Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8119
Gene name
LocationContig_51:32210..33617
Strand+
Gene length (bp)1407
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00108 Thiolase_N Thiolase, N-terminal domain 1.8E-13 17 239
PF02803 Thiolase_C Thiolase, C-terminal domain 9.7E-10 283 383

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07598|NLTP_CHICK Non-specific lipid-transfer protein (Fragment) OS=Gallus gallus GN=SCP2 PE=2 SV=1 17 405 2.0E-149
sp|O62742|NLTP_RABIT Non-specific lipid-transfer protein OS=Oryctolagus cuniculus GN=SCP2 PE=1 SV=1 17 406 5.0E-147
sp|P11915|NLTP_RAT Non-specific lipid-transfer protein OS=Rattus norvegicus GN=Scp2 PE=1 SV=3 17 406 3.0E-146
sp|P32020|NLTP_MOUSE Non-specific lipid-transfer protein OS=Mus musculus GN=Scp2 PE=1 SV=3 17 406 2.0E-144
sp|P07857|NLTP_BOVIN Non-specific lipid-transfer protein OS=Bos taurus GN=SCP2 PE=1 SV=2 17 406 5.0E-143
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07598|NLTP_CHICK Non-specific lipid-transfer protein (Fragment) OS=Gallus gallus GN=SCP2 PE=2 SV=1 17 405 2.0E-149
sp|O62742|NLTP_RABIT Non-specific lipid-transfer protein OS=Oryctolagus cuniculus GN=SCP2 PE=1 SV=1 17 406 5.0E-147
sp|P11915|NLTP_RAT Non-specific lipid-transfer protein OS=Rattus norvegicus GN=Scp2 PE=1 SV=3 17 406 3.0E-146
sp|P32020|NLTP_MOUSE Non-specific lipid-transfer protein OS=Mus musculus GN=Scp2 PE=1 SV=3 17 406 2.0E-144
sp|P07857|NLTP_BOVIN Non-specific lipid-transfer protein OS=Bos taurus GN=SCP2 PE=1 SV=2 17 406 5.0E-143
sp|P22307|NLTP_HUMAN Non-specific lipid-transfer protein OS=Homo sapiens GN=SCP2 PE=1 SV=2 17 406 3.0E-142
sp|G5EDP2|NLTP2_CAEEL Non-specific lipid-transfer protein-like 2 OS=Caenorhabditis elegans GN=daf-22 PE=1 SV=1 14 406 1.0E-122
sp|O26884|Y793_METTH Uncharacterized protein MTH_793 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_793 PE=4 SV=1 17 407 2.0E-48
sp|Q58944|Y1549_METJA Uncharacterized protein MJ1549 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1549 PE=4 SV=1 17 375 2.0E-39
sp|Q43935|CATF_ACIAD Beta-ketoadipyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=catF PE=3 SV=1 83 363 2.0E-06
sp|B0VE46|FADA_ACIBY 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AYE) GN=fadA PE=3 SV=1 90 363 5.0E-06
sp|B0VLX5|FADA_ACIBS 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain SDF) GN=fadA PE=3 SV=1 90 363 5.0E-06
sp|B2I2J8|FADA_ACIBC 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain ACICU) GN=fadA PE=3 SV=1 90 363 5.0E-06
sp|B7I3P0|FADA_ACIB5 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AB0057) GN=fadA PE=3 SV=1 90 363 5.0E-06
sp|B7H1I1|FADA_ACIB3 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AB307-0294) GN=fadA PE=3 SV=1 90 363 5.0E-06
sp|A3M1H9|FADA_ACIBT 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=fadA PE=3 SV=2 90 363 6.0E-06
sp|A8F2R3|FABH_RICM5 3-oxoacyl-[acyl-carrier-protein] synthase 3 OS=Rickettsia massiliae (strain Mtu5) GN=fabH PE=3 SV=1 32 124 6.0E-06
sp|Q43974|PCAF_ACIAD Beta-ketoadipyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaF PE=1 SV=1 83 363 7.0E-06
sp|Q6FF69|FADA_ACIAD 3-ketoacyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=fadA PE=3 SV=1 90 363 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016746 acyltransferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.4835 0.2029 0.1207 0.0299 0.3922 0.0744 0.1914 0.0763 0.1047 0.6068

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4033
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|650
Ophiocordyceps australis map64 (Brazil) OphauB2|1181
Ophiocordyceps camponoti-floridani Ophcf2|06751
Ophiocordyceps camponoti-rufipedis Ophun1|593
Ophiocordyceps kimflemingae Ophio5|8070
Ophiocordyceps subramaniannii Hirsu2|8119 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8119
MASADSSGGGRKAKEPVYVLGVGMTKFIKPRGKVDYTELGFEAGVKALLDAGINYDEVEQGVACYCYGDSTCGQR
VFYQFGMTKIPIYNVNNNCSTGSTGLAMARSLVGAGAADCVLVVGFEKMMRGSLQSFFTDRENPTGTTVAMMAET
RGIESAPGAAQMFGNAGREYMERYGAAADDFAEIARVNHAHSPNNPYSQFQQVYSLDQIKAAPVIFAPLTKLQCC
PTSDGGAAAVVVSRRFLDARPHLWARAVEVAGQCLATDAPSLFSRSAIDLMGYEMTQHAVRVALAEAGLASAADD
VQVVELHDCFSANQMVAMDALGLCARGKAHELVRRGDLTYGGRFLINPSGGLISKGHPLGATGIAQCAELVWHLR
GWANNRAVPGTRHCLQHNLGLGGAVVVTVYRRPDRAAAPVVDDDAVGRANGLGYNPAVEARGFTPEQATSVRSKS
ATSAWALQDTQEKVQARF*
Coding >Hirsu2|8119
ATGGCATCGGCGGACAGCAGCGGTGGGGGCCGGAAAGCAAAGGAGCCGGTGTACGTGCTGGGCGTGGGCATGACC
AAGTTCATCAAGCCGCGCGGCAAGGTTGACTACACCGAACTCGGCTTCGAGGCCGGCGTCAAGGCGCTGCTGGAC
GCGGGCATCAACTACGACGAGGTGGAGCAGGGCGTGGCGTGCTACTGCTACGGCGACAGCACGTGCGGCCAGCGC
GTCTTCTACCAGTTCGGCATGACCAAGATCCCCATCTACAACGTCAACAACAACTGCTCGACCGGCAGCACGGGG
CTGGCGATGGCGCGGTCGCTGGTGGGCGCGGGCGCGGCCGACTGCGTCCTGGTCGTCGGCTTCGAGAAGATGATG
CGCGGCAGCCTGCAGAGCTTCTTCACCGACCGCGAGAACCCGACGGGGACGACGGTGGCCATGATGGCCGAGACG
CGCGGCATCGAGAGCGCGCCCGGCGCCGCCCAGATGTTCGGCAACGCCGGCCGCGAGTACATGGAGCGCTACGGC
GCCGCGGCCGACGACTTCGCCGAGATCGCGCGCGTCAACCACGCCCACTCGCCCAACAACCCCTACTCGCAGTTC
CAGCAGGTCTACTCGCTCGACCAGATCAAGGCCGCGCCCGTCATCTTCGCCCCGCTGACCAAGCTGCAGTGCTGC
CCGACGTCGGACGGCGGCGCCGCCGCCGTCGTCGTCTCGCGCCGCTTCCTCGACGCCCGCCCGCACCTGTGGGCC
CGCGCCGTCGAGGTGGCCGGCCAGTGCCTGGCCACCGACGCGCCCAGCCTCTTCTCCCGCAGCGCCATCGACCTG
ATGGGCTACGAGATGACGCAGCACGCCGTCCGCGTCGCCCTGGCCGAGGCCGGCCTCGCCTCCGCCGCCGACGAC
GTCCAGGTCGTCGAGCTCCACGACTGCTTCAGCGCCAACCAGATGGTCGCCATGGACGCCCTCGGCCTGTGCGCC
CGCGGCAAGGCCCACGAGCTCGTCCGCCGCGGCGACCTGACCTACGGCGGCCGCTTCCTCATCAACCCCTCCGGC
GGCCTCATCTCCAAGGGCCACCCGCTCGGCGCCACCGGCATCGCCCAGTGCGCCGAGCTGGTCTGGCACCTGCGC
GGCTGGGCCAACAACCGCGCCGTGCCCGGCACCCGCCACTGCCTGCAGCACAACCTGGGCTTGGGCGGCGCCGTC
GTCGTCACCGTCTACCGCCGCCCGGACCGCGCCGCCGCCCCCGTCGTCGACGACGACGCCGTCGGCCGCGCCAAC
GGCCTCGGCTACAACCCGGCCGTCGAGGCCCGCGGCTTCACCCCGGAACAGGCCACCTCCGTCCGCAGCAAGAGC
GCCACCAGCGCCTGGGCCCTGCAAGACACTCAGGAAAAGGTCCAGGCCCGCTTCTGA
Transcript >Hirsu2|8119
ATGGCATCGGCGGACAGCAGCGGTGGGGGCCGGAAAGCAAAGGAGCCGGTGTACGTGCTGGGCGTGGGCATGACC
AAGTTCATCAAGCCGCGCGGCAAGGTTGACTACACCGAACTCGGCTTCGAGGCCGGCGTCAAGGCGCTGCTGGAC
GCGGGCATCAACTACGACGAGGTGGAGCAGGGCGTGGCGTGCTACTGCTACGGCGACAGCACGTGCGGCCAGCGC
GTCTTCTACCAGTTCGGCATGACCAAGATCCCCATCTACAACGTCAACAACAACTGCTCGACCGGCAGCACGGGG
CTGGCGATGGCGCGGTCGCTGGTGGGCGCGGGCGCGGCCGACTGCGTCCTGGTCGTCGGCTTCGAGAAGATGATG
CGCGGCAGCCTGCAGAGCTTCTTCACCGACCGCGAGAACCCGACGGGGACGACGGTGGCCATGATGGCCGAGACG
CGCGGCATCGAGAGCGCGCCCGGCGCCGCCCAGATGTTCGGCAACGCCGGCCGCGAGTACATGGAGCGCTACGGC
GCCGCGGCCGACGACTTCGCCGAGATCGCGCGCGTCAACCACGCCCACTCGCCCAACAACCCCTACTCGCAGTTC
CAGCAGGTCTACTCGCTCGACCAGATCAAGGCCGCGCCCGTCATCTTCGCCCCGCTGACCAAGCTGCAGTGCTGC
CCGACGTCGGACGGCGGCGCCGCCGCCGTCGTCGTCTCGCGCCGCTTCCTCGACGCCCGCCCGCACCTGTGGGCC
CGCGCCGTCGAGGTGGCCGGCCAGTGCCTGGCCACCGACGCGCCCAGCCTCTTCTCCCGCAGCGCCATCGACCTG
ATGGGCTACGAGATGACGCAGCACGCCGTCCGCGTCGCCCTGGCCGAGGCCGGCCTCGCCTCCGCCGCCGACGAC
GTCCAGGTCGTCGAGCTCCACGACTGCTTCAGCGCCAACCAGATGGTCGCCATGGACGCCCTCGGCCTGTGCGCC
CGCGGCAAGGCCCACGAGCTCGTCCGCCGCGGCGACCTGACCTACGGCGGCCGCTTCCTCATCAACCCCTCCGGC
GGCCTCATCTCCAAGGGCCACCCGCTCGGCGCCACCGGCATCGCCCAGTGCGCCGAGCTGGTCTGGCACCTGCGC
GGCTGGGCCAACAACCGCGCCGTGCCCGGCACCCGCCACTGCCTGCAGCACAACCTGGGCTTGGGCGGCGCCGTC
GTCGTCACCGTCTACCGCCGCCCGGACCGCGCCGCCGCCCCCGTCGTCGACGACGACGCCGTCGGCCGCGCCAAC
GGCCTCGGCTACAACCCGGCCGTCGAGGCCCGCGGCTTCACCCCGGAACAGGCCACCTCCGTCCGCAGCAAGAGC
GCCACCAGCGCCTGGGCCCTGCAAGACACTCAGGAAAAGGTCCAGGCCCGCTTCTGA
Gene >Hirsu2|8119
ATGGCATCGGCGGACAGCAGCGGTGGGGGCCGGAAAGCAAAGGAGCCGGTGTACGTGCTGGGCGTGGGCATGACC
AAGTTCATCAAGCCGCGCGGCAAGGTTGACTACACCGAACTCGGCTTCGAGGCCGGCGTCAAGGCGCTGCTGGAC
GCGGGCATCAACTACGACGAGGTGGAGCAGGGCGTGGCGTGCTACTGCTACGGCGACAGCACGTGCGGCCAGCGC
GTCTTCTACCAGTTCGGCATGACCAAGATCCCCATCTACAACGTCAACAACAACTGCTCGACCGGCAGCACGGGG
CTGGCGATGGCGCGGTCGCTGGTGGGCGCGGGCGCGGCCGACTGCGTCCTGGTCGTCGGCTTCGAGAAGATGATG
CGCGGCAGCCTGCAGAGCTTCTTCACCGACCGCGAGAACCCGACGGGGACGACGGTGGCCATGATGGCCGAGACG
CGCGGCATCGAGAGCGCGCCCGGCGCCGCCCAGATGTTCGGCAACGCCGGCCGCGAGTACATGGAGCGCTACGGC
GCCGCGGCCGACGACTTCGCCGAGATCGCGCGCGTCAACCACGCCCACTCGCCCAACAACCCCTACTCGCAGTTC
CAGCAGGTCTACTCGCTCGACCAGATCAAGGCCGCGCCCGTCATCTTCGCCCCGCTGACCAAGCTGCAGTGCTGC
CCGACGTCGGACGGCGGCGCCGCCGCCGTCGTCGTCTCGCGCCGCTTCCTCGACGCCCGCCCGCACCTGTGGGCC
CGCGCCGTCGAGGTGGCCGGCCAGTGCCTGGCCACCGACGCGCCCAGCCTCTTCTCCCGCAGCGCCATCGACCTG
ATGGGCTACGAGATGACGCAGCACGCCGTCCGCGTCGCCCTGGCCGAGGCCGGCCTCGCCTCCGCCGCCGACGAC
GTCCAGGTCGTCGAGCTCCACGACTGCTTCAGCGCCAACCAGATGGTCGCCATGGACGCCCTCGGCCTGTGCGCC
CGCGGCAAGGCCCACGAGCTCGTCCGCCGCGGCGACCTGACCTACGGCGGCCGCTTCCTCATCAACCCCTCCGGC
GGCCTCATCTCCAAGGGCCACCCGCTCGGCGCCACCGGCATCGCCCAGTGCGCCGAGCTGGTCTGGCACCTGCGC
GGCTGGGCCAACAACCGCGCCGTGCCCGGCACCCGCCACTGCCTGCAGCACAACCTGGGCTTGGGCGGCGCCGTC
GTCGTCACCGTCTACCGCCGCCCGGACCGCGCCGCCGCCCCCGTCGTCGACGACGACGCCGTCGGCCGCGCCAAC
GGCCTCGGCTACAACCCGGCCGTCGAGGCCCGCGGCTTCACCCCGGAACAGGCCACCTCCGTCCGCAGCAAGAGC
GCCACCAGCGCCTGGGCCCTGCAAGACACTCAGGAAAAGGTCCAGGCCCGCTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail