Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8116
Gene name
LocationContig_51:23931..24998
Strand+
Gene length (bp)1067
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 2.2E-15 49 137
PF13649 Methyltransf_25 Methyltransferase domain 2.2E-07 272 337
PF08241 Methyltransf_11 Methyltransferase domain 1.4E-12 50 141
PF08241 Methyltransf_11 Methyltransferase domain 3.5E-07 273 337
PF13489 Methyltransf_23 Methyltransferase domain 1.8E-15 31 157
PF13847 Methyltransf_31 Methyltransferase domain 1.5E-09 46 160
PF08242 Methyltransf_12 Methyltransferase domain 4.0E-08 50 139
PF02353 CMAS Mycolic acid cyclopropane synthetase 1.1E-04 48 166
PF05401 NodS Nodulation protein S (NodS) 2.0E-05 46 143

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B8ISV4|TAM_METNO Trans-aconitate 2-methyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=tam PE=3 SV=1 47 154 7.0E-07
sp|B0UPF4|TAM_METS4 Trans-aconitate 2-methyltransferase OS=Methylobacterium sp. (strain 4-46) GN=tam PE=3 SV=1 47 154 8.0E-07

GO

GO Term Description Terminal node
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Yes
GO:0009877 nodulation Yes
GO:0009312 oligosaccharide biosynthetic process Yes
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0044419 interspecies interaction between organisms No
GO:0005975 carbohydrate metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0044403 symbiont process No
GO:1901576 organic substance biosynthetic process No
GO:0009311 oligosaccharide metabolic process No
GO:0051704 multi-organism process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0016051 carbohydrate biosynthetic process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8116
MAVGDASLVGAEVLFDQISEAYEDAYGDNEGLKKALEQLREFHDVKASVLDVGCGPGGPASYLAKLGFEMTGFDV
SQNMVDTCRKNVPGNFFKEDMAAFSPKKPFDAIVALYSMFQLSHSATYSVLLKIASWLRPGGTFVLGTIPAEDLV
EEKSLLRASDYVERYVTIFMGKPIANTLITTKGWLDILQRAGFLIRNVDRYNFNVKGAVPERHMFITCQRSNLDP
LLGPFPLPMFRRAPHSLSEDAWKPFAERLTRHEFDAVVKAVESNKDVLDIGSGHGELPIAIAEKFGKAYAIEPNG
DRNEVLVKNGKHAPVEIRQGSAESLPYSDKQFDAAVAL*
Coding >Hirsu2|8116
ATGGCTGTGGGAGATGCTTCTCTTGTGGGCGCCGAGGTCCTCTTTGACCAAATCTCTGAGGCCTACGAAGACGCA
TATGGTGATAATGAGGGTCTGAAGAAAGCTCTGGAACAGCTGAGAGAGTTTCACGATGTCAAAGCAAGCGTCTTG
GACGTAGGGTGCGGCCCTGGAGGCCCAGCATCCTACCTGGCGAAGTTGGGATTCGAGATGACGGGCTTTGATGTC
TCGCAGAATATGGTTGACACTTGCCGCAAGAATGTTCCGGGCAACTTCTTCAAGGAAGACATGGCAGCTTTTAGT
CCGAAAAAGCCATTCGACGCCATTGTGGCCTTGTACTCTATGTTCCAGCTTTCACATAGCGCTACGTACTCGGTT
CTTTTGAAGATCGCATCCTGGCTGCGCCCCGGTGGGACCTTTGTCCTGGGTACGATCCCCGCCGAGGATCTAGTG
GAAGAAAAGAGTCTTCTCAGAGCGTCGGATTACGTGGAGCGATACGTTACGATATTCATGGGCAAGCCAATCGCC
AACACGCTGATCACCACCAAAGGCTGGCTCGACATTCTGCAGCGGGCTGGATTCCTCATTCGAAACGTCGACCGT
TACAACTTCAACGTCAAAGGCGCTGTTCCAGAAAGGCACATGTTCATCACTTGTCAGAGGTCGAACTTGGATCCC
CTTTTGGGCCCGTTCCCTTTGCCCATGTTTCGGCGCGCGCCGCACTCGCTTAGTGAAGATGCCTGGAAGCCCTTC
GCAGAGAGGCTGACTCGACACGAGTTCGACGCCGTCGTCAAGGCCGTCGAGTCGAACAAGGATGTTCTCGACATT
GGCAGCGGACATGGCGAACTTCCGATTGCCATTGCCGAAAAATTCGGCAAAGCCTACGCGATCGAGCCCAATGGC
GACAGAAACGAGGTGCTCGTCAAGAACGGCAAACACGCGCCGGTTGAAATAAGACAGGGGTCGGCTGAAAGCCTG
CCGTATAGCGACAAGCAGTTTGACGCGGCCGTAGCTCTCTGA
Transcript >Hirsu2|8116
ATGGCTGTGGGAGATGCTTCTCTTGTGGGCGCCGAGGTCCTCTTTGACCAAATCTCTGAGGCCTACGAAGACGCA
TATGGTGATAATGAGGGTCTGAAGAAAGCTCTGGAACAGCTGAGAGAGTTTCACGATGTCAAAGCAAGCGTCTTG
GACGTAGGGTGCGGCCCTGGAGGCCCAGCATCCTACCTGGCGAAGTTGGGATTCGAGATGACGGGCTTTGATGTC
TCGCAGAATATGGTTGACACTTGCCGCAAGAATGTTCCGGGCAACTTCTTCAAGGAAGACATGGCAGCTTTTAGT
CCGAAAAAGCCATTCGACGCCATTGTGGCCTTGTACTCTATGTTCCAGCTTTCACATAGCGCTACGTACTCGGTT
CTTTTGAAGATCGCATCCTGGCTGCGCCCCGGTGGGACCTTTGTCCTGGGTACGATCCCCGCCGAGGATCTAGTG
GAAGAAAAGAGTCTTCTCAGAGCGTCGGATTACGTGGAGCGATACGTTACGATATTCATGGGCAAGCCAATCGCC
AACACGCTGATCACCACCAAAGGCTGGCTCGACATTCTGCAGCGGGCTGGATTCCTCATTCGAAACGTCGACCGT
TACAACTTCAACGTCAAAGGCGCTGTTCCAGAAAGGCACATGTTCATCACTTGTCAGAGGTCGAACTTGGATCCC
CTTTTGGGCCCGTTCCCTTTGCCCATGTTTCGGCGCGCGCCGCACTCGCTTAGTGAAGATGCCTGGAAGCCCTTC
GCAGAGAGGCTGACTCGACACGAGTTCGACGCCGTCGTCAAGGCCGTCGAGTCGAACAAGGATGTTCTCGACATT
GGCAGCGGACATGGCGAACTTCCGATTGCCATTGCCGAAAAATTCGGCAAAGCCTACGCGATCGAGCCCAATGGC
GACAGAAACGAGGTGCTCGTCAAGAACGGCAAACACGCGCCGGTTGAAATAAGACAGGGGTCGGCTGAAAGCCTG
CCGTATAGCGACAAGCAGTTTGACGCGGCCGTAGCTCTCTGA
Gene >Hirsu2|8116
ATGGCTGTGGGAGATGCTTCTCTTGTGGGCGCCGAGGTCCTCTTTGACCAAATCTCTGAGGCCTACGAAGACGCA
TATGGTGATAATGAGGGTCTGAAGAAAGCTCTGGAACAGCTGAGAGAGTTTCACGATGTCAAAGCAAGCGTCTTG
GACGTAGGGTGCGGCCCTGGAGGCCCAGCATCCTACCTGGCGAAGTTGGGATTCGAGATGACGGGCTTTGATGTC
TCGCAGAATATGGTTGACACTTGCCGCAAGAATGTTCCGGGCAACTTCTTCAAGGAAGACATGGCAGCTTTTAGT
CCGAAAAAGCCATTCGACGCCATTGTGGCCTTGTACTCTATGTTCCAGCTTTCACATAGCGCTACGTACTCGGTT
CTTTTGAAGATCGCATCCTGGCTGCGCCCCGGTGGGACCTTTGTCCTGGGTACGATCCCCGCCGAGGATCTAGTG
GAAGAAAAGAGTCTTCTCAGAGCGTCGGATTACGTGGAGCGATACGTTACGATATTCATGGGCAAGCCAATCGCC
AACACGCTGATCACCACCAAAGGCTGGCTCGACATTCTGCAGCGGGCTGGATTCCTCATTCGAAACGTCGACCGT
TACAACTTCAACGTCAAAGGCGCTGTTCCAGAAAGGCACATGTTCATCACTTGTCAGAGGTCGAACTTGGATCCC
CTTTTGGGCCCGTTCCCTTTGCCCATGTTTCGGCGCGCGCCGCACTCGCTTAGTGAAGATGCCTGGAAGCCCTTC
GCAGAGAGGCTGACTCGACACGAGTTCGACGCCGTCGTCAAGGCCGTCGAGTCGAACAAGGATGTTCTCGACATT
GGCAGCGGACATGGCGGTGCGTTCCACTAGAGGGTTGTATAGAAGCGGTGGCTGACGCTCGACCAGAACTTCCGA
TTGCCATTGCCGAAAAATTCGGCAAAGCCTACGCGATCGAGCCCAATGGCGACAGAAACGAGGTGCTCGTCAAGA
ACGGCAAACACGCGCCGGTTGAAATAAGACAGGGGTCGGCTGAAAGCCTGCCGTATAGCGACAAGCAGTTTGACG
CGGCCGTAGCTCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail