Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8121
Gene name
LocationContig_51:36258..36574
Strand+
Gene length (bp)316
Transcript length (bp)258
Coding sequence length (bp)258
Protein length (aa) 86

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00403 HMA Heavy-metal-associated domain 7.0E-15 9 65

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38636|ATX1_YEAST Metal homeostasis factor ATX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATX1 PE=1 SV=1 1 69 3.0E-20
sp|O74735|ATX1_SCHPO Metal homeostasis factor atx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atx1 PE=3 SV=1 7 69 2.0E-15
sp|Q94BT9|ATOX1_ARATH Copper transport protein ATX1 OS=Arabidopsis thaliana GN=ATX1 PE=1 SV=2 4 73 1.0E-11
sp|O82089|CCH_ARATH Copper transport protein CCH OS=Arabidopsis thaliana GN=CCH PE=1 SV=1 5 65 6.0E-11
sp|Q54PZ2|ATOX1_DICDI Copper transport protein ATOX1 homolog OS=Dictyostelium discoideum GN=atox1 PE=3 SV=2 6 65 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38636|ATX1_YEAST Metal homeostasis factor ATX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATX1 PE=1 SV=1 1 69 3.0E-20
sp|O74735|ATX1_SCHPO Metal homeostasis factor atx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atx1 PE=3 SV=1 7 69 2.0E-15
sp|Q94BT9|ATOX1_ARATH Copper transport protein ATX1 OS=Arabidopsis thaliana GN=ATX1 PE=1 SV=2 4 73 1.0E-11
sp|O82089|CCH_ARATH Copper transport protein CCH OS=Arabidopsis thaliana GN=CCH PE=1 SV=1 5 65 6.0E-11
sp|Q54PZ2|ATOX1_DICDI Copper transport protein ATOX1 homolog OS=Dictyostelium discoideum GN=atox1 PE=3 SV=2 6 65 1.0E-08
sp|Q9XT28|ATOX1_SHEEP Copper transport protein ATOX1 OS=Ovis aries GN=ATOX1 PE=3 SV=1 7 66 4.0E-08
sp|Q3T0E0|ATOX1_BOVIN Copper transport protein ATOX1 OS=Bos taurus GN=ATOX1 PE=3 SV=1 7 66 4.0E-08
sp|Q7XTY9|CCS_ORYSJ Copper chaperone for superoxide dismutase, chloroplastic OS=Oryza sativa subsp. japonica GN=CCS PE=2 SV=1 8 64 6.0E-08
sp|O00244|ATOX1_HUMAN Copper transport protein ATOX1 OS=Homo sapiens GN=ATOX1 PE=1 SV=1 7 67 7.0E-08
sp|Q9TT99|ATOX1_CANLF Copper transport protein ATOX1 OS=Canis lupus familiaris GN=ATOX1 PE=3 SV=1 7 66 2.0E-07
sp|Q9LD47|CCS_ARATH Copper chaperone for superoxide dismutase, chloroplastic/cytosolic OS=Arabidopsis thaliana GN=CCS PE=1 SV=1 8 85 1.0E-06
sp|Q9WUC4|ATOX1_RAT Copper transport protein ATOX1 OS=Rattus norvegicus GN=Atox1 PE=1 SV=1 7 66 2.0E-06
sp|Q6PWT7|CCS_PIG Copper chaperone for superoxide dismutase OS=Sus scrofa GN=CCS PE=2 SV=1 8 65 2.0E-06
sp|O08997|ATOX1_MOUSE Copper transport protein ATOX1 OS=Mus musculus GN=Atox1 PE=1 SV=1 7 66 4.0E-06
sp|Q9JK72|CCS_RAT Copper chaperone for superoxide dismutase OS=Rattus norvegicus GN=Ccs PE=1 SV=1 8 65 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0030001 metal ion transport Yes
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8121
MAETHTYEFNVAMSCGGCSGAIDRVLKKLEGVDSYEVSLEKQSARVVTALPYETVLEKIAKTGKKINSATADGVA
KSVEVPAAAA*
Coding >Hirsu2|8121
ATGGCCGAGACGCACACGTACGAGTTCAACGTCGCCATGTCGTGCGGCGGCTGCTCCGGCGCCATCGACCGCGTG
CTCAAGAAGCTCGAAGGCGTCGACAGCTACGAGGTGTCGCTGGAGAAGCAGAGCGCCCGGGTGGTGACGGCGCTG
CCGTACGAGACGGTGCTGGAGAAGATCGCCAAGACGGGCAAGAAGATCAACTCGGCCACGGCGGACGGCGTCGCC
AAGTCGGTCGAGGTGCCGGCCGCCGCCGCCTGA
Transcript >Hirsu2|8121
ATGGCCGAGACGCACACGTACGAGTTCAACGTCGCCATGTCGTGCGGCGGCTGCTCCGGCGCCATCGACCGCGTG
CTCAAGAAGCTCGAAGGCGTCGACAGCTACGAGGTGTCGCTGGAGAAGCAGAGCGCCCGGGTGGTGACGGCGCTG
CCGTACGAGACGGTGCTGGAGAAGATCGCCAAGACGGGCAAGAAGATCAACTCGGCCACGGCGGACGGCGTCGCC
AAGTCGGTCGAGGTGCCGGCCGCCGCCGCCTGA
Gene >Hirsu2|8121
ATGGCCGAGACGCACACGTACGAGTTCAACGTCGCCATGTCGTGCGGCGGCTGCTCCGGCGCCATCGACCGCGTG
CTCAAGAAGCTCGAAGGTTCGTCGTCCCGCCGCGACGGGCTTGCCTGTGCCGTGCTGACACCGTTGCCGCCCAGG
CGTCGACAGCTACGAGGTGTCGCTGGAGAAGCAGAGCGCCCGGGTGGTGACGGCGCTGCCGTACGAGACGGTGCT
GGAGAAGATCGCCAAGACGGGCAAGAAGATCAACTCGGCCACGGCGGACGGCGTCGCCAAGTCGGTCGAGGTGCC
GGCCGCCGCCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail