Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8119
Gene name
LocationContig_51:32210..33617
Strand+
Gene length (bp)1407
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00108 Thiolase_N Thiolase, N-terminal domain 1.8E-13 17 239
PF02803 Thiolase_C Thiolase, C-terminal domain 9.7E-10 283 383

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07598|NLTP_CHICK Non-specific lipid-transfer protein (Fragment) OS=Gallus gallus GN=SCP2 PE=2 SV=1 17 405 2.0E-149
sp|O62742|NLTP_RABIT Non-specific lipid-transfer protein OS=Oryctolagus cuniculus GN=SCP2 PE=1 SV=1 17 406 5.0E-147
sp|P11915|NLTP_RAT Non-specific lipid-transfer protein OS=Rattus norvegicus GN=Scp2 PE=1 SV=3 17 406 3.0E-146
sp|P32020|NLTP_MOUSE Non-specific lipid-transfer protein OS=Mus musculus GN=Scp2 PE=1 SV=3 17 406 2.0E-144
sp|P07857|NLTP_BOVIN Non-specific lipid-transfer protein OS=Bos taurus GN=SCP2 PE=1 SV=2 17 406 5.0E-143
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07598|NLTP_CHICK Non-specific lipid-transfer protein (Fragment) OS=Gallus gallus GN=SCP2 PE=2 SV=1 17 405 2.0E-149
sp|O62742|NLTP_RABIT Non-specific lipid-transfer protein OS=Oryctolagus cuniculus GN=SCP2 PE=1 SV=1 17 406 5.0E-147
sp|P11915|NLTP_RAT Non-specific lipid-transfer protein OS=Rattus norvegicus GN=Scp2 PE=1 SV=3 17 406 3.0E-146
sp|P32020|NLTP_MOUSE Non-specific lipid-transfer protein OS=Mus musculus GN=Scp2 PE=1 SV=3 17 406 2.0E-144
sp|P07857|NLTP_BOVIN Non-specific lipid-transfer protein OS=Bos taurus GN=SCP2 PE=1 SV=2 17 406 5.0E-143
sp|P22307|NLTP_HUMAN Non-specific lipid-transfer protein OS=Homo sapiens GN=SCP2 PE=1 SV=2 17 406 3.0E-142
sp|G5EDP2|NLTP2_CAEEL Non-specific lipid-transfer protein-like 2 OS=Caenorhabditis elegans GN=daf-22 PE=1 SV=1 14 406 1.0E-122
sp|O26884|Y793_METTH Uncharacterized protein MTH_793 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_793 PE=4 SV=1 17 407 2.0E-48
sp|Q58944|Y1549_METJA Uncharacterized protein MJ1549 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1549 PE=4 SV=1 17 375 2.0E-39
sp|Q43935|CATF_ACIAD Beta-ketoadipyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=catF PE=3 SV=1 83 363 2.0E-06
sp|B0VE46|FADA_ACIBY 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AYE) GN=fadA PE=3 SV=1 90 363 5.0E-06
sp|B0VLX5|FADA_ACIBS 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain SDF) GN=fadA PE=3 SV=1 90 363 5.0E-06
sp|B2I2J8|FADA_ACIBC 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain ACICU) GN=fadA PE=3 SV=1 90 363 5.0E-06
sp|B7I3P0|FADA_ACIB5 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AB0057) GN=fadA PE=3 SV=1 90 363 5.0E-06
sp|B7H1I1|FADA_ACIB3 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AB307-0294) GN=fadA PE=3 SV=1 90 363 5.0E-06
sp|A3M1H9|FADA_ACIBT 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=fadA PE=3 SV=2 90 363 6.0E-06
sp|A8F2R3|FABH_RICM5 3-oxoacyl-[acyl-carrier-protein] synthase 3 OS=Rickettsia massiliae (strain Mtu5) GN=fabH PE=3 SV=1 32 124 6.0E-06
sp|Q43974|PCAF_ACIAD Beta-ketoadipyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaF PE=1 SV=1 83 363 7.0E-06
sp|Q6FF69|FADA_ACIAD 3-ketoacyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=fadA PE=3 SV=1 90 363 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016746 acyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8119
MASADSSGGGRKAKEPVYVLGVGMTKFIKPRGKVDYTELGFEAGVKALLDAGINYDEVEQGVACYCYGDSTCGQR
VFYQFGMTKIPIYNVNNNCSTGSTGLAMARSLVGAGAADCVLVVGFEKMMRGSLQSFFTDRENPTGTTVAMMAET
RGIESAPGAAQMFGNAGREYMERYGAAADDFAEIARVNHAHSPNNPYSQFQQVYSLDQIKAAPVIFAPLTKLQCC
PTSDGGAAAVVVSRRFLDARPHLWARAVEVAGQCLATDAPSLFSRSAIDLMGYEMTQHAVRVALAEAGLASAADD
VQVVELHDCFSANQMVAMDALGLCARGKAHELVRRGDLTYGGRFLINPSGGLISKGHPLGATGIAQCAELVWHLR
GWANNRAVPGTRHCLQHNLGLGGAVVVTVYRRPDRAAAPVVDDDAVGRANGLGYNPAVEARGFTPEQATSVRSKS
ATSAWALQDTQEKVQARF*
Coding >Hirsu2|8119
ATGGCATCGGCGGACAGCAGCGGTGGGGGCCGGAAAGCAAAGGAGCCGGTGTACGTGCTGGGCGTGGGCATGACC
AAGTTCATCAAGCCGCGCGGCAAGGTTGACTACACCGAACTCGGCTTCGAGGCCGGCGTCAAGGCGCTGCTGGAC
GCGGGCATCAACTACGACGAGGTGGAGCAGGGCGTGGCGTGCTACTGCTACGGCGACAGCACGTGCGGCCAGCGC
GTCTTCTACCAGTTCGGCATGACCAAGATCCCCATCTACAACGTCAACAACAACTGCTCGACCGGCAGCACGGGG
CTGGCGATGGCGCGGTCGCTGGTGGGCGCGGGCGCGGCCGACTGCGTCCTGGTCGTCGGCTTCGAGAAGATGATG
CGCGGCAGCCTGCAGAGCTTCTTCACCGACCGCGAGAACCCGACGGGGACGACGGTGGCCATGATGGCCGAGACG
CGCGGCATCGAGAGCGCGCCCGGCGCCGCCCAGATGTTCGGCAACGCCGGCCGCGAGTACATGGAGCGCTACGGC
GCCGCGGCCGACGACTTCGCCGAGATCGCGCGCGTCAACCACGCCCACTCGCCCAACAACCCCTACTCGCAGTTC
CAGCAGGTCTACTCGCTCGACCAGATCAAGGCCGCGCCCGTCATCTTCGCCCCGCTGACCAAGCTGCAGTGCTGC
CCGACGTCGGACGGCGGCGCCGCCGCCGTCGTCGTCTCGCGCCGCTTCCTCGACGCCCGCCCGCACCTGTGGGCC
CGCGCCGTCGAGGTGGCCGGCCAGTGCCTGGCCACCGACGCGCCCAGCCTCTTCTCCCGCAGCGCCATCGACCTG
ATGGGCTACGAGATGACGCAGCACGCCGTCCGCGTCGCCCTGGCCGAGGCCGGCCTCGCCTCCGCCGCCGACGAC
GTCCAGGTCGTCGAGCTCCACGACTGCTTCAGCGCCAACCAGATGGTCGCCATGGACGCCCTCGGCCTGTGCGCC
CGCGGCAAGGCCCACGAGCTCGTCCGCCGCGGCGACCTGACCTACGGCGGCCGCTTCCTCATCAACCCCTCCGGC
GGCCTCATCTCCAAGGGCCACCCGCTCGGCGCCACCGGCATCGCCCAGTGCGCCGAGCTGGTCTGGCACCTGCGC
GGCTGGGCCAACAACCGCGCCGTGCCCGGCACCCGCCACTGCCTGCAGCACAACCTGGGCTTGGGCGGCGCCGTC
GTCGTCACCGTCTACCGCCGCCCGGACCGCGCCGCCGCCCCCGTCGTCGACGACGACGCCGTCGGCCGCGCCAAC
GGCCTCGGCTACAACCCGGCCGTCGAGGCCCGCGGCTTCACCCCGGAACAGGCCACCTCCGTCCGCAGCAAGAGC
GCCACCAGCGCCTGGGCCCTGCAAGACACTCAGGAAAAGGTCCAGGCCCGCTTCTGA
Transcript >Hirsu2|8119
ATGGCATCGGCGGACAGCAGCGGTGGGGGCCGGAAAGCAAAGGAGCCGGTGTACGTGCTGGGCGTGGGCATGACC
AAGTTCATCAAGCCGCGCGGCAAGGTTGACTACACCGAACTCGGCTTCGAGGCCGGCGTCAAGGCGCTGCTGGAC
GCGGGCATCAACTACGACGAGGTGGAGCAGGGCGTGGCGTGCTACTGCTACGGCGACAGCACGTGCGGCCAGCGC
GTCTTCTACCAGTTCGGCATGACCAAGATCCCCATCTACAACGTCAACAACAACTGCTCGACCGGCAGCACGGGG
CTGGCGATGGCGCGGTCGCTGGTGGGCGCGGGCGCGGCCGACTGCGTCCTGGTCGTCGGCTTCGAGAAGATGATG
CGCGGCAGCCTGCAGAGCTTCTTCACCGACCGCGAGAACCCGACGGGGACGACGGTGGCCATGATGGCCGAGACG
CGCGGCATCGAGAGCGCGCCCGGCGCCGCCCAGATGTTCGGCAACGCCGGCCGCGAGTACATGGAGCGCTACGGC
GCCGCGGCCGACGACTTCGCCGAGATCGCGCGCGTCAACCACGCCCACTCGCCCAACAACCCCTACTCGCAGTTC
CAGCAGGTCTACTCGCTCGACCAGATCAAGGCCGCGCCCGTCATCTTCGCCCCGCTGACCAAGCTGCAGTGCTGC
CCGACGTCGGACGGCGGCGCCGCCGCCGTCGTCGTCTCGCGCCGCTTCCTCGACGCCCGCCCGCACCTGTGGGCC
CGCGCCGTCGAGGTGGCCGGCCAGTGCCTGGCCACCGACGCGCCCAGCCTCTTCTCCCGCAGCGCCATCGACCTG
ATGGGCTACGAGATGACGCAGCACGCCGTCCGCGTCGCCCTGGCCGAGGCCGGCCTCGCCTCCGCCGCCGACGAC
GTCCAGGTCGTCGAGCTCCACGACTGCTTCAGCGCCAACCAGATGGTCGCCATGGACGCCCTCGGCCTGTGCGCC
CGCGGCAAGGCCCACGAGCTCGTCCGCCGCGGCGACCTGACCTACGGCGGCCGCTTCCTCATCAACCCCTCCGGC
GGCCTCATCTCCAAGGGCCACCCGCTCGGCGCCACCGGCATCGCCCAGTGCGCCGAGCTGGTCTGGCACCTGCGC
GGCTGGGCCAACAACCGCGCCGTGCCCGGCACCCGCCACTGCCTGCAGCACAACCTGGGCTTGGGCGGCGCCGTC
GTCGTCACCGTCTACCGCCGCCCGGACCGCGCCGCCGCCCCCGTCGTCGACGACGACGCCGTCGGCCGCGCCAAC
GGCCTCGGCTACAACCCGGCCGTCGAGGCCCGCGGCTTCACCCCGGAACAGGCCACCTCCGTCCGCAGCAAGAGC
GCCACCAGCGCCTGGGCCCTGCAAGACACTCAGGAAAAGGTCCAGGCCCGCTTCTGA
Gene >Hirsu2|8119
ATGGCATCGGCGGACAGCAGCGGTGGGGGCCGGAAAGCAAAGGAGCCGGTGTACGTGCTGGGCGTGGGCATGACC
AAGTTCATCAAGCCGCGCGGCAAGGTTGACTACACCGAACTCGGCTTCGAGGCCGGCGTCAAGGCGCTGCTGGAC
GCGGGCATCAACTACGACGAGGTGGAGCAGGGCGTGGCGTGCTACTGCTACGGCGACAGCACGTGCGGCCAGCGC
GTCTTCTACCAGTTCGGCATGACCAAGATCCCCATCTACAACGTCAACAACAACTGCTCGACCGGCAGCACGGGG
CTGGCGATGGCGCGGTCGCTGGTGGGCGCGGGCGCGGCCGACTGCGTCCTGGTCGTCGGCTTCGAGAAGATGATG
CGCGGCAGCCTGCAGAGCTTCTTCACCGACCGCGAGAACCCGACGGGGACGACGGTGGCCATGATGGCCGAGACG
CGCGGCATCGAGAGCGCGCCCGGCGCCGCCCAGATGTTCGGCAACGCCGGCCGCGAGTACATGGAGCGCTACGGC
GCCGCGGCCGACGACTTCGCCGAGATCGCGCGCGTCAACCACGCCCACTCGCCCAACAACCCCTACTCGCAGTTC
CAGCAGGTCTACTCGCTCGACCAGATCAAGGCCGCGCCCGTCATCTTCGCCCCGCTGACCAAGCTGCAGTGCTGC
CCGACGTCGGACGGCGGCGCCGCCGCCGTCGTCGTCTCGCGCCGCTTCCTCGACGCCCGCCCGCACCTGTGGGCC
CGCGCCGTCGAGGTGGCCGGCCAGTGCCTGGCCACCGACGCGCCCAGCCTCTTCTCCCGCAGCGCCATCGACCTG
ATGGGCTACGAGATGACGCAGCACGCCGTCCGCGTCGCCCTGGCCGAGGCCGGCCTCGCCTCCGCCGCCGACGAC
GTCCAGGTCGTCGAGCTCCACGACTGCTTCAGCGCCAACCAGATGGTCGCCATGGACGCCCTCGGCCTGTGCGCC
CGCGGCAAGGCCCACGAGCTCGTCCGCCGCGGCGACCTGACCTACGGCGGCCGCTTCCTCATCAACCCCTCCGGC
GGCCTCATCTCCAAGGGCCACCCGCTCGGCGCCACCGGCATCGCCCAGTGCGCCGAGCTGGTCTGGCACCTGCGC
GGCTGGGCCAACAACCGCGCCGTGCCCGGCACCCGCCACTGCCTGCAGCACAACCTGGGCTTGGGCGGCGCCGTC
GTCGTCACCGTCTACCGCCGCCCGGACCGCGCCGCCGCCCCCGTCGTCGACGACGACGCCGTCGGCCGCGCCAAC
GGCCTCGGCTACAACCCGGCCGTCGAGGCCCGCGGCTTCACCCCGGAACAGGCCACCTCCGTCCGCAGCAAGAGC
GCCACCAGCGCCTGGGCCCTGCAAGACACTCAGGAAAAGGTCCAGGCCCGCTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail