Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8127
Gene name
LocationContig_51:49693..50278
Strand-
Gene length (bp)585
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase 1.7E-12 21 172

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33753|TRM2_YEAST tRNA (uracil(54)-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM2 PE=1 SV=2 1 172 1.0E-47
sp|Q09833|YAD7_SCHPO tRNA (uracil(54)-C(5))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.07c PE=3 SV=1 1 172 5.0E-44
sp|Q5HEM5|Y1957_STAAC Uncharacterized RNA methyltransferase SACOL1957 OS=Staphylococcus aureus (strain COL) GN=SACOL1957 PE=3 SV=1 24 171 5.0E-26
sp|Q8CRU6|Y1582_STAES Uncharacterized RNA methyltransferase SE_1582 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1582 PE=3 SV=2 24 176 1.0E-25
sp|Q99SY9|Y1897_STAAM Uncharacterized RNA methyltransferase SAV1897 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1897 PE=3 SV=1 24 171 1.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33753|TRM2_YEAST tRNA (uracil(54)-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM2 PE=1 SV=2 1 172 1.0E-47
sp|Q09833|YAD7_SCHPO tRNA (uracil(54)-C(5))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.07c PE=3 SV=1 1 172 5.0E-44
sp|Q5HEM5|Y1957_STAAC Uncharacterized RNA methyltransferase SACOL1957 OS=Staphylococcus aureus (strain COL) GN=SACOL1957 PE=3 SV=1 24 171 5.0E-26
sp|Q8CRU6|Y1582_STAES Uncharacterized RNA methyltransferase SE_1582 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1582 PE=3 SV=2 24 176 1.0E-25
sp|Q99SY9|Y1897_STAAM Uncharacterized RNA methyltransferase SAV1897 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1897 PE=3 SV=1 24 171 1.0E-25
sp|Q7A4Q9|Y1713_STAAN Uncharacterized RNA methyltransferase SA1713 OS=Staphylococcus aureus (strain N315) GN=SA1713 PE=3 SV=1 24 171 1.0E-25
sp|Q6GFG0|Y1988_STAAR Uncharacterized RNA methyltransferase SAR1988 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1988 PE=3 SV=1 24 171 3.0E-25
sp|Q8R933|Y1797_CALS4 Uncharacterized RNA methyltransferase TTE1797 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1797 PE=3 SV=1 5 172 3.0E-25
sp|Q8NVT4|Y1838_STAAW Uncharacterized RNA methyltransferase MW1838 OS=Staphylococcus aureus (strain MW2) GN=MW1838 PE=3 SV=1 24 171 6.0E-25
sp|Q6G836|Y1819_STAAS Uncharacterized RNA methyltransferase SAS1819 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1819 PE=3 SV=1 24 171 6.0E-25
sp|Q5HN37|Y1435_STAEQ Uncharacterized RNA methyltransferase SERP1435 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1435 PE=3 SV=1 24 176 7.0E-25
sp|Q74D67|Y1452_GEOSL Uncharacterized RNA methyltransferase GSU1452 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU1452 PE=3 SV=1 8 187 4.0E-24
sp|Q7V7K6|Y737_PROMM Uncharacterized RNA methyltransferase PMT_0737 OS=Prochlorococcus marinus (strain MIT 9313) GN=PMT_0737 PE=3 SV=1 8 172 1.0E-23
sp|Q9KF10|Y687_BACHD Uncharacterized RNA methyltransferase BH0687 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH0687 PE=3 SV=1 22 171 9.0E-23
sp|Q8YR05|Y3654_NOSS1 Uncharacterized RNA methyltransferase alr3654 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3654 PE=3 SV=1 22 170 2.0E-22
sp|Q92AV4|Y1815_LISIN Uncharacterized RNA methyltransferase lin1815 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin1815 PE=3 SV=1 2 172 2.0E-22
sp|Q7U6V8|Y1228_SYNPX Uncharacterized RNA methyltransferase SYNW1228 OS=Synechococcus sp. (strain WH8102) GN=SYNW1228 PE=3 SV=1 24 172 2.0E-22
sp|O31545|YFJO_BACSU Uncharacterized RNA methyltransferase YfjO OS=Bacillus subtilis (strain 168) GN=yfjO PE=3 SV=1 2 170 2.0E-22
sp|Q71YW4|Y1727_LISMF Uncharacterized RNA methyltransferase LMOf2365_1727 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=LMOf2365_1727 PE=3 SV=1 2 174 5.0E-22
sp|Q8Y6I1|Y1703_LISMO Uncharacterized RNA methyltransferase lmo1703 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo1703 PE=3 SV=1 2 174 7.0E-22
sp|Q837V0|Y728_ENTFA Uncharacterized RNA methyltransferase EF_0728 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=EF_0728 PE=3 SV=1 2 175 1.0E-21
sp|Q73EJ5|Y363_BACC1 Uncharacterized RNA methyltransferase BCE_0363 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0363 PE=3 SV=1 22 174 1.0E-21
sp|Q7VBX7|Y965_PROMA Uncharacterized RNA methyltransferase Pro_0965 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=Pro_0965 PE=3 SV=1 24 172 2.0E-21
sp|Q8ES75|Y768_OCEIH Uncharacterized RNA methyltransferase OB0768 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB0768 PE=3 SV=1 2 170 2.0E-21
sp|Q92AQ7|Y1863_LISIN Uncharacterized RNA methyltransferase lin1863 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin1863 PE=3 SV=1 2 170 3.0E-21
sp|Q9KEF5|Y897_BACHD Uncharacterized RNA methyltransferase BH0897 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH0897 PE=3 SV=1 2 170 3.0E-21
sp|Q7NGN4|Y3134_GLOVI Uncharacterized RNA methyltransferase gll3134 OS=Gloeobacter violaceus (strain PCC 7421) GN=gll3134 PE=3 SV=1 16 172 4.0E-21
sp|Q81ZD6|Y333_BACAN Uncharacterized RNA methyltransferase BA_0333/GBAA_0333/BAS0318 OS=Bacillus anthracis GN=BA_0333 PE=3 SV=1 22 170 6.0E-21
sp|Q8P0H4|Y1360_STRP8 Uncharacterized RNA methyltransferase spyM18_1360 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=spyM18_1360 PE=3 SV=1 22 170 7.0E-21
sp|Q99Z86|Y1346_STRP1 Uncharacterized RNA methyltransferase SPy_1346/M5005_Spy1098 OS=Streptococcus pyogenes serotype M1 GN=SPy_1346 PE=3 SV=1 22 170 7.0E-21
sp|Q814A6|Y364_BACCR Uncharacterized RNA methyltransferase BC_0364 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_0364 PE=3 SV=1 22 170 9.0E-21
sp|Q9CDP0|YWFF_LACLA Uncharacterized RNA methyltransferase YwfF OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ywfF PE=3 SV=1 22 175 9.0E-21
sp|Q88XP4|Y1151_LACPL Uncharacterized RNA methyltransferase lp_1151 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_1151 PE=3 SV=1 24 172 1.0E-20
sp|Q892Z2|Y1941_CLOTE Uncharacterized RNA methyltransferase CTC_01941 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_01941 PE=3 SV=1 24 174 1.0E-20
sp|Q5XBK8|Y1070_STRP6 Uncharacterized RNA methyltransferase M6_Spy1070 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy1070 PE=3 SV=1 22 170 1.0E-20
sp|P0DG15|Y1024_STRPQ Uncharacterized RNA methyltransferase SPs0836 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=SPs0836 PE=3 SV=1 22 170 1.0E-20
sp|P0DG14|Y1024_STRP3 Uncharacterized RNA methyltransferase SpyM3_1024 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=SpyM3_1024 PE=3 SV=1 22 170 1.0E-20
sp|Q8Y6D6|Y1751_LISMO Uncharacterized RNA methyltransferase lmo1751 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo1751 PE=3 SV=1 2 170 2.0E-20
sp|Q71YR7|Y1776_LISMF Uncharacterized RNA methyltransferase LMOf2365_1776 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=LMOf2365_1776 PE=3 SV=1 2 170 2.0E-20
sp|Q9CGB9|YLJE_LACLA Uncharacterized RNA methyltransferase YljE OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yljE PE=3 SV=1 22 172 2.0E-20
sp|P73374|Y1967_SYNY3 Uncharacterized RNA methyltransferase sll1967 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1967 PE=3 SV=1 11 171 3.0E-20
sp|Q97R12|Y1029_STRPN Uncharacterized RNA methyltransferase SP_1029 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=SP_1029 PE=3 SV=1 22 176 4.0E-20
sp|Q8DKB7|Y942_THEEB Uncharacterized RNA methyltransferase tlr0942 OS=Thermosynechococcus elongatus (strain BP-1) GN=tlr0942 PE=3 SV=1 12 170 6.0E-20
sp|P55137|Y742_CHLTR Uncharacterized RNA methyltransferase CT_742 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_742 PE=3 SV=2 22 172 6.0E-20
sp|Q8DPY7|Y932_STRR6 Uncharacterized RNA methyltransferase spr0932 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=spr0932 PE=3 SV=1 22 176 9.0E-20
sp|Q73E18|Y542_BACC1 Uncharacterized RNA methyltransferase BCE_0542 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0542 PE=3 SV=1 2 172 1.0E-19
sp|Q8DUV4|Y788_STRMU Uncharacterized RNA methyltransferase SMU_788 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=SMU_788 PE=3 SV=1 22 170 1.0E-19
sp|Q81Z48|Y426_BACAN Uncharacterized RNA methyltransferase BA_0426/GBAA_0426/BAS0414 OS=Bacillus anthracis GN=BA_0426 PE=3 SV=1 2 170 2.0E-19
sp|C3LWJ3|RLMC_VIBCM 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rlmC PE=3 SV=1 23 172 3.0E-19
sp|A5F0U5|RLMC_VIBC3 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rlmC PE=3 SV=1 23 172 3.0E-19
sp|Q9I525|RLMD_PSEAE 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rlmD PE=3 SV=1 17 171 3.0E-19
sp|Q02I93|RLMD_PSEAB 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rlmD PE=3 SV=1 17 171 3.0E-19
sp|O31503|RLMCD_BACSU 23S rRNA (uracil-C(5))-methyltransferase RlmCD OS=Bacillus subtilis (strain 168) GN=rlmCD PE=1 SV=1 22 170 4.0E-19
sp|A6VUQ2|RLMD_MARMS 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Marinomonas sp. (strain MWYL1) GN=rlmD PE=3 SV=1 22 172 6.0E-19
sp|P58106|Y118_CHLMU Uncharacterized RNA methyltransferase TC_0118 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=TC_0118 PE=3 SV=1 8 172 6.0E-19
sp|Q72IZ3|Y988_THET2 Uncharacterized RNA methyltransferase TT_C0988 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C0988 PE=3 SV=1 25 170 7.0E-19
sp|A1JM74|RLMC_YERE8 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rlmC PE=3 SV=1 21 173 9.0E-19
sp|Q8KGF9|Y009_CHLTE Uncharacterized RNA methyltransferase CT0009 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0009 PE=3 SV=1 22 174 1.0E-18
sp|Q97LN4|Y523_CLOAB Uncharacterized RNA methyltransferase CA_C0523 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C0523 PE=3 SV=1 24 174 1.0E-18
sp|Q8R918|Y1812_CALS4 Uncharacterized RNA methyltransferase TTE1812 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1812 PE=3 SV=1 2 172 1.0E-18
sp|D3UZL8|RLMC_XENBS 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Xenorhabdus bovienii (strain SS-2004) GN=rlmC PE=3 SV=1 21 170 2.0E-18
sp|Q9KL20|RLMC_VIBCH 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rlmC PE=3 SV=1 23 172 3.0E-18
sp|F6CY50|RLMD_MARPP 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Marinomonas posidonica (strain CECT 7376 / NCIMB 14433 / IVIA-Po-181) GN=rlmD PE=3 SV=1 22 172 3.0E-18
sp|Q97NV8|Y1901_STRPN Uncharacterized RNA methyltransferase SP_1901 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=SP_1901 PE=3 SV=2 22 170 3.0E-18
sp|Q8DNH6|Y1717_STRR6 Uncharacterized RNA methyltransferase spr1717 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=spr1717 PE=3 SV=1 22 170 3.0E-18
sp|Q8DSK3|Y1779_STRMU Uncharacterized RNA methyltransferase SMU_1779c OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=SMU_1779c PE=3 SV=1 18 170 4.0E-18
sp|A0KGG9|RLMD_AERHH 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rlmD PE=3 SV=1 22 172 6.0E-18
sp|Q74I68|Y1698_LACJO Uncharacterized RNA methyltransferase LJ_1698 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=LJ_1698 PE=3 SV=1 22 174 6.0E-18
sp|Q6KHE2|Y5020_MYCMO Uncharacterized RNA methyltransferase MMOB5020 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=MMOB5020 PE=3 SV=1 22 174 8.0E-18
sp|Q8ZQJ5|RLMC_SALTY 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rlmC PE=3 SV=1 21 172 9.0E-18
sp|B4TRN5|RLMC_SALSV 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Salmonella schwarzengrund (strain CVM19633) GN=rlmC PE=3 SV=1 21 172 9.0E-18
sp|B5QYK4|RLMC_SALEP 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Salmonella enteritidis PT4 (strain P125109) GN=rlmC PE=3 SV=1 21 172 9.0E-18
sp|B6I8H9|RLMC_ECOSE 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli (strain SE11) GN=rlmC PE=3 SV=1 21 170 1.0E-17
sp|Q4K898|RLMD_PSEF5 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rlmD PE=3 SV=1 17 171 1.0E-17
sp|B7NAK5|RLMC_ECOLU 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rlmC PE=3 SV=1 21 170 1.0E-17
sp|B7M7D4|RLMC_ECO8A 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli O8 (strain IAI1) GN=rlmC PE=3 SV=1 21 170 1.0E-17
sp|B7LD52|RLMC_ECO55 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli (strain 55989 / EAEC) GN=rlmC PE=3 SV=1 21 170 1.0E-17
sp|A7ZJS7|RLMC_ECO24 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rlmC PE=3 SV=1 21 170 1.0E-17
sp|C0PXN9|RLMC_SALPC 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Salmonella paratyphi C (strain RKS4594) GN=rlmC PE=3 SV=1 21 172 1.0E-17
sp|A9N824|RLMC_SALPB 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rlmC PE=3 SV=1 21 172 1.0E-17
sp|Q57R80|RLMC_SALCH 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Salmonella choleraesuis (strain SC-B67) GN=rlmC PE=3 SV=1 21 172 1.0E-17
sp|Q8P017|Y1615_STRP8 Uncharacterized RNA methyltransferase spyM18_1615 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=spyM18_1615 PE=3 SV=1 22 172 2.0E-17
sp|F2JTX5|RLMD_MARM1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Marinomonas mediterranea (strain ATCC 700492 / JCM 21426 / NBRC 103028 / MMB-1) GN=rlmD PE=3 SV=1 22 172 2.0E-17
sp|B1IWR3|RLMC_ECOLC 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rlmC PE=3 SV=1 21 170 2.0E-17
sp|A7ZYG2|RLMC_ECOHS 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli O9:H4 (strain HS) GN=rlmC PE=3 SV=1 21 170 2.0E-17
sp|Q99YP3|Y1606_STRP1 Uncharacterized RNA methyltransferase SPy_1606/M5005_Spy1319 OS=Streptococcus pyogenes serotype M1 GN=SPy_1606 PE=3 SV=1 22 172 2.0E-17
sp|B7UMV1|RLMC_ECO27 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rlmC PE=3 SV=1 21 170 2.0E-17
sp|Q891A0|Y2481_CLOTE Uncharacterized RNA methyltransferase CTC_02481 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_02481 PE=3 SV=1 26 170 2.0E-17
sp|B7NPF5|RLMC_ECO7I 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rlmC PE=3 SV=1 21 170 2.0E-17
sp|Q8E0T7|Y633_STRA5 Uncharacterized RNA methyltransferase SAG0633 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=SAG0633 PE=3 SV=1 22 170 2.0E-17
sp|Q8E6F5|Y613_STRA3 Uncharacterized RNA methyltransferase gbs0613 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs0613 PE=3 SV=1 22 170 2.0E-17
sp|Q83S14|RLMC_SHIFL 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shigella flexneri GN=rlmC PE=3 SV=1 21 170 2.0E-17
sp|Q0T8K2|RLMC_SHIF8 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shigella flexneri serotype 5b (strain 8401) GN=rlmC PE=3 SV=1 21 170 2.0E-17
sp|Q3Z3S5|RLMC_SHISS 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shigella sonnei (strain Ss046) GN=rlmC PE=3 SV=1 21 170 2.0E-17
sp|Q1RE66|RLMC_ECOUT 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli (strain UTI89 / UPEC) GN=rlmC PE=3 SV=1 21 170 2.0E-17
sp|Q0TJI9|RLMC_ECOL5 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rlmC PE=3 SV=1 21 170 2.0E-17
sp|A1A998|RLMC_ECOK1 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli O1:K1 / APEC GN=rlmC PE=3 SV=1 21 170 2.0E-17
sp|B7MHG3|RLMC_ECO45 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rlmC PE=3 SV=1 21 170 2.0E-17
sp|Q8FJE7|RLMC_ECOL6 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rlmC PE=3 SV=1 21 170 3.0E-17
sp|B7MQW3|RLMC_ECO81 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli O81 (strain ED1a) GN=rlmC PE=3 SV=1 21 170 3.0E-17
sp|B5YSF1|RLMC_ECO5E 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rlmC PE=3 SV=1 21 170 3.0E-17
sp|Q8X6Q5|RLMC_ECO57 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli O157:H7 GN=rlmC PE=3 SV=1 21 170 3.0E-17
sp|B1LN12|RLMC_ECOSM 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rlmC PE=3 SV=1 21 170 3.0E-17
sp|Q5XAU1|Y1337_STRP6 Uncharacterized RNA methyltransferase M6_Spy1337 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy1337 PE=3 SV=1 22 172 4.0E-17
sp|P0DG17|Y1299_STRPQ Uncharacterized RNA methyltransferase SPs0562 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=SPs0562 PE=3 SV=1 22 172 4.0E-17
sp|P0DG16|Y1299_STRP3 Uncharacterized RNA methyltransferase SpyM3_1299 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=SpyM3_1299 PE=3 SV=1 22 172 4.0E-17
sp|B4T0E3|RLMC_SALNS 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Salmonella newport (strain SL254) GN=rlmC PE=3 SV=1 21 172 4.0E-17
sp|B5BBV5|RLMC_SALPK 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Salmonella paratyphi A (strain AKU_12601) GN=rlmC PE=3 SV=1 21 172 4.0E-17
sp|Q5PGN2|RLMC_SALPA 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rlmC PE=3 SV=1 21 172 4.0E-17
sp|B5FPZ6|RLMC_SALDC 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Salmonella dublin (strain CT_02021853) GN=rlmC PE=3 SV=1 21 172 4.0E-17
sp|B5F101|RLMC_SALA4 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Salmonella agona (strain SL483) GN=rlmC PE=3 SV=1 21 172 4.0E-17
sp|Q8Z841|RLMC_SALTI 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Salmonella typhi GN=rlmC PE=3 SV=1 21 172 4.0E-17
sp|A0L0G4|RLMC_SHESA 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shewanella sp. (strain ANA-3) GN=rlmC PE=3 SV=1 2 170 4.0E-17
sp|B8F7Z1|TRMA_HAEPS tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=trmA PE=3 SV=1 24 175 6.0E-17
sp|Q74CC6|Y1748_GEOSL Uncharacterized RNA methyltransferase GSU1748 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU1748 PE=3 SV=1 24 172 6.0E-17
sp|Q72DK5|Y924_DESVH Uncharacterized RNA methyltransferase DVU_0924 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=DVU_0924 PE=3 SV=1 22 177 6.0E-17
sp|Q0HM20|RLMC_SHESM 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shewanella sp. (strain MR-4) GN=rlmC PE=3 SV=1 2 170 6.0E-17
sp|Q0HRR5|RLMC_SHESR 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shewanella sp. (strain MR-7) GN=rlmC PE=3 SV=1 2 170 7.0E-17
sp|A7MF48|RLMC_CROS8 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rlmC PE=3 SV=1 18 172 7.0E-17
sp|A9MIM3|RLMC_SALAR 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rlmC PE=3 SV=1 21 172 8.0E-17
sp|Q72W54|Y086_LEPIC Uncharacterized RNA methyltransferase LIC_10086 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=LIC_10086 PE=3 SV=1 22 174 8.0E-17
sp|Q323P2|RLMC_SHIBS 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shigella boydii serotype 4 (strain Sb227) GN=rlmC PE=3 SV=1 21 170 8.0E-17
sp|A4SRC5|RLMD_AERS4 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Aeromonas salmonicida (strain A449) GN=rlmD PE=3 SV=1 2 172 9.0E-17
sp|P75817|RLMC_ECOLI 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli (strain K12) GN=rlmC PE=1 SV=1 21 170 9.0E-17
sp|B1X800|RLMC_ECODH 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli (strain K12 / DH10B) GN=rlmC PE=3 SV=1 21 170 9.0E-17
sp|C4ZY31|RLMC_ECOBW 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rlmC PE=3 SV=1 21 170 9.0E-17
sp|Q8F9U1|Y098_LEPIN Uncharacterized RNA methyltransferase LA_0098 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=LA_0098 PE=3 SV=1 22 174 9.0E-17
sp|B2VFZ2|RLMD_ERWT9 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rlmD PE=3 SV=1 22 172 9.0E-17
sp|Q97J51|Y1435_CLOAB Uncharacterized RNA methyltransferase CA_C1435 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1435 PE=3 SV=1 24 172 1.0E-16
sp|B7LN23|RLMC_ESCF3 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rlmC PE=3 SV=1 21 170 2.0E-16
sp|B0TUZ2|RLMC_SHEHH 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shewanella halifaxensis (strain HAW-EB4) GN=rlmC PE=3 SV=2 2 170 2.0E-16
sp|A8AIQ7|RLMC_CITK8 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rlmC PE=3 SV=1 2 172 2.0E-16
sp|Q65W13|RLMD_MANSM 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rlmD PE=3 SV=1 22 172 3.0E-16
sp|B2TUM0|RLMC_SHIB3 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rlmC PE=3 SV=1 21 170 3.0E-16
sp|B0BU06|TRMA_ACTPJ tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=trmA PE=3 SV=1 24 172 3.0E-16
sp|B4EUF2|RLMD_PROMH 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Proteus mirabilis (strain HI4320) GN=rlmD PE=3 SV=1 22 172 3.0E-16
sp|B1XU70|RLMD_POLNS 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rlmD PE=3 SV=1 22 172 4.0E-16
sp|Q6D3S2|RLMC_PECAS 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rlmC PE=3 SV=1 13 172 7.0E-16
sp|Q9Z721|Y885_CHLPN Uncharacterized RNA methyltransferase CPn_0885/CP_0981/CPj0885/CpB0914 OS=Chlamydia pneumoniae GN=CPn_0885 PE=3 SV=2 22 172 7.0E-16
sp|A4W8M4|RLMC_ENT38 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Enterobacter sp. (strain 638) GN=rlmC PE=3 SV=1 18 170 7.0E-16
sp|D3VBF7|RLMC_XENNA 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / LMG 1036 / NCIB 9965 / AN6) GN=rlmC PE=3 SV=1 21 170 8.0E-16
sp|A8GCB4|RLMC_SERP5 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Serratia proteamaculans (strain 568) GN=rlmC PE=3 SV=1 18 172 1.0E-15
sp|Q74N58|Y053_NANEQ Uncharacterized RNA methyltransferase NEQ053 OS=Nanoarchaeum equitans (strain Kin4-M) GN=NEQ053 PE=3 SV=1 22 177 1.0E-15
sp|Q830R6|Y2706_ENTFA Uncharacterized RNA methyltransferase EF_2706 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=EF_2706 PE=3 SV=1 22 172 1.0E-15
sp|Q9CJX3|RLMD_PASMU 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Pasteurella multocida (strain Pm70) GN=rlmD PE=3 SV=1 22 172 1.0E-15
sp|B5XV15|RLMD_KLEP3 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Klebsiella pneumoniae (strain 342) GN=rlmD PE=3 SV=1 22 172 1.0E-15
sp|Q606W5|RLMD_METCA 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rlmD PE=3 SV=1 22 172 2.0E-15
sp|Q8G4I8|Y1394_BIFLO Uncharacterized RNA methyltransferase BL1394 OS=Bifidobacterium longum (strain NCC 2705) GN=BL1394 PE=3 SV=1 24 172 2.0E-15
sp|Q4ZQ44|RLMD_PSEU2 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rlmD PE=3 SV=1 22 171 2.0E-15
sp|B1JRJ4|RLMC_YERPY 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rlmC PE=3 SV=1 21 170 2.0E-15
sp|Q66CN7|RLMC_YERPS 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rlmC PE=3 SV=1 21 170 2.0E-15
sp|B2K9X0|RLMC_YERPB 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rlmC PE=3 SV=1 21 170 2.0E-15
sp|A7FK27|RLMC_YERP3 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rlmC PE=3 SV=1 21 170 2.0E-15
sp|B3GZC6|TRMA_ACTP7 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=trmA PE=3 SV=1 24 172 3.0E-15
sp|Q8PB48|RLMD_XANCP 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rlmD PE=3 SV=1 22 172 3.0E-15
sp|Q4USG1|RLMD_XANC8 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rlmD PE=3 SV=1 22 172 3.0E-15
sp|Q6MGU3|Y3828_BDEBA Uncharacterized RNA methyltransferase Bd3828 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=Bd3828 PE=3 SV=1 26 170 3.0E-15
sp|A1JJR0|RLMD_YERE8 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rlmD PE=3 SV=1 22 170 3.0E-15
sp|C5B8X6|RLMD_EDWI9 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Edwardsiella ictaluri (strain 93-146) GN=rlmD PE=3 SV=1 22 171 3.0E-15
sp|Q7MVG9|Y1095_PORGI Uncharacterized RNA methyltransferase PG_1095 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=PG_1095 PE=3 SV=1 6 172 3.0E-15
sp|A3N3R7|TRMA_ACTP2 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=trmA PE=3 SV=1 24 172 3.0E-15
sp|A5F5I8|RLMD_VIBC3 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rlmD PE=3 SV=1 22 169 4.0E-15
sp|B4ET17|RLMC_PROMH 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Proteus mirabilis (strain HI4320) GN=rlmC PE=3 SV=1 21 170 4.0E-15
sp|Q6MAY1|Y1544_PARUW Uncharacterized RNA methyltransferase pc1544 OS=Protochlamydia amoebophila (strain UWE25) GN=pc1544 PE=3 SV=1 26 170 4.0E-15
sp|A1U2U9|RLMD_MARHV 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rlmD PE=3 SV=1 22 175 4.0E-15
sp|Q821Q5|Y883_CHLCV Uncharacterized RNA methyltransferase CCA_00883 OS=Chlamydophila caviae (strain GPIC) GN=CCA_00883 PE=3 SV=1 22 174 5.0E-15
sp|A7MTS9|RLMD_VIBCB 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rlmD PE=3 SV=1 8 172 5.0E-15
sp|A4TN73|RLMC_YERPP 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Yersinia pestis (strain Pestoides F) GN=rlmC PE=3 SV=1 21 170 6.0E-15
sp|Q1CGA8|RLMC_YERPN 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rlmC PE=3 SV=1 21 170 6.0E-15
sp|A9R4V6|RLMC_YERPG 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rlmC PE=3 SV=1 21 170 6.0E-15
sp|Q8ZGG1|RLMC_YERPE 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Yersinia pestis GN=rlmC PE=3 SV=1 21 170 6.0E-15
sp|D0JIM5|RLMC_YERPD 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Yersinia pestis (strain D106004) GN=rlmC PE=3 SV=2 21 170 6.0E-15
sp|Q1CAC8|RLMC_YERPA 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rlmC PE=3 SV=1 21 170 6.0E-15
sp|Q8XNG6|Y367_CLOPE Uncharacterized RNA methyltransferase CPE0367 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE0367 PE=3 SV=1 2 170 6.0E-15
sp|A1RGE6|RLMC_SHESW 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shewanella sp. (strain W3-18-1) GN=rlmC PE=3 SV=1 2 172 6.0E-15
sp|Q8R5Z8|Y1713_FUSNN Uncharacterized RNA methyltransferase FN1713 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=FN1713 PE=3 SV=1 23 172 6.0E-15
sp|A3QB25|RLMC_SHELP 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rlmC PE=3 SV=1 24 172 6.0E-15
sp|Q0A8Y4|RLMD_ALKEH 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rlmD PE=3 SV=1 24 176 7.0E-15
sp|Q7W676|RLMD_BORPA 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rlmD PE=3 SV=2 22 175 8.0E-15
sp|Q885Y8|RLMD_PSESM 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rlmD PE=3 SV=1 17 171 8.0E-15
sp|A6TD57|RLMD_KLEP7 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rlmD PE=3 SV=1 22 172 1.0E-14
sp|C6DEQ3|RLMC_PECCP 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rlmC PE=3 SV=1 13 172 1.0E-14
sp|Q88SY9|Y3226_LACPL Uncharacterized RNA methyltransferase lp_3226 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_3226 PE=3 SV=1 22 167 1.0E-14
sp|B4SRK6|RLMD_STRM5 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Stenotrophomonas maltophilia (strain R551-3) GN=rlmD PE=3 SV=1 22 172 1.0E-14
sp|A9L1I5|RLMC_SHEB9 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shewanella baltica (strain OS195) GN=rlmC PE=3 SV=1 2 170 1.0E-14
sp|B8E5Q5|RLMC_SHEB2 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shewanella baltica (strain OS223) GN=rlmC PE=3 SV=1 2 170 1.0E-14
sp|Q9UZR7|ATRMA_PYRAB tRNA (uracil(54)-C(5))-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB10780 PE=1 SV=1 12 170 1.0E-14
sp|Q8E1E4|Y413_STRA5 Uncharacterized RNA methyltransferase SAG0413 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=SAG0413 PE=3 SV=1 22 174 1.0E-14
sp|O66617|Y257_AQUAE Uncharacterized RNA methyltransferase aq_257 OS=Aquifex aeolicus (strain VF5) GN=aq_257 PE=3 SV=1 25 174 1.0E-14
sp|A4Y9Y4|RLMC_SHEPC 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rlmC PE=3 SV=1 2 172 1.0E-14
sp|Q7WI42|RLMD_BORBR 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rlmD PE=3 SV=1 22 175 2.0E-14
sp|Q47WQ1|RLMD_COLP3 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rlmD PE=3 SV=1 20 170 2.0E-14
sp|A1RHE4|RLMD_SHESW 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella sp. (strain W3-18-1) GN=rlmD PE=3 SV=1 8 171 2.0E-14
sp|Q87LP5|RLMD_VIBPA 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rlmD PE=3 SV=1 22 172 2.0E-14
sp|C5BED3|RLMC_EDWI9 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Edwardsiella ictaluri (strain 93-146) GN=rlmC PE=3 SV=1 13 172 2.0E-14
sp|A6WS34|RLMC_SHEB8 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shewanella baltica (strain OS185) GN=rlmC PE=3 SV=1 2 170 2.0E-14
sp|Q32ID7|RLMC_SHIDS 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rlmC PE=3 SV=1 21 169 2.0E-14
sp|A4Y952|RLMD_SHEPC 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rlmD PE=3 SV=1 8 171 3.0E-14
sp|Q8EI67|RLMC_SHEON 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shewanella oneidensis (strain MR-1) GN=rlmC PE=3 SV=2 24 170 3.0E-14
sp|Q2L016|RLMD_BORA1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Bordetella avium (strain 197N) GN=rlmD PE=3 SV=1 22 177 3.0E-14
sp|Q1IDL9|RLMD_PSEE4 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Pseudomonas entomophila (strain L48) GN=rlmD PE=3 SV=1 17 171 3.0E-14
sp|B9LA97|TRMA_NAUPA tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=trmA PE=3 SV=1 24 172 4.0E-14
sp|Q8E6W1|Y448_STRA3 Uncharacterized RNA methyltransferase gbs0448 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs0448 PE=3 SV=1 22 174 4.0E-14
sp|B2FPX2|RLMD_STRMK 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Stenotrophomonas maltophilia (strain K279a) GN=rlmD PE=3 SV=1 22 172 5.0E-14
sp|A3D7B5|RLMD_SHEB5 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rlmD PE=3 SV=1 22 171 5.0E-14
sp|A3D0Y0|RLMC_SHEB5 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rlmC PE=3 SV=1 2 170 5.0E-14
sp|Q8XIK5|Y2114_CLOPE Uncharacterized RNA methyltransferase CPE2114 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE2114 PE=3 SV=1 12 172 6.0E-14
sp|C3LQZ5|RLMD_VIBCM 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rlmD PE=3 SV=1 22 169 6.0E-14
sp|Q9KPC1|RLMD_VIBCH 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rlmD PE=3 SV=1 22 169 6.0E-14
sp|A8H8Q9|RLMC_SHEPA 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rlmC PE=3 SV=2 2 170 6.0E-14
sp|Q8DC67|RLMD_VIBVU 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Vibrio vulnificus (strain CMCP6) GN=rlmD PE=3 SV=1 22 172 6.0E-14
sp|Q5QVT1|TRMA_IDILO tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=trmA PE=3 SV=2 24 172 6.0E-14
sp|A6WR37|RLMD_SHEB8 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella baltica (strain OS185) GN=rlmD PE=3 SV=1 22 171 7.0E-14
sp|Q8F9A3|Y292_LEPIN Uncharacterized RNA methyltransferase LA_0292 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=LA_0292 PE=3 SV=1 24 172 7.0E-14
sp|Q72VP7|Y249_LEPIC Uncharacterized RNA methyltransferase LIC_10249 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=LIC_10249 PE=3 SV=1 24 172 7.0E-14
sp|A9KYI1|RLMD_SHEB9 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella baltica (strain OS195) GN=rlmD PE=3 SV=1 22 171 7.0E-14
sp|Q48FH7|RLMD_PSE14 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rlmD PE=3 SV=1 17 171 7.0E-14
sp|B8E8S1|RLMD_SHEB2 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella baltica (strain OS223) GN=rlmD PE=3 SV=1 22 171 7.0E-14
sp|Q2SL27|RLMD_HAHCH 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Hahella chejuensis (strain KCTC 2396) GN=rlmD PE=3 SV=1 4 172 8.0E-14
sp|Q0HXI0|RLMD_SHESR 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella sp. (strain MR-7) GN=rlmD PE=3 SV=2 22 171 8.0E-14
sp|A0KU76|RLMD_SHESA 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella sp. (strain ANA-3) GN=rlmD PE=3 SV=1 22 171 8.0E-14
sp|Q8U1N4|ATRMA_PYRFU tRNA (uracil(54)-C(5))-methyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1172 PE=3 SV=1 22 172 9.0E-14
sp|Q0K956|RLMD_CUPNH 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rlmD PE=3 SV=1 22 172 9.0E-14
sp|Q7VXM6|RLMD_BORPE 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rlmD PE=3 SV=1 22 175 9.0E-14
sp|Q7MHP7|RLMD_VIBVY 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Vibrio vulnificus (strain YJ016) GN=rlmD PE=3 SV=2 22 172 1.0E-13
sp|Q7N839|RLMD_PHOLL 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rlmD PE=3 SV=1 22 172 1.0E-13
sp|O58864|ATRMA_PYRHO tRNA (uracil(54)-C(5))-methyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1137 PE=3 SV=1 22 170 1.0E-13
sp|Q7U339|TRMA_HAEDU tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=trmA PE=3 SV=1 24 172 1.0E-13
sp|Q6F847|RLMD_ACIAD 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rlmD PE=3 SV=1 22 178 1.0E-13
sp|Q6MEM7|Y248_PARUW Uncharacterized RNA methyltransferase pc0248 OS=Protochlamydia amoebophila (strain UWE25) GN=pc0248 PE=3 SV=1 2 172 1.0E-13
sp|Q46ZH7|RLMD_CUPPJ 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rlmD PE=3 SV=1 22 172 1.0E-13
sp|Q9X0H9|Y1094_THEMA Uncharacterized RNA methyltransferase TM_1094 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_1094 PE=3 SV=1 4 174 2.0E-13
sp|Q0HL77|RLMD_SHESM 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella sp. (strain MR-4) GN=rlmD PE=3 SV=2 22 171 2.0E-13
sp|C4LBR5|RLMD_TOLAT 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rlmD PE=3 SV=1 2 172 2.0E-13
sp|Q8FEG6|RLMD_ECOL6 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rlmD PE=3 SV=3 22 172 2.0E-13
sp|Q0TE74|RLMD_ECOL5 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rlmD PE=3 SV=1 22 172 2.0E-13
sp|B6EKM3|RLMD_ALISL 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Aliivibrio salmonicida (strain LFI1238) GN=rlmD PE=3 SV=1 22 172 2.0E-13
sp|P55135|RLMD_ECOLI 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Escherichia coli (strain K12) GN=rlmD PE=1 SV=3 22 172 2.0E-13
sp|Q83QD5|RLMD_SHIFL 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shigella flexneri GN=rlmD PE=3 SV=3 22 172 2.0E-13
sp|Q31XK5|RLMD_SHIBS 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shigella boydii serotype 4 (strain Sb227) GN=rlmD PE=3 SV=1 22 172 2.0E-13
sp|Q0T1Q1|RLMD_SHIF8 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shigella flexneri serotype 5b (strain 8401) GN=rlmD PE=3 SV=1 22 172 2.0E-13
sp|Q3YY71|RLMD_SHISS 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shigella sonnei (strain Ss046) GN=rlmD PE=3 SV=1 22 172 2.0E-13
sp|Q63UT8|RLMD_BURPS 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Burkholderia pseudomallei (strain K96243) GN=rlmD PE=3 SV=1 22 172 2.0E-13
sp|Q3JRP8|RLMD_BURP1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Burkholderia pseudomallei (strain 1710b) GN=rlmD PE=3 SV=2 22 172 2.0E-13
sp|Q62JV9|RLMD_BURMA 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Burkholderia mallei (strain ATCC 23344) GN=rlmD PE=3 SV=1 22 172 2.0E-13
sp|Q32CD0|RLMD_SHIDS 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rlmD PE=3 SV=1 22 172 2.0E-13
sp|Q8EBQ3|RLMD_SHEON 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella oneidensis (strain MR-1) GN=rlmD PE=3 SV=1 22 171 3.0E-13
sp|Q9PAY7|RLMD_XYLFA 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Xylella fastidiosa (strain 9a5c) GN=rlmD PE=3 SV=1 22 173 3.0E-13
sp|Q0I127|RLMD_HAES1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Haemophilus somnus (strain 129Pt) GN=rlmD PE=3 SV=1 22 172 3.0E-13
sp|Q8AA22|Y643_BACTN Uncharacterized RNA methyltransferase BT_0643 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=BT_0643 PE=3 SV=1 13 171 3.0E-13
sp|A0RPL1|TRMA_CAMFF tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=trmA PE=3 SV=1 12 172 3.0E-13
sp|B2U9U3|RLMD_RALPJ 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Ralstonia pickettii (strain 12J) GN=rlmD PE=3 SV=1 22 172 3.0E-13
sp|Q87BR3|RLMD_XYLFT 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rlmD PE=3 SV=1 22 173 4.0E-13
sp|A1S4D3|RLMD_SHEAM 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rlmD PE=3 SV=1 22 171 4.0E-13
sp|A7MQZ8|RLMD_CROS8 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rlmD PE=3 SV=1 22 172 4.0E-13
sp|Q6D178|RLMD_PECAS 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rlmD PE=3 SV=1 22 170 4.0E-13
sp|A1S382|RLMC_SHEAM 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rlmC PE=3 SV=1 16 170 5.0E-13
sp|Q4QNK7|RLMD_HAEI8 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Haemophilus influenzae (strain 86-028NP) GN=rlmD PE=3 SV=1 22 170 5.0E-13
sp|Q1R7Q7|RLMD_ECOUT 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Escherichia coli (strain UTI89 / UPEC) GN=rlmD PE=3 SV=1 22 172 5.0E-13
sp|A1AEX2|RLMD_ECOK1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Escherichia coli O1:K1 / APEC GN=rlmD PE=3 SV=1 22 172 5.0E-13
sp|Q6LMS7|RLMD_PHOPR 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Photobacterium profundum GN=rlmD PE=3 SV=2 22 170 5.0E-13
sp|Q5P8D0|TRMA_AROAE tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=trmA PE=3 SV=1 24 172 5.0E-13
sp|Q7N6G6|RLMC_PHOLL 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rlmC PE=3 SV=1 21 170 6.0E-13
sp|Q8PMU6|RLMD_XANAC 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rlmD PE=3 SV=1 22 172 6.0E-13
sp|Q13Z67|RLMD_BURXL 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Burkholderia xenovorans (strain LB400) GN=rlmD PE=3 SV=2 17 172 7.0E-13
sp|C6AQU6|TRMA_AGGAN tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Aggregatibacter aphrophilus (strain NJ8700) GN=trmA PE=3 SV=1 24 172 8.0E-13
sp|Q3K8E9|RLMD_PSEPF 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Pseudomonas fluorescens (strain Pf0-1) GN=rlmD PE=3 SV=1 4 185 8.0E-13
sp|P44643|RLMD_HAEIN 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rlmD PE=3 SV=1 22 170 8.0E-13
sp|Q2P4L7|RLMD_XANOM 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rlmD PE=3 SV=2 22 172 1.0E-12
sp|Q5H1Q8|RLMD_XANOR 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rlmD PE=3 SV=2 22 172 1.0E-12
sp|A8ANZ1|RLMD_CITK8 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rlmD PE=3 SV=1 22 172 1.0E-12
sp|Q9UZK1|ARLMC_PYRAB 23S rRNA (uracil(747)-C(5))-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB11450 PE=1 SV=1 23 172 1.0E-12
sp|Q39FQ4|RLMD_BURL3 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rlmD PE=3 SV=2 22 172 1.0E-12
sp|A0Q5J5|RLMD_FRATN 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Francisella tularensis subsp. novicida (strain U112) GN=rlmD PE=3 SV=1 22 172 1.0E-12
sp|E1W218|RLMD_HAEP3 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Haemophilus parainfluenzae (strain T3T1) GN=rlmD PE=3 SV=1 22 170 1.0E-12
sp|Q48A12|TRMA_COLP3 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=trmA PE=3 SV=1 24 172 1.0E-12
sp|A0K7U1|RLMD_BURCH 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Burkholderia cenocepacia (strain HI2424) GN=rlmD PE=3 SV=1 22 172 1.0E-12
sp|Q1BGX9|RLMD_BURCA 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Burkholderia cenocepacia (strain AU 1054) GN=rlmD PE=3 SV=1 22 172 1.0E-12
sp|Q0VP26|RLMD_ALCBS 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rlmD PE=3 SV=1 22 172 1.0E-12
sp|Q7VNM5|RLMC_HAEDU Putative 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rlmC PE=5 SV=1 21 172 1.0E-12
sp|Q3JCY2|RLMD_NITOC 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rlmD PE=3 SV=1 22 172 1.0E-12
sp|Q8F201|Y2977_LEPIN Uncharacterized RNA methyltransferase LA_2977 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=LA_2977 PE=3 SV=1 20 172 2.0E-12
sp|Q0BEW2|RLMD_BURCM 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rlmD PE=3 SV=2 22 172 2.0E-12
sp|A6W3C7|TRMA_MARMS tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Marinomonas sp. (strain MWYL1) GN=trmA PE=3 SV=1 24 172 2.0E-12
sp|Q47F12|TRMA_DECAR tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Dechloromonas aromatica (strain RCB) GN=trmA PE=3 SV=1 23 172 2.0E-12
sp|B2HYZ7|TRMA_ACIBC tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=trmA PE=3 SV=1 16 173 2.0E-12
sp|A1K4G2|RLMD_AZOSB 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Azoarcus sp. (strain BH72) GN=rlmD PE=3 SV=1 22 172 2.0E-12
sp|A7ZDV3|TRMA_CAMC1 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Campylobacter concisus (strain 13826) GN=trmA PE=3 SV=1 24 171 2.0E-12
sp|Q2SWE9|RLMD_BURTA 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rlmD PE=3 SV=2 22 172 2.0E-12
sp|A7GY40|TRMA_CAMC5 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Campylobacter curvus (strain 525.92) GN=trmA PE=3 SV=1 17 172 2.0E-12
sp|Q8XED8|RLMD_ECO57 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Escherichia coli O157:H7 GN=rlmD PE=3 SV=3 22 172 3.0E-12
sp|A4VI15|TRMA_PSEU5 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=trmA PE=3 SV=1 22 172 3.0E-12
sp|Q5E320|RLMD_VIBF1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rlmD PE=3 SV=2 22 172 3.0E-12
sp|Q7VKU9|RLMD_HAEDU 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rlmD PE=3 SV=1 17 172 3.0E-12
sp|Q9CPH1|RLMC_PASMU 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Pasteurella multocida (strain Pm70) GN=rlmC PE=3 SV=2 21 172 4.0E-12
sp|A8H1S1|RLMD_SHEPA 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rlmD PE=3 SV=1 2 171 4.0E-12
sp|B2HTF7|RLMD_ACIBC 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Acinetobacter baumannii (strain ACICU) GN=rlmD PE=3 SV=1 22 178 4.0E-12
sp|B8F5M9|RLMC_HAEPS 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rlmC PE=3 SV=1 21 170 4.0E-12
sp|B7I675|RLMD_ACIB5 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Acinetobacter baumannii (strain AB0057) GN=rlmD PE=3 SV=1 22 178 4.0E-12
sp|Q72TD6|Y1085_LEPIC Uncharacterized RNA methyltransferase LIC_11085 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=LIC_11085 PE=3 SV=1 20 172 4.0E-12
sp|Q9CK32|TRMA_PASMU tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pasteurella multocida (strain Pm70) GN=trmA PE=3 SV=1 24 172 4.0E-12
sp|B0V5N2|RLMD_ACIBY 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Acinetobacter baumannii (strain AYE) GN=rlmD PE=3 SV=1 22 178 4.0E-12
sp|B7H018|RLMD_ACIB3 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Acinetobacter baumannii (strain AB307-0294) GN=rlmD PE=3 SV=1 22 178 4.0E-12
sp|Q88MB9|RLMD_PSEPK 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Pseudomonas putida (strain KT2440) GN=rlmD PE=3 SV=1 17 171 5.0E-12
sp|Q5UQK3|YR405_MIMIV Putative RNA methyltransferase R405 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R405 PE=3 SV=1 22 174 5.0E-12
sp|A5UI99|RLMC_HAEIG 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Haemophilus influenzae (strain PittGG) GN=rlmC PE=3 SV=1 16 172 6.0E-12
sp|A4WDX1|RLMD_ENT38 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Enterobacter sp. (strain 638) GN=rlmD PE=3 SV=1 22 171 6.0E-12
sp|Q1LLI5|RLMD_CUPMC 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rlmD PE=3 SV=2 18 172 6.0E-12
sp|P44083|RLMC_HAEIN 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rlmC PE=3 SV=1 16 172 6.0E-12
sp|A8EWU8|TRMA_ARCB4 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Arcobacter butzleri (strain RM4018) GN=trmA PE=3 SV=1 8 175 7.0E-12
sp|Q8Z446|RLMD_SALTI 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Salmonella typhi GN=rlmD PE=3 SV=3 20 172 7.0E-12
sp|Q4QLU9|RLMC_HAEI8 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Haemophilus influenzae (strain 86-028NP) GN=rlmC PE=3 SV=1 21 172 8.0E-12
sp|C6DDJ9|RLMD_PECCP 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rlmD PE=3 SV=1 22 170 8.0E-12
sp|Q1QDU2|RLMD_PSYCK 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Psychrobacter cryohalolentis (strain K5) GN=rlmD PE=3 SV=1 22 172 8.0E-12
sp|Q65PY6|TRMA_MANSM tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=trmA PE=3 SV=1 24 172 8.0E-12
sp|Q2Y6W3|RLMD_NITMU 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rlmD PE=3 SV=1 22 172 8.0E-12
sp|A3M4W0|TRMA_ACIBT tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=trmA PE=3 SV=2 16 173 9.0E-12
sp|A3N1B8|RLMC_ACTP2 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rlmC PE=3 SV=1 20 170 9.0E-12
sp|B0VR22|TRMA_ACIBS tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Acinetobacter baumannii (strain SDF) GN=trmA PE=3 SV=1 16 173 9.0E-12
sp|B7I4Y4|TRMA_ACIB5 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=trmA PE=3 SV=1 16 173 9.0E-12
sp|B7H3Q6|TRMA_ACIB3 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=trmA PE=3 SV=1 16 173 9.0E-12
sp|Q1I4J8|TRMA_PSEE4 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pseudomonas entomophila (strain L48) GN=trmA PE=3 SV=1 22 172 9.0E-12
sp|B0VCX5|TRMA_ACIBY tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Acinetobacter baumannii (strain AYE) GN=trmA PE=3 SV=1 16 173 9.0E-12
sp|Q7MAX6|TRMA_PHOLL tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=trmA PE=3 SV=1 24 174 9.0E-12
sp|Q5PEJ4|RLMD_SALPA 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rlmD PE=3 SV=1 20 172 1.0E-11
sp|B7VK72|RLMD_VIBTL 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Vibrio tasmaniensis (strain LGP32) GN=rlmD PE=3 SV=1 8 172 1.0E-11
sp|Q57KF9|RLMD_SALCH 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Salmonella choleraesuis (strain SC-B67) GN=rlmD PE=3 SV=1 20 172 1.0E-11
sp|B0BQ52|RLMC_ACTPJ 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rlmC PE=3 SV=1 21 170 1.0E-11
sp|B1J3Q4|TRMA_PSEPW tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pseudomonas putida (strain W619) GN=trmA PE=3 SV=1 22 172 1.0E-11
sp|A5EXH9|TRMA_DICNV tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Dichelobacter nodosus (strain VCS1703A) GN=trmA PE=3 SV=1 5 172 1.0E-11
sp|B5FAG4|RLMD_VIBFM 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Vibrio fischeri (strain MJ11) GN=rlmD PE=3 SV=1 22 172 1.0E-11
sp|Q8ZME1|RLMD_SALTY 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rlmD PE=3 SV=3 20 172 1.0E-11
sp|A5UDB0|RLMC_HAEIE 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Haemophilus influenzae (strain PittEE) GN=rlmC PE=3 SV=1 16 172 1.0E-11
sp|Q8Y035|RLMD_RALSO 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Ralstonia solanacearum (strain GMI1000) GN=rlmD PE=3 SV=1 22 172 1.0E-11
sp|B4F1H4|TRMA_PROMH tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Proteus mirabilis (strain HI4320) GN=trmA PE=3 SV=1 24 172 2.0E-11
sp|Q3BVV1|RLMD_XANC5 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rlmD PE=3 SV=2 22 172 2.0E-11
sp|Q086B4|RLMD_SHEFN 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella frigidimarina (strain NCIMB 400) GN=rlmD PE=3 SV=1 22 171 2.0E-11
sp|C5BC48|TRMA_EDWI9 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=trmA PE=3 SV=1 24 172 2.0E-11
sp|Q5P841|RLMD_AROAE 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Aromatoleum aromaticum (strain EbN1) GN=rlmD PE=3 SV=1 22 172 2.0E-11
sp|Q3SK67|RLMD_THIDA 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rlmD PE=3 SV=1 22 172 2.0E-11
sp|B8CJP2|RLMD_SHEPW 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rlmD PE=3 SV=1 17 171 2.0E-11
sp|Q0BKU7|RLMD_FRATO 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rlmD PE=3 SV=1 22 172 2.0E-11
sp|Q2A275|RLMD_FRATH 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rlmD PE=3 SV=1 22 172 2.0E-11
sp|Q5NGX1|RLMD_FRATT 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rlmD PE=3 SV=1 22 172 2.0E-11
sp|Q14IC3|RLMD_FRAT1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rlmD PE=3 SV=1 22 172 2.0E-11
sp|B0UVN9|TRMA_HISS2 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Histophilus somni (strain 2336) GN=trmA PE=3 SV=1 24 166 2.0E-11
sp|Q7NWP9|RLMD_CHRVO 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rlmD PE=3 SV=1 22 172 2.0E-11
sp|B0VKL3|RLMD_ACIBS 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Acinetobacter baumannii (strain SDF) GN=rlmD PE=3 SV=1 22 178 2.0E-11
sp|Q12PZ8|RLMD_SHEDO 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rlmD PE=3 SV=1 22 171 3.0E-11
sp|D0L1G3|RLMC_HALNC 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Halothiobacillus neapolitanus (strain ATCC 23641 / c2) GN=rlmC PE=3 SV=1 8 172 3.0E-11
sp|Q4FUU5|RLMD_PSYA2 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rlmD PE=3 SV=1 22 172 3.0E-11
sp|A1K524|TRMA_AZOSB tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Azoarcus sp. (strain BH72) GN=trmA PE=3 SV=1 24 173 3.0E-11
sp|Q12SP8|TRMA_SHEDO tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=trmA PE=3 SV=1 24 172 3.0E-11
sp|Q0I1I7|TRMA_HAES1 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Haemophilus somnus (strain 129Pt) GN=trmA PE=3 SV=2 24 166 3.0E-11
sp|A1SSB8|RLMD_PSYIN 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Psychromonas ingrahamii (strain 37) GN=rlmD PE=3 SV=1 22 169 3.0E-11
sp|A6WHQ8|TRMA_SHEB8 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella baltica (strain OS185) GN=trmA PE=3 SV=1 24 172 3.0E-11
sp|A4WG46|TRMA_ENT38 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Enterobacter sp. (strain 638) GN=trmA PE=3 SV=1 24 170 3.0E-11
sp|A4XQI3|TRMA_PSEMY tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pseudomonas mendocina (strain ymp) GN=trmA PE=3 SV=1 22 172 4.0E-11
sp|B3PL62|RLMD_CELJU 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Cellvibrio japonicus (strain Ueda107) GN=rlmD PE=3 SV=1 22 169 4.0E-11
sp|Q47HS4|RLMD_DECAR 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Dechloromonas aromatica (strain RCB) GN=rlmD PE=3 SV=1 22 171 4.0E-11
sp|A6Q2V7|TRMA_NITSB tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Nitratiruptor sp. (strain SB155-2) GN=trmA PE=3 SV=1 24 172 4.0E-11
sp|Q65VK8|RLMC_MANSM 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rlmC PE=3 SV=1 21 172 4.0E-11
sp|E4ZBM0|RLMD_NEIL0 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Neisseria lactamica (strain 020-06) GN=rlmD PE=3 SV=1 22 171 4.0E-11
sp|B3GXZ9|RLMC_ACTP7 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rlmC PE=3 SV=1 20 170 5.0E-11
sp|Q73JF6|Y2619_TREDE Uncharacterized RNA methyltransferase TDE_2619 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_2619 PE=3 SV=1 24 172 5.0E-11
sp|A5UDM6|TRMA_HAEIE tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Haemophilus influenzae (strain PittEE) GN=trmA PE=3 SV=1 24 172 6.0E-11
sp|Q087X5|RLMC_SHEFN 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Shewanella frigidimarina (strain NCIMB 400) GN=rlmC PE=3 SV=1 22 172 6.0E-11
sp|A8FSS4|RLMD_SHESH 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella sediminis (strain HAW-EB3) GN=rlmD PE=3 SV=1 22 171 6.0E-11
sp|Q8CX51|TRMA_SHEON tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella oneidensis (strain MR-1) GN=trmA PE=3 SV=1 24 173 7.0E-11
sp|B0TK00|RLMD_SHEHH 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella halifaxensis (strain HAW-EB4) GN=rlmD PE=3 SV=1 22 171 7.0E-11
sp|Q3ILM2|TRMA_PSEHT tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=trmA PE=3 SV=1 24 172 7.0E-11
sp|Q1H069|RLMD_METFK 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rlmD PE=3 SV=1 22 172 7.0E-11
sp|A7ML95|TRMA_CROS8 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=trmA PE=3 SV=2 24 172 7.0E-11
sp|Q6LLU2|TRMA_PHOPR tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Photobacterium profundum GN=trmA PE=3 SV=1 24 172 8.0E-11
sp|Q1QXW4|TRMA_CHRSD tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=trmA PE=3 SV=2 24 172 8.0E-11
sp|P31812|TRMA_HAEIN tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trmA PE=3 SV=2 24 166 9.0E-11
sp|Q4QM53|TRMA_HAEI8 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=trmA PE=3 SV=1 24 166 9.0E-11
sp|A3Q962|TRMA_SHELP tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=trmA PE=3 SV=1 24 172 9.0E-11
sp|A1SSL6|TRMA_PSYIN tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Psychromonas ingrahamii (strain 37) GN=trmA PE=3 SV=1 24 166 9.0E-11
sp|A6VKU5|RLMC_ACTSZ 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rlmC PE=3 SV=1 21 170 1.0E-10
sp|B2VGA5|TRMA_ERWT9 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=trmA PE=3 SV=1 24 172 1.0E-10
sp|Q3IDM6|RLMD_PSEHT 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rlmD PE=3 SV=1 22 172 1.0E-10
sp|Q6FBS0|TRMA_ACIAD tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=trmA PE=3 SV=1 24 171 1.0E-10
sp|Q15NK9|TRMA_PSEA6 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=trmA PE=3 SV=1 24 172 1.0E-10
sp|B5Z069|TRMA_ECO5E tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=trmA PE=3 SV=1 24 170 1.0E-10
sp|A4SHG2|TRMA_AERS4 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Aeromonas salmonicida (strain A449) GN=trmA PE=3 SV=1 24 172 1.0E-10
sp|C3LPZ5|TRMA_VIBCM tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=trmA PE=3 SV=1 5 172 1.0E-10
sp|Q9KVJ0|TRMA_VIBCH tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trmA PE=3 SV=1 5 172 1.0E-10
sp|A5F4M4|TRMA_VIBC3 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=trmA PE=3 SV=1 5 172 1.0E-10
sp|A5W926|TRMA_PSEP1 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=trmA PE=3 SV=1 22 172 1.0E-10
sp|Q7U326|TRMA_HELHP tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=trmA PE=3 SV=1 24 175 1.0E-10
sp|A6VLF9|TRMA_ACTSZ tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=trmA PE=3 SV=1 24 172 1.0E-10
sp|Q88E14|TRMA_PSEPK tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pseudomonas putida (strain KT2440) GN=trmA PE=3 SV=1 22 172 1.0E-10
sp|B0KHR5|TRMA_PSEPG tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pseudomonas putida (strain GB-1) GN=trmA PE=3 SV=1 22 172 1.0E-10
sp|C6C5A0|TRMA_DICDC tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Dickeya dadantii (strain Ech703) GN=trmA PE=3 SV=1 24 172 1.0E-10
sp|Q30RT5|TRMA_SULDN tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=trmA PE=3 SV=1 24 170 1.0E-10
sp|O54099|Y5901_STRCO Uncharacterized RNA methyltransferase SCO5901 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5901 PE=3 SV=1 22 171 2.0E-10
sp|A5CXB2|RLMD_VESOH 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rlmD PE=3 SV=1 22 170 2.0E-10
sp|Q8U2K7|ARLMC_PYRFU 23S rRNA (uracil(747)-C(5))-methyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0827 PE=3 SV=1 23 172 2.0E-10
sp|A6QBC0|TRMA_SULNB tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Sulfurovum sp. (strain NBC37-1) GN=trmA PE=3 SV=1 24 172 2.0E-10
sp|Q31JA4|TRMA_THICR tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=trmA PE=3 SV=1 13 172 2.0E-10
sp|A9KW82|TRMA_SHEB9 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella baltica (strain OS195) GN=trmA PE=3 SV=1 24 172 2.0E-10
sp|A3DA80|TRMA_SHEB5 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=trmA PE=3 SV=1 24 172 2.0E-10
sp|B8EBM5|TRMA_SHEB2 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella baltica (strain OS223) GN=trmA PE=3 SV=1 24 172 2.0E-10
sp|A6TGE9|TRMA_KLEP7 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=trmA PE=3 SV=1 24 172 2.0E-10
sp|O58994|ARLMC_PYRHO 23S rRNA (uracil(747)-C(5))-methyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1259 PE=3 SV=1 23 172 2.0E-10
sp|B7LUM8|TRMA_ESCF3 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=trmA PE=3 SV=1 24 165 2.0E-10
sp|Q93HB4|Y2389_STRAW Uncharacterized RNA methyltransferase SAV_2389 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_2389 PE=3 SV=1 22 171 2.0E-10
sp|B6I5I3|TRMA_ECOSE tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli (strain SE11) GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|P23003|TRMA_ECOLI tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli (strain K12) GN=trmA PE=1 SV=1 24 170 2.0E-10
sp|B1IVB3|TRMA_ECOLC tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|A8A773|TRMA_ECOHS tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|B1XBX6|TRMA_ECODH tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|C5A0R4|TRMA_ECOBW tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|C6UJK3|TRMA_ECOBR tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli (strain B / REL606) GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|C5WBK5|TRMA_ECOBD tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli (strain B / BL21-DE3) GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|B7M721|TRMA_ECO8A tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli O8 (strain IAI1) GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|B7LA67|TRMA_ECO55 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|A7ZUI5|TRMA_ECO24 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|B4RYR7|TRMA_ALTMD tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=trmA1 PE=3 SV=2 24 172 2.0E-10
sp|B4T0X5|TRMA_SALNS tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Salmonella newport (strain SL254) GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|B4RN45|TRMA_NEIG2 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=trmA PE=3 SV=1 24 172 2.0E-10
sp|Q5F757|TRMA_NEIG1 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=trmA PE=3 SV=1 24 172 2.0E-10
sp|A0KQR3|TRMA_AERHH tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=trmA PE=3 SV=1 24 172 2.0E-10
sp|Q32AE5|TRMA_SHIDS tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=trmA PE=3 SV=1 24 165 2.0E-10
sp|Q1R3U2|TRMA_ECOUT tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|Q8CXW3|TRMA_ECOL6 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|Q0TA91|TRMA_ECOL5 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|A1AIE7|TRMA_ECOK1 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli O1:K1 / APEC GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|B7MIA5|TRMA_ECO45 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=trmA PE=3 SV=1 24 170 2.0E-10
sp|B7UNU5|TRMA_ECO27 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=trmA PE=3 SV=1 24 170 3.0E-10
sp|Q820Z9|TRMA_SHIFL tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shigella flexneri GN=trmA PE=3 SV=1 24 165 3.0E-10
sp|Q31U23|TRMA_SHIBS tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=trmA PE=3 SV=1 24 165 3.0E-10
sp|Q48DT0|TRMA_PSE14 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=trmA PE=3 SV=1 22 172 3.0E-10
sp|B7MR93|TRMA_ECO81 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli O81 (strain ED1a) GN=trmA PE=3 SV=1 24 170 3.0E-10
sp|Q87WA0|TRMA_PSESM tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=trmA PE=3 SV=1 22 172 3.0E-10
sp|Q8X723|TRMA_ECO57 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli O157:H7 GN=trmA PE=3 SV=1 24 165 3.0E-10
sp|Q4ZNF5|TRMA_PSEU2 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=trmA PE=3 SV=1 22 172 3.0E-10
sp|C6DHQ1|TRMA_PECCP tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=trmA PE=3 SV=1 16 172 3.0E-10
sp|B7NU35|TRMA_ECO7I tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=trmA PE=3 SV=1 24 170 3.0E-10
sp|Q7MFU0|RLMC_VIBVY 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Vibrio vulnificus (strain YJ016) GN=rlmC PE=3 SV=2 23 172 3.0E-10
sp|Q7MQ79|TRMA_VIBVY tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Vibrio vulnificus (strain YJ016) GN=trmA PE=3 SV=1 24 172 3.0E-10
sp|Q8DD43|TRMA_VIBVU tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=trmA PE=3 SV=1 24 172 3.0E-10
sp|A4YB86|TRMA_SHEPC tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=trmA PE=3 SV=1 24 173 4.0E-10
sp|A1RP91|TRMA_SHESW tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella sp. (strain W3-18-1) GN=trmA PE=3 SV=1 24 172 4.0E-10
sp|A1WME3|RLMD_VEREI 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Verminephrobacter eiseniae (strain EF01-2) GN=rlmD PE=3 SV=1 22 172 4.0E-10
sp|Q9JT82|TRMA_NEIMA tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=trmA PE=3 SV=1 24 172 4.0E-10
sp|Q6CZB4|TRMA_PECAS tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=trmA PE=3 SV=1 16 172 4.0E-10
sp|B5XZ11|TRMA_KLEP3 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Klebsiella pneumoniae (strain 342) GN=trmA PE=3 SV=1 24 172 4.0E-10
sp|B1LNS5|TRMA_ECOSM tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=trmA PE=3 SV=1 24 170 4.0E-10
sp|B7NFR5|TRMA_ECOLU tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=trmA PE=3 SV=1 24 170 4.0E-10
sp|E1SSZ4|RLMD_FERBD 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Ferrimonas balearica (strain DSM 9799 / CCM 4581 / PAT) GN=rlmD PE=3 SV=1 25 171 4.0E-10
sp|B7VM88|TRMA_VIBTL tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=trmA PE=3 SV=1 8 172 4.0E-10
sp|Q2NQZ6|TRMA_SODGM tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Sodalis glossinidius (strain morsitans) GN=trmA PE=3 SV=1 24 172 5.0E-10
sp|B0TMV6|TRMA_SHEHH tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=trmA PE=3 SV=1 24 172 5.0E-10
sp|Q5X5A8|RLMD_LEGPA 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Legionella pneumophila (strain Paris) GN=rlmD PE=3 SV=1 22 172 5.0E-10
sp|Q5ZVI4|RLMD_LEGPH 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rlmD PE=3 SV=1 22 172 5.0E-10
sp|A5IBU7|RLMD_LEGPC 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Legionella pneumophila (strain Corby) GN=rlmD PE=3 SV=1 22 172 5.0E-10
sp|Q5R111|RLMD_IDILO 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rlmD PE=3 SV=1 26 172 6.0E-10
sp|B6ENT4|TRMA_ALISL tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=trmA PE=3 SV=1 24 172 6.0E-10
sp|Q0SY26|TRMA_SHIF8 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=trmA PE=3 SV=1 24 165 7.0E-10
sp|Q0I0C6|TRMA_SHESR tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella sp. (strain MR-7) GN=trmA PE=3 SV=1 24 172 7.0E-10
sp|Q5WW81|RLMD_LEGPL 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Legionella pneumophila (strain Lens) GN=rlmD PE=3 SV=1 22 172 7.0E-10
sp|C4L9A7|TRMA_TOLAT tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=trmA PE=3 SV=1 24 172 7.0E-10
sp|Q0HNV8|TRMA_SHESM tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella sp. (strain MR-4) GN=trmA PE=3 SV=1 24 172 7.0E-10
sp|P55136|RLMD_PHOAS 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Fragment) OS=Photobacterium angustum (strain S14 / CCUG 15956) GN=rlmD PE=3 SV=1 22 174 8.0E-10
sp|Q1QX18|RLMD_CHRSD 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rlmD PE=3 SV=1 22 191 8.0E-10
sp|A8GL74|TRMA_SERP5 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Serratia proteamaculans (strain 568) GN=trmA PE=3 SV=1 24 172 1.0E-09
sp|C1DLS8|TRMA_AZOVD tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=trmA PE=3 SV=1 22 172 1.0E-09
sp|C3K2F6|TRMA_PSEFS tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=trmA PE=3 SV=1 22 172 1.0E-09
sp|C6CG41|TRMA_DICZE tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Dickeya zeae (strain Ech1591) GN=trmA PE=3 SV=1 24 172 1.0E-09
sp|A0KRK4|TRMA_SHESA tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella sp. (strain ANA-3) GN=trmA PE=3 SV=1 24 172 1.0E-09
sp|Q9PP92|TRMA_CAMJE tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=trmA PE=3 SV=1 24 172 1.0E-09
sp|Q089S7|TRMA_SHEFN tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=trmA PE=3 SV=1 24 172 1.0E-09
sp|Q8FPI1|Y1797_COREF Uncharacterized RNA methyltransferase CE1797 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE1797 PE=3 SV=1 26 172 1.0E-09
sp|B5FCA6|TRMA_VIBFM tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Vibrio fischeri (strain MJ11) GN=trmA PE=3 SV=1 24 172 1.0E-09
sp|Q5E215|TRMA_VIBF1 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=trmA PE=3 SV=1 24 172 1.0E-09
sp|A8AKV5|TRMA_CITK8 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=trmA PE=3 SV=1 16 170 1.0E-09
sp|A7MXY6|TRMA_VIBCB tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=trmA PE=3 SV=1 24 172 1.0E-09
sp|B5BJN9|TRMA_SALPK tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=trmA PE=3 SV=1 24 170 1.0E-09
sp|Q5PK68|TRMA_SALPA tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=trmA PE=3 SV=1 24 170 1.0E-09
sp|A8GYV6|TRMA_SHEPA tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=trmA PE=3 SV=1 24 172 1.0E-09
sp|A9N0H5|TRMA_SALPB tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=trmA PE=3 SV=1 24 170 1.0E-09
sp|P22038|TRMA_SALTY tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trmA PE=2 SV=2 24 170 1.0E-09
sp|B5REZ3|TRMA_SALG2 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=trmA PE=3 SV=1 24 170 1.0E-09
sp|B5QXR0|TRMA_SALEP tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=trmA PE=3 SV=1 24 170 1.0E-09
sp|B5FPX9|TRMA_SALDC tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Salmonella dublin (strain CT_02021853) GN=trmA PE=3 SV=1 24 170 1.0E-09
sp|Q57H88|TRMA_SALCH tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=trmA PE=3 SV=1 24 170 1.0E-09
sp|Q8Z313|TRMA_SALTI tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Salmonella typhi GN=trmA PE=3 SV=1 24 170 2.0E-09
sp|B4TCR0|TRMA_SALHS tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Salmonella heidelberg (strain SL476) GN=trmA PE=3 SV=1 24 170 2.0E-09
sp|A9MHG7|TRMA_SALAR tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=trmA PE=3 SV=1 24 170 2.0E-09
sp|Q9JYA0|TRMA_NEIMB tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=trmA PE=3 SV=1 24 172 2.0E-09
sp|Q87KN8|TRMA_VIBPA tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trmA PE=3 SV=1 24 172 2.0E-09
sp|Q8D4B4|RLMC_VIBVU 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC OS=Vibrio vulnificus (strain CMCP6) GN=rlmC PE=3 SV=2 23 172 2.0E-09
sp|A1VZH5|TRMA_CAMJJ tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=trmA PE=3 SV=1 24 172 2.0E-09
sp|A8FLP0|TRMA_CAMJ8 tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=trmA PE=3 SV=1 24 172 2.0E-09
sp|Q5HUW5|TRMA_CAMJR tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Campylobacter jejuni (strain RM1221) GN=trmA PE=3 SV=1 24 172 2.0E-09
sp|A1VQF1|RLMD_POLNA 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Polaromonas naphthalenivorans (strain CJ2) GN=rlmD PE=3 SV=1 22 172 2.0E-09
sp|Q7M7T6|TRMA_WOLSU tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=trmA PE=3 SV=1 24 170 2.0E-09
sp|A8G1G7|TRMA_SHESH tRNA/tmRNA (uracil-C(5))-methyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=trmA PE=3 SV=1 24 172 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006396 RNA processing Yes
GO:0008173 RNA methyltransferase activity Yes
GO:0016070 RNA metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0008168 methyltransferase activity No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8127
LPVFTAYVAERIRPPAAAAAVDHLIDAYSGSGLFTVALAPLFRHSTGVDVSAASIASAGRNAALNGLGEDRCVFL
AADAARLFASVAYPPDRTAVVLDPPRKGCDAAFLAQLAAFAPRRLLYVSCNVHTQARDVGALVRGDHPGARYRLE
SIVGFDFFPQTGHVEAVAVLDRCDDDDDGAEAPSGERHSGGTCA*
Coding >Hirsu2|8127
CTGCCCGTCTTCACGGCCTACGTCGCCGAGCGCATCCGGCCTCCCGCCGCCGCCGCAGCCGTCGACCACCTGATC
GACGCCTACTCCGGCTCCGGCCTCTTCACCGTCGCGCTCGCGCCCCTCTTCCGCCACTCGACGGGCGTCGACGTC
TCGGCCGCGTCCATCGCCTCGGCCGGCCGCAACGCCGCGCTCAACGGCCTCGGCGAAGACCGCTGCGTCTTCCTC
GCCGCCGACGCCGCCCGCCTCTTCGCCAGCGTCGCCTACCCGCCCGACCGCACCGCCGTCGTCCTCGACCCGCCA
CGCAAGGGCTGCGACGCCGCCTTCCTCGCCCAGCTGGCCGCCTTCGCGCCCCGCCGCCTCCTCTACGTCAGCTGC
AACGTCCACACCCAGGCCCGCGACGTCGGCGCCCTCGTCCGCGGCGACCACCCCGGCGCCCGCTACCGCCTCGAG
AGCATCGTCGGCTTCGACTTCTTCCCCCAGACCGGCCACGTCGAGGCCGTCGCCGTGCTCGACAGGTGCGACGAC
GACGACGACGGCGCCGAGGCGCCGTCGGGAGAGCGACACAGTGGCGGAACTTGTGCATGA
Transcript >Hirsu2|8127
CTGCCCGTCTTCACGGCCTACGTCGCCGAGCGCATCCGGCCTCCCGCCGCCGCCGCAGCCGTCGACCACCTGATC
GACGCCTACTCCGGCTCCGGCCTCTTCACCGTCGCGCTCGCGCCCCTCTTCCGCCACTCGACGGGCGTCGACGTC
TCGGCCGCGTCCATCGCCTCGGCCGGCCGCAACGCCGCGCTCAACGGCCTCGGCGAAGACCGCTGCGTCTTCCTC
GCCGCCGACGCCGCCCGCCTCTTCGCCAGCGTCGCCTACCCGCCCGACCGCACCGCCGTCGTCCTCGACCCGCCA
CGCAAGGGCTGCGACGCCGCCTTCCTCGCCCAGCTGGCCGCCTTCGCGCCCCGCCGCCTCCTCTACGTCAGCTGC
AACGTCCACACCCAGGCCCGCGACGTCGGCGCCCTCGTCCGCGGCGACCACCCCGGCGCCCGCTACCGCCTCGAG
AGCATCGTCGGCTTCGACTTCTTCCCCCAGACCGGCCACGTCGAGGCCGTCGCCGTGCTCGACAGGTGCGACGAC
GACGACGACGGCGCCGAGGCGCCGTCGGGAGAGCGACACAGTGGCGGAACTTGTGCATGA
Gene >Hirsu2|8127
CTGCCCGTCTTCACGGCCTACGTCGCCGAGCGCATCCGGCCTCCCGCCGCCGCCGCAGCCGTCGACCACCTGATC
GACGCCTACTCCGGCTCCGGCCTCTTCACCGTCGCGCTCGCGCCCCTCTTCCGCCACTCGACGGGCGTCGACGTC
TCGGCCGCGTCCATCGCCTCGGCCGGCCGCAACGCCGCGCTCAACGGCCTCGGCGAAGACCGCTGCGTCTTCCTC
GCCGCCGACGCCGCCCGCCTCTTCGCCAGCGTCGCCTACCCGCCCGACCGCACCGCCGTCGTCCTCGACCCGCCA
CGCAAGGGCTGCGACGCCGCCTTCCTCGCCCAGCTGGCCGCCTTCGCGCCCCGCCGCCTCCTCTACGTCAGCTGC
AACGTCCACACCCAGGCCCGCGACGTCGGCGCCCTCGTCCGCGGCGACCACCCCGGCGCCCGCTACCGCCTCGAG
AGCATCGTCGGCTTCGACTTCTTCCCCCAGACCGGCCACGTCGAGGCCGTCGCCGTGCTCGACAGGTGCGACGAC
GACGACGACGGCGCCGAGGCGCCGTCGGGAGAGCGACACAGTGGCGGAACTTGTGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail