Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8134
Gene name
LocationContig_511:2181..3756
Strand-
Gene length (bp)1575
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 6.1E-03 64 74
PF00098 zf-CCHC Zinc knuckle 1.3E-08 80 96
PF00098 zf-CCHC Zinc knuckle 1.3E-08 103 118
PF00098 zf-CCHC Zinc knuckle 9.9E-08 133 148
PF00098 zf-CCHC Zinc knuckle 1.5E-05 168 183
PF00098 zf-CCHC Zinc knuckle 7.3E-09 188 204
PF00098 zf-CCHC Zinc knuckle 3.1E-05 213 229
PF14392 zf-CCHC_4 Zinc knuckle 9.2E-01 81 95
PF14392 zf-CCHC_4 Zinc knuckle 3.0E+00 104 118
PF14392 zf-CCHC_4 Zinc knuckle 1.6E+00 133 148
PF14392 zf-CCHC_4 Zinc knuckle 3.4E+00 169 183
PF14392 zf-CCHC_4 Zinc knuckle 2.9E-01 189 204
PF14392 zf-CCHC_4 Zinc knuckle 2.1E+00 212 228

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 59 227 2.0E-37
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 64 229 4.0E-36
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 36 229 6.0E-31
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 64 229 4.0E-28
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 64 228 4.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 59 227 2.0E-37
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 64 229 4.0E-36
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 36 229 6.0E-31
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 64 229 4.0E-28
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 64 228 4.0E-26
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 64 227 2.0E-24
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 44 208 1.0E-23
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 64 227 9.0E-23
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 56 208 1.0E-22
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 44 208 1.0E-22
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 44 208 1.0E-22
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 44 208 1.0E-22
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 64 227 7.0E-21
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 64 227 7.0E-21
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 64 227 7.0E-21
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 91 229 2.0E-20
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 80 227 2.0E-18
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 76 205 4.0E-17
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 58 147 1.0E-16
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 81 229 1.0E-16
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 58 183 5.0E-16
sp|Q04832|HEXP_LEIMA DNA-binding protein HEXBP OS=Leishmania major GN=HEXBP PE=3 SV=1 64 149 3.0E-14
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 103 228 3.0E-14
sp|O42395|CNBP_CHICK Cellular nucleic acid-binding protein OS=Gallus gallus GN=CNBP PE=2 SV=1 101 227 1.0E-13
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 97 228 1.0E-13
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 54 152 1.0E-13
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 64 183 1.0E-13
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 79 227 2.0E-13
sp|P53996|CNBP_MOUSE Cellular nucleic acid-binding protein OS=Mus musculus GN=Cnbp PE=1 SV=2 101 227 3.0E-13
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 64 203 3.0E-13
sp|Q3T0Q6|CNBP_BOVIN Cellular nucleic acid-binding protein OS=Bos taurus GN=CNBP PE=2 SV=1 101 227 1.0E-12
sp|P62634|CNBP_RAT Cellular nucleic acid-binding protein OS=Rattus norvegicus GN=Cnbp PE=2 SV=1 101 227 3.0E-12
sp|Q5R5R5|CNBP_PONAB Cellular nucleic acid-binding protein OS=Pongo abelii GN=CNBP PE=2 SV=1 101 227 3.0E-12
sp|P62633|CNBP_HUMAN Cellular nucleic acid-binding protein OS=Homo sapiens GN=CNBP PE=1 SV=1 101 227 3.0E-12
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 53 149 4.0E-12
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 81 228 7.0E-12
sp|Q79666|POL_HV1MV Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate MVP5180) GN=gag-pol PE=3 SV=3 2 173 8.0E-12
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 58 146 2.0E-11
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 81 228 2.0E-11
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 103 227 5.0E-11
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 73 209 1.0E-10
sp|P18802|POL_HV1ND Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate NDK) GN=gag-pol PE=3 SV=3 2 118 1.0E-10
sp|Q75002|POL_HV1ET Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag-pol PE=3 SV=3 1 118 1.0E-10
sp|Q9Q720|POL_HV1V9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate VI991) GN=gag-pol PE=3 SV=3 1 118 1.0E-10
sp|O12158|POL_HV192 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag-pol PE=1 SV=2 1 118 1.0E-10
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 81 203 2.0E-10
sp|Q8N567|ZCHC9_HUMAN Zinc finger CCHC domain-containing protein 9 OS=Homo sapiens GN=ZCCHC9 PE=2 SV=2 71 183 2.0E-10
sp|Q1A267|POL_SIVMB Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate MB66) GN=gag-pol PE=3 SV=4 2 118 2.0E-10
sp|P05895|POL_SIVVT Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag-pol PE=3 SV=2 67 117 2.0E-10
sp|P27980|POL_SIVVG Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag-pol PE=3 SV=2 67 117 3.0E-10
sp|Q8R1J3|ZCHC9_MOUSE Zinc finger CCHC domain-containing protein 9 OS=Mus musculus GN=Zcchc9 PE=2 SV=2 71 183 3.0E-10
sp|O89940|POL_HV1SE Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag-pol PE=3 SV=3 5 118 4.0E-10
sp|Q94C69|CSP3_ARATH Cold shock domain-containing protein 3 OS=Arabidopsis thaliana GN=CSP3 PE=1 SV=1 64 185 5.0E-10
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 64 147 6.0E-10
sp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C OS=Oryza sativa subsp. japonica GN=RPA1C PE=1 SV=1 57 176 8.0E-10
sp|P04588|POL_HV1MA Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag-pol PE=1 SV=3 1 118 9.0E-10
sp|Q77373|POL_HV1AN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate ANT70) GN=gag-pol PE=3 SV=3 76 117 1.0E-09
sp|O93215|POL_HV190 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag-pol PE=3 SV=4 1 118 2.0E-09
sp|P24740|POL_HV1U4 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag-pol PE=1 SV=3 1 118 2.0E-09
sp|Q1A249|POL_SIVEK Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate EK505) GN=gag-pol PE=3 SV=3 2 117 3.0E-09
sp|P04589|POL_HV1EL Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag-pol PE=3 SV=3 2 118 3.0E-09
sp|Q9QBZ5|POL_HV1MP Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag-pol PE=3 SV=3 1 118 4.0E-09
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 78 203 5.0E-09
sp|Q9QBZ1|POL_HV1M2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag-pol PE=3 SV=3 80 118 6.0E-09
sp|P04587|POL_HV1B5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag-pol PE=1 SV=3 2 118 6.0E-09
sp|P27973|POL_SIVV1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM155) GN=gag-pol PE=3 SV=2 80 117 7.0E-09
sp|Q02836|POL_SIVG1 Gag-Pol polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag-pol PE=3 SV=2 76 117 7.0E-09
sp|O91080|POL_HV1YF Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF30) GN=gag-pol PE=3 SV=3 76 121 7.0E-09
sp|P36627|BYR3_SCHPO Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr3 PE=3 SV=1 167 229 1.0E-08
sp|Q9QBY3|POL_HV196 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag-pol PE=3 SV=3 80 118 1.0E-08
sp|P03367|POL_HV1BR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag-pol PE=1 SV=3 80 118 1.0E-08
sp|P17283|POL_SIVCZ Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate CPZ GAB1) GN=gag-pol PE=3 SV=2 80 118 1.0E-08
sp|P0C6F2|POL_HV1LW Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag-pol PE=1 SV=1 80 118 1.0E-08
sp|Q9QSR3|POL_HV1VI Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag-pol PE=3 SV=3 80 118 1.0E-08
sp|O41798|POL_HV19N Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate 92NG083) GN=gag-pol PE=3 SV=3 76 118 1.0E-08
sp|O65639|CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana GN=CSP1 PE=1 SV=1 133 228 2.0E-08
sp|P12499|POL_HV1Z2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate Z2/CDC-Z34) GN=gag-pol PE=1 SV=3 2 118 2.0E-08
sp|P04585|POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) GN=gag-pol PE=1 SV=4 80 118 2.0E-08
sp|P03366|POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag-pol PE=1 SV=3 80 118 2.0E-08
sp|Q9QBZ9|POL_HV197 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag-pol PE=3 SV=2 80 118 2.0E-08
sp|Q9IDV9|POL_HV1YB Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF106) GN=gag-pol PE=1 SV=3 2 121 3.0E-08
sp|P35963|POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag-pol PE=1 SV=3 80 118 3.0E-08
sp|P20892|POL_HV1OY Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate OYI) GN=gag-pol PE=3 SV=3 80 118 3.0E-08
sp|P12497|POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) GN=gag-pol PE=1 SV=4 80 118 3.0E-08
sp|Q73368|POL_HV1B9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag-pol PE=3 SV=3 80 118 3.0E-08
sp|O89290|POL_HV193 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate 93BR020) GN=gag-pol PE=3 SV=3 80 118 3.0E-08
sp|P20875|POL_HV1JR Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) GN=gag-pol PE=1 SV=3 80 118 4.0E-08
sp|Q8AII1|POL_SIVTN Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate TAN1) GN=gag-pol PE=3 SV=4 76 118 5.0E-08
sp|P27978|GAG_SIVVG Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM3) GN=gag PE=3 SV=1 76 117 5.0E-08
sp|P03369|POL_HV1A2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) GN=gag-pol PE=1 SV=3 80 118 7.0E-08
sp|P05961|POL_HV1MN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) GN=gag-pol PE=1 SV=3 80 118 8.0E-08
sp|Q9WC63|POL_HV1S9 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9173) GN=gag-pol PE=3 SV=3 80 118 8.0E-08
sp|Q9WC54|POL_HV1S2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype J (isolate SE9280) GN=gag-pol PE=3 SV=3 80 118 8.0E-08
sp|P05892|GAG_SIVVT Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM TYO-1) GN=gag PE=3 SV=1 76 117 1.0E-07
sp|P05959|POL_HV1RH Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate RF/HAT3) GN=gag-pol PE=1 SV=3 80 121 2.0E-07
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 81 229 2.0E-07
sp|Q79665|GAG_HV1MV Gag polyprotein OS=Human immunodeficiency virus type 1 group O (isolate MVP5180) GN=gag PE=3 SV=3 76 117 2.0E-07
sp|Q8T8R1|Y3800_DROME CCHC-type zinc finger protein CG3800 OS=Drosophila melanogaster GN=CG3800 PE=1 SV=1 64 122 3.0E-07
sp|Q75001|GAG_HV1ET Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate ETH2220) GN=gag PE=3 SV=3 50 118 4.0E-07
sp|Q77372|GAG_HV1AN Gag polyprotein OS=Human immunodeficiency virus type 1 group O (isolate ANT70) GN=gag PE=3 SV=3 76 117 5.0E-07
sp|O89939|GAG_HV1SE Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate SE6165) GN=gag PE=3 SV=3 50 118 5.0E-07
sp|Q1A268|GAG_SIVMB Gag polyprotein OS=Simian immunodeficiency virus (isolate MB66) GN=gag PE=3 SV=3 2 118 5.0E-07
sp|Q8WW36|ZCH13_HUMAN Zinc finger CCHC domain-containing protein 13 OS=Homo sapiens GN=ZCCHC13 PE=1 SV=1 101 227 7.0E-07
sp|P27972|GAG_SIVV1 Gag polyprotein OS=Simian immunodeficiency virus agm.vervet (isolate AGM155) GN=gag PE=3 SV=1 80 117 8.0E-07
sp|O12157|GAG_HV192 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) GN=gag PE=3 SV=3 1 118 8.0E-07
sp|P18800|GAG_HV1ND Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate NDK) GN=gag PE=3 SV=3 2 118 9.0E-07
sp|Q02843|GAG_SIVG1 Gag polyprotein OS=Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) GN=gag PE=1 SV=1 76 117 9.0E-07
sp|Q82851|POL_JEMBR Gag-Pol polyprotein OS=Jembrana disease virus GN=gag-pol PE=3 SV=1 80 117 9.0E-07
sp|Q9Q721|GAG_HV1V9 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate VI991) GN=gag PE=3 SV=3 1 118 9.0E-07
sp|P12451|POL_HV2SB Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate SBLISY) GN=gag-pol PE=3 SV=3 76 117 1.0E-06
sp|P15833|POL_HV2D2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate D205) GN=gag-pol PE=3 SV=3 76 117 1.0E-06
sp|O91079|GAG_HV1YF Gag polyprotein OS=Human immunodeficiency virus type 1 group N (isolate YBF30) GN=gag PE=3 SV=3 76 148 1.0E-06
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 76 126 2.0E-06
sp|P05960|POL_HV1C4 Gag-Pol polyprotein (Fragment) OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag-pol PE=3 SV=3 79 118 2.0E-06
sp|Q9QBZ2|GAG_HV1M2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP257) GN=gag PE=3 SV=2 79 118 2.0E-06
sp|P69732|GAG_EIAVY Gag polyprotein OS=Equine infectious anemia virus (strain Wyoming) GN=gag PE=1 SV=1 132 222 2.0E-06
sp|P69731|GAG_EIAVC Gag polyprotein OS=Equine infectious anemia virus (isolate CL22) GN=gag PE=3 SV=1 132 222 2.0E-06
sp|P69730|GAG_EIAV9 Gag polyprotein OS=Equine infectious anemia virus (isolate 1369) GN=gag PE=1 SV=1 132 222 2.0E-06
sp|P17282|GAG_SIVCZ Gag polyprotein OS=Simian immunodeficiency virus (isolate CPZ GAB1) GN=gag PE=3 SV=1 76 150 2.0E-06
sp|P04584|POL_HV2RO Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) GN=gag-pol PE=1 SV=3 80 117 2.0E-06
sp|P24107|POL_HV2CA Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate CAM2) GN=gag-pol PE=3 SV=3 80 117 2.0E-06
sp|P18042|POL_HV2G1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate Ghana-1) GN=gag-pol PE=1 SV=4 80 117 2.0E-06
sp|P05887|GAG_HV1C4 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate CDC-451) GN=gag PE=3 SV=3 79 118 2.0E-06
sp|P04593|GAG_HV1B5 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH5) GN=gag PE=3 SV=3 79 118 2.0E-06
sp|Q1A250|GAG_SIVEK Gag polyprotein OS=Simian immunodeficiency virus (isolate EK505) GN=gag PE=3 SV=3 80 117 3.0E-06
sp|Q9QSR4|GAG_HV1VI Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F1 (isolate VI850) GN=gag PE=3 SV=3 50 118 3.0E-06
sp|P04594|GAG_HV1MA Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate MAL) GN=gag PE=3 SV=3 50 118 3.0E-06
sp|Q9QBZ6|GAG_HV1MP Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype F2 (isolate MP255) GN=gag PE=3 SV=2 79 118 3.0E-06
sp|O93182|GAG_HV190 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate 90CF056) GN=gag PE=3 SV=3 79 118 3.0E-06
sp|Q9FYB7|RSZ32_ARATH Serine/arginine-rich splicing factor RS2Z32 OS=Arabidopsis thaliana GN=RS2Z32 PE=1 SV=1 29 123 3.0E-06
sp|P20876|POL_HV2ST Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ST) GN=gag-pol PE=3 SV=3 80 117 3.0E-06
sp|P03348|GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) GN=gag PE=1 SV=3 79 118 3.0E-06
sp|Q9QBY4|GAG_HV196 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) GN=gag PE=3 SV=2 79 118 3.0E-06
sp|Q70622|GAG_HV1LW Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate LW123) GN=gag PE=1 SV=3 79 118 3.0E-06
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 76 123 4.0E-06
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 67 229 4.0E-06
sp|P12502|POL_SIVS4 Gag-Pol polyprotein OS=Simian immunodeficiency virus (isolate F236/smH4) GN=gag-pol PE=3 SV=2 80 117 4.0E-06
sp|P0C1K7|GAG_HV19N Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype G (isolate 92NG083) GN=gag PE=3 SV=2 76 118 7.0E-06
sp|P04591|GAG_HV1H2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) GN=gag PE=1 SV=3 79 118 8.0E-06
sp|P24736|GAG_HV1U4 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype A (isolate U455) GN=gag PE=1 SV=3 76 118 8.0E-06
sp|Q9QC00|GAG_HV197 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype K (isolate 97ZR-EQTB11) GN=gag PE=3 SV=2 80 118 8.0E-06
sp|P03347|GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) GN=gag PE=1 SV=3 79 118 8.0E-06
sp|P53849|GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS2 PE=1 SV=1 168 227 9.0E-06
sp|P12498|POL_HV1J3 Gag-Pol polyprotein (Fragment) OS=Human immunodeficiency virus type 1 group M subtype B (isolate JH32) GN=gag-pol PE=3 SV=4 80 117 9.0E-06
sp|P35955|GAG_VILVK Gag polyprotein OS=Maedi visna virus (strain KV1772) GN=gag PE=3 SV=1 161 212 9.0E-06
sp|P04592|GAG_HV1EL Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype D (isolate ELI) GN=gag PE=3 SV=3 2 118 9.0E-06
sp|Q73367|GAG_HV1B9 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (strain 89.6) GN=gag PE=3 SV=3 79 118 9.0E-06
sp|P35962|GAG_HV1Y2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) GN=gag PE=1 SV=2 79 118 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046914 transition metal ion binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.4656 0.4678 0.3257 0.0498 0.2111 0.0346 0.3118 0.2263 0.1561 0.0337

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5660
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|634
Ophiocordyceps camponoti-floridani Ophcf2|06831
Ophiocordyceps camponoti-rufipedis Ophun1|709
Ophiocordyceps kimflemingae Ophio5|8087
Ophiocordyceps subramaniannii Hirsu2|8134 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8134
LQTLAPQQALPGIVDWLLVCTSPSIAQSVVFCSPRERSLHNFEAAQNGLHARRVLLLDRSHTGGSTGHQARDCPT
KGPAKCYNCGGEGHMSRDCPEPLKENKSCYKCGQTGHISRDCTLSGGPGVGGGQSTECYKCGEMGHIARNCTKSS
FGGSYGGGAFGGGGGAGKTCYSCGGYGHMSRECVNGMKCYNCGESGHYSRDCPKESAGGGEKICYKCQQAGHVQA
QCPN*
Coding >Hirsu2|8134
CTGCAGACTCTTGCACCTCAACAAGCGCTGCCCGGCATCGTCGATTGGCTGTTGGTCTGCACCTCACCATCGATC
GCTCAGTCAGTCGTCTTCTGCTCTCCAAGAGAACGCTCCCTCCACAACTTCGAAGCGGCGCAAAATGGATTACAC
GCGCGGCGCGTGCTACTCTTGGATCGATCCCACACAGGCGGTTCCACCGGCCATCAGGCCCGTGACTGCCCGACC
AAGGGGCCCGCCAAGTGCTACAACTGCGGTGGCGAGGGCCATATGAGCCGAGACTGCCCCGAGCCCTTGAAGGAG
AACAAGTCCTGCTACAAATGCGGCCAGACCGGCCACATCTCTCGTGACTGCACTCTGAGTGGCGGTCCGGGCGTC
GGTGGTGGACAGTCTACCGAGTGCTACAAGTGTGGCGAGATGGGACACATCGCACGTAACTGCACCAAATCCTCC
TTCGGCGGCTCCTACGGCGGCGGTGCCTTCGGCGGCGGCGGCGGCGCGGGCAAGACTTGCTACTCGTGCGGTGGC
TACGGCCACATGTCCCGCGAGTGTGTCAACGGCATGAAGTGCTACAACTGCGGCGAGTCCGGCCATTACTCGCGC
GACTGCCCCAAGGAGTCGGCCGGTGGCGGCGAGAAGATTTGCTACAAGTGCCAGCAGGCCGGCCATGTCCAGGCC
CAGTGCCCCAACTGA
Transcript >Hirsu2|8134
CTGCAGACTCTTGCACCTCAACAAGCGCTGCCCGGCATCGTCGATTGGCTGTTGGTCTGCACCTCACCATCGATC
GCTCAGTCAGTCGTCTTCTGCTCTCCAAGAGAACGCTCCCTCCACAACTTCGAAGCGGCGCAAAATGGATTACAC
GCGCGGCGCGTGCTACTCTTGGATCGATCCCACACAGGCGGTTCCACCGGCCATCAGGCCCGTGACTGCCCGACC
AAGGGGCCCGCCAAGTGCTACAACTGCGGTGGCGAGGGCCATATGAGCCGAGACTGCCCCGAGCCCTTGAAGGAG
AACAAGTCCTGCTACAAATGCGGCCAGACCGGCCACATCTCTCGTGACTGCACTCTGAGTGGCGGTCCGGGCGTC
GGTGGTGGACAGTCTACCGAGTGCTACAAGTGTGGCGAGATGGGACACATCGCACGTAACTGCACCAAATCCTCC
TTCGGCGGCTCCTACGGCGGCGGTGCCTTCGGCGGCGGCGGCGGCGCGGGCAAGACTTGCTACTCGTGCGGTGGC
TACGGCCACATGTCCCGCGAGTGTGTCAACGGCATGAAGTGCTACAACTGCGGCGAGTCCGGCCATTACTCGCGC
GACTGCCCCAAGGAGTCGGCCGGTGGCGGCGAGAAGATTTGCTACAAGTGCCAGCAGGCCGGCCATGTCCAGGCC
CAGTGCCCCAACTGA
Gene >Hirsu2|8134
CTGCAGACTCTTGCACCTCAACAAGCGCTGCCCGGCATCGTCGATTGGCTGTTGGTCTGCACCTCACCATGTGAG
TTGTCCCTGCCTCGCTCTGCATGGCCTGTACACTCGAGTATCCGCACGTGCATTGGGAGGAAAAGAACCACATCC
GCAAATTTCTCTCCCGCTGTGGGAATTTTTCTTTCCCTCGCCTTTCCCGCCTGCCCCGCTTAGATTACCTTACCT
CAGTCCTAGGCACCGTTTGTACCAGCGCGTGCTGAAAACCCAAACACCGTTATCGCCCTGGGCCAGAAAAAAATT
CTTTCCTTTCTCGCCTCTTGCGCTTTGCCAACCGAAGCCCTATCCTGACTCCGCACAGCGATCGCTCAGTCAGTC
GTCTTCTGCTCTCCAAGAGAAGTAAGTTCCGCCTCTGCACCAACCCGCCGCCCTTCCAAAACAGCTGCTCGGTCC
GACAGGAACGGGCAACGGCCGTCCTCCCTCCTGGCATTCACCGCCGCGCCGACCTGCTCACGGCGCTCGTCACCT
GCTGATCTCGAGCAACAGCGCTCCCTCCACAACTTCGAAGCGGCGCAAAATGGATTACACGCGCGGCGCGTGCTA
CTCTTGTGAGTCGTGCCTTTCCCTTCCCGCCCTGATGCGATGACACCCTCTTCTGTACCTCTGCAACGAGTCAAC
CTTTGCTATTGGCAGTGACTGACAGGGATCGATCCCACACAGGCGGTTCCACCGGCCATCAGGTACGTCGAAGAA
GCTCGCTCGGCCATGGCGATGTCGCCCATCTCACTATTCTCGTAGGCCCGTGACTGCCCGACCAAGGGGCCCGCC
AAGTGGTAAGTTCTGCCTGGCTCGGCTTGGGTGAATGAGCCTCAGCTAAAACCCGGATCAAGCTACAACTGCGGT
GGTGAGTTGACCTGCGCTTGCTGCCGACGTCGTCTTCCTCAGCTGACTTCTGTTGTAGGCGAGGGCCATATGAGT
ACGTCTTGCCGCTCTCGTCCCGGGCGAATTCCGAGCCGCTCGCTGACCGGCGTCTACAGGCCGAGACTGCCCCGA
GCCCTTGAAGGAGAACAAGTCCTGCTACAAATGCGGCCAGACCGGCCACATCTCTCGTGACTGCACTCTGAGTGG
CGGTCCGGGCGTCGGTGGTGGACAGTCTACCGAGTGCTACAAGGCAAGAACTGGAACAGCCGTTCCCTTTGACGC
GACTTGGCCATCCTTACTGACCAGAGGACAGTGTGGCGAGATGGGACACATCGCACGTAACTGCACCAAATCCTC
CTTCGGCGGCTCCTACGGCGGCGGTGCCTTCGGCGGCGGCGGCGGCGCGGGCAAGACTTGCTACTCGTGCGGTGG
CTACGGCCACATGTCCCGTAAGCCACGGCCGGTCTTTCCTCCTCCCGGGCGGCAGTGCTAACACGTGGCCTTGTA
GGCGAGTGTGTCAACGGCATGAAGTGCTACAACTGCGGCGAGTCCGGCCATTACTCGCGCGACTGCCCCAAGGAG
TCGGCCGGTGGCGGCGAGAAGATTTGCTACAAGTGCCAGCAGGCCGGCCATGTCCAGGCCCAGTGCCCCAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail