCCTCGGCTGGAGCATCGGCCTTTGCCTCGTCGCCCTCATGGCCTTTGGCTCCGTCAAGAGCTGGTTGTTGAGC
GGTCGTCAAGCCACCTGGGGCCGCTGCCTGCTGCAGGGCTTTCAGATGCTCGTCTTGGGCAGTCTGGCCGCTGGT
GCCGCCGTCTTGTGCGTCAACCTTGTCGGAGGAGGCGGCTCGTCGCAGTCGGCGGGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail