Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8129
Gene name
LocationContig_510:6493..7232
Strand-
Gene length (bp)739
Transcript length (bp)642
Coding sequence length (bp)642
Protein length (aa) 214

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.1008 0.0646 0.8616 0.4358 0.058 0.0024 0.2324 0.0935 0.1405 0.0024

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999738

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6273
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02916
Ophiocordyceps camponoti-rufipedis Ophun1|5720
Ophiocordyceps kimflemingae Ophio5|5600
Ophiocordyceps subramaniannii Hirsu2|8129 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8129
MVRSLLLLAAFAAVGLAADAESNEVQQVMEKFFKDVPEDATFQTNADVVTVSVPCPTGYCEKPDVGFTLVAGPST
LGFKFPEGFNEDGSTYKSFEGGCVCSTEVGTCSMAAEVQGKKKTTIDATVTVDQCSTIFDLVPSAANKGTPTAAV
SATGSRSAAITGQTGQSGASSTASSTSGSASPTAGSNKAAGPAAAINQLLLGVAALMGAAIAL*
Coding >Hirsu2|8129
ATGGTCCGCTCATTGCTTCTGCTGGCAGCCTTCGCCGCCGTCGGCCTGGCAGCAGACGCCGAATCCAACGAGGTT
CAGCAGGTCATGGAAAAGTTCTTCAAAGATGTTCCCGAAGACGCGACTTTCCAGACCAACGCGGATGTCGTTACG
GTGTCTGTTCCCTGCCCAACCGGTTATTGCGAAAAACCCGATGTCGGGTTTACCCTCGTCGCTGGTCCTTCGACG
CTTGGCTTCAAGTTTCCCGAAGGCTTCAACGAAGACGGTTCGACATACAAGAGCTTTGAGGGGGGTTGCGTCTGT
TCCACCGAGGTCGGCACCTGTTCGATGGCCGCGGAAGTGCAGGGAAAGAAGAAAACGACGATCGATGCCACGGTC
ACCGTAGACCAGTGCTCAACCATCTTTGATCTTGTGCCCAGTGCTGCGAACAAGGGTACGCCGACTGCGGCCGTC
AGCGCCACGGGGTCCAGATCCGCTGCGATTACCGGGCAAACTGGTCAGTCCGGGGCCTCTTCGACGGCATCTTCT
ACCTCGGGGTCTGCTTCACCCACCGCCGGATCGAACAAGGCTGCCGGGCCGGCGGCGGCGATAAACCAACTGCTG
CTTGGTGTCGCTGCTTTGATGGGAGCCGCCATCGCCCTCTAA
Transcript >Hirsu2|8129
ATGGTCCGCTCATTGCTTCTGCTGGCAGCCTTCGCCGCCGTCGGCCTGGCAGCAGACGCCGAATCCAACGAGGTT
CAGCAGGTCATGGAAAAGTTCTTCAAAGATGTTCCCGAAGACGCGACTTTCCAGACCAACGCGGATGTCGTTACG
GTGTCTGTTCCCTGCCCAACCGGTTATTGCGAAAAACCCGATGTCGGGTTTACCCTCGTCGCTGGTCCTTCGACG
CTTGGCTTCAAGTTTCCCGAAGGCTTCAACGAAGACGGTTCGACATACAAGAGCTTTGAGGGGGGTTGCGTCTGT
TCCACCGAGGTCGGCACCTGTTCGATGGCCGCGGAAGTGCAGGGAAAGAAGAAAACGACGATCGATGCCACGGTC
ACCGTAGACCAGTGCTCAACCATCTTTGATCTTGTGCCCAGTGCTGCGAACAAGGGTACGCCGACTGCGGCCGTC
AGCGCCACGGGGTCCAGATCCGCTGCGATTACCGGGCAAACTGGTCAGTCCGGGGCCTCTTCGACGGCATCTTCT
ACCTCGGGGTCTGCTTCACCCACCGCCGGATCGAACAAGGCTGCCGGGCCGGCGGCGGCGATAAACCAACTGCTG
CTTGGTGTCGCTGCTTTGATGGGAGCCGCCATCGCCCTCTAA
Gene >Hirsu2|8129
ATGGTCCGCTCATTGCTTCTGCTGGCAGCCTTCGCCGCCGTCGGCCTGGCAGCAGACGCCGAATCCAACGAGGTT
CAGCAGGTCATGGAAAAGTTCTTCAAAGATGTTCCCGAAGACGCGACTTTCCAGACCAACGCGGATGTCGTTACG
GTGTCTGTTCCCTGCCCAACCGGTTATTGCGAAAAACCCGATGTCGGGTTTACCCTCGTCGCTGGTCCTTCGACG
CTTGGCTTCAAGTTTCCCGAAGGCTTCAACGAAGACGGTTCGACGTGAGTCTACAGTCACTCCTGTACATGTATA
TTTCTACTGGCTACGGTCGGAAGGCTTGATGGCTTTGGACGGCTGATCCTCTATTGTATCGATCAGATACAAGAG
CTTTGAGGGGGGTTGCGTCTGTTCCACCGAGGTCGGCACCTGTTCGATGGCCGCGGAAGTGCAGGGAAAGAAGAA
AACGACGATCGATGCCACGGTCACCGTAGACCAGTGCTCAACCATCTTTGATCTTGTGCCCAGTGCTGCGAACAA
GGGTACGCCGACTGCGGCCGTCAGCGCCACGGGGTCCAGATCCGCTGCGATTACCGGGCAAACTGGTCAGTCCGG
GGCCTCTTCGACGGCATCTTCTACCTCGGGGTCTGCTTCACCCACCGCCGGATCGAACAAGGCTGCCGGGCCGGC
GGCGGCGATAAACCAACTGCTGCTTGGTGTCGCTGCTTTGATGGGAGCCGCCATCGCCCTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail