Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|8115
Gene name
LocationContig_51:21855..23361
Strand-
Gene length (bp)1506
Transcript length (bp)1113
Coding sequence length (bp)1113
Protein length (aa) 371

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 4.8E-18 189 344

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 6 368 5.0E-39
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 6 368 1.0E-37
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 123 358 9.0E-15
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 123 358 4.0E-14
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 197 355 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 6 368 5.0E-39
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 6 368 1.0E-37
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 123 358 9.0E-15
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 123 358 4.0E-14
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 197 355 1.0E-11
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 197 363 2.0E-11
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 197 363 5.0E-11
sp|P10950|ASMT_BOVIN Acetylserotonin O-methyltransferase OS=Bos taurus GN=ASMT PE=1 SV=2 184 350 2.0E-10
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 153 348 1.0E-08
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 155 344 1.0E-08
sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 197 344 3.0E-08
sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 197 344 4.0E-08
sp|P46597|ASMT_HUMAN Acetylserotonin O-methyltransferase OS=Homo sapiens GN=ASMT PE=1 SV=1 190 358 6.0E-08
sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 197 344 7.0E-08
sp|Q8HZJ0|ASMT_MACMU Acetylserotonin O-methyltransferase OS=Macaca mulatta GN=ASMT PE=2 SV=1 190 362 7.0E-08
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 197 364 5.0E-07
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 189 352 6.0E-07
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 197 347 6.0E-07
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 142 344 8.0E-07
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 197 364 9.0E-07
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 163 345 3.0E-06
sp|D3KU67|ASMT_MUSMM Acetylserotonin O-methyltransferase OS=Mus musculus molossinus GN=Asmt PE=2 SV=1 190 344 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6971 0.3199 0.028 0.0888 0.1821 0.0222 0.125 0.3095 0.321 0.0112

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|8115
MASFQIPDPESLLSLSKLITEQVNNYVDMVRHCEKSPEEDLKLSLQQKQEMRDRAEAVANTGGQLQALITDPSHW
MAQSAWAYYDSVALCLCIEMKIAEHIEPGEKGATLEDLVKSTGASSGLITARNHFQIPQDPRKAAFCEAFQTDIS
LYDFYHSVDTKRGERFARAMVGHYDGQLNQPLETIFPFGDLADGSLLVDIGGGTGRQAIRLAALFPQLSCVVQDH
SSVVSGAEKEIELSENITNRISWEAHDFCTLQPRKGAAVYLLSHVLMDHTDKKAAQIVQSVVDAMDPASSKLLIH
DFMDPPSFGQDRPRIFDMLDLHMIASLSRPSRSEADWDALIARADKRLRRHKTWAAKDGSAVLELRLQAE*
Coding >Hirsu2|8115
ATGGCTTCATTCCAAATTCCTGATCCCGAAAGCTTGCTGTCTCTGTCGAAGTTGATTACTGAACAAGTCAATAAC
TATGTCGACATGGTTCGCCACTGTGAGAAGAGTCCTGAAGAGGACCTCAAGCTATCTCTGCAGCAGAAGCAGGAG
ATGCGAGATCGAGCTGAAGCTGTCGCAAATACCGGTGGACAGCTTCAGGCCCTTATAACTGACCCAAGTCATTGG
ATGGCTCAGAGCGCGTGGGCGTACTATGACAGTGTGGCGCTCTGTCTCTGCATCGAGATGAAGATCGCCGAGCAC
ATCGAGCCCGGCGAAAAGGGAGCAACGCTCGAAGATCTGGTCAAGAGCACCGGTGCCTCATCAGGCCTTATCACG
GCTCGGAACCACTTTCAGATTCCACAGGATCCGAGAAAGGCGGCCTTTTGCGAAGCCTTCCAGACCGACATTTCG
CTCTACGACTTCTACCACAGTGTCGACACGAAGCGTGGAGAGCGGTTTGCCCGCGCCATGGTGGGACACTACGAT
GGTCAACTAAATCAGCCGTTAGAGACCATCTTTCCCTTCGGAGACTTGGCGGACGGATCTCTGCTTGTCGACATT
GGCGGCGGCACCGGACGACAGGCAATTCGACTGGCAGCCCTGTTTCCACAACTGTCATGCGTGGTGCAAGACCAC
AGTAGTGTCGTCTCGGGCGCCGAGAAGGAGATAGAGCTTTCGGAAAATATAACAAATCGCATTTCGTGGGAGGCA
CACGACTTTTGCACTCTGCAGCCTCGGAAGGGAGCTGCTGTCTACCTGTTGAGCCACGTATTGATGGACCACACG
GACAAGAAAGCAGCGCAAATAGTTCAGTCTGTTGTTGACGCTATGGACCCGGCGTCGTCGAAGCTCCTGATCCAC
GACTTCATGGACCCTCCGTCGTTCGGCCAGGACCGTCCGCGCATCTTTGACATGCTCGACCTGCATATGATTGCG
AGCCTGAGCAGACCCTCTCGCAGTGAGGCTGACTGGGACGCTTTAATCGCTCGTGCCGATAAGAGACTTAGGAGG
CATAAGACCTGGGCTGCTAAGGACGGATCTGCAGTGCTTGAGCTTAGGCTTCAGGCGGAGTGA
Transcript >Hirsu2|8115
ATGGCTTCATTCCAAATTCCTGATCCCGAAAGCTTGCTGTCTCTGTCGAAGTTGATTACTGAACAAGTCAATAAC
TATGTCGACATGGTTCGCCACTGTGAGAAGAGTCCTGAAGAGGACCTCAAGCTATCTCTGCAGCAGAAGCAGGAG
ATGCGAGATCGAGCTGAAGCTGTCGCAAATACCGGTGGACAGCTTCAGGCCCTTATAACTGACCCAAGTCATTGG
ATGGCTCAGAGCGCGTGGGCGTACTATGACAGTGTGGCGCTCTGTCTCTGCATCGAGATGAAGATCGCCGAGCAC
ATCGAGCCCGGCGAAAAGGGAGCAACGCTCGAAGATCTGGTCAAGAGCACCGGTGCCTCATCAGGCCTTATCACG
GCTCGGAACCACTTTCAGATTCCACAGGATCCGAGAAAGGCGGCCTTTTGCGAAGCCTTCCAGACCGACATTTCG
CTCTACGACTTCTACCACAGTGTCGACACGAAGCGTGGAGAGCGGTTTGCCCGCGCCATGGTGGGACACTACGAT
GGTCAACTAAATCAGCCGTTAGAGACCATCTTTCCCTTCGGAGACTTGGCGGACGGATCTCTGCTTGTCGACATT
GGCGGCGGCACCGGACGACAGGCAATTCGACTGGCAGCCCTGTTTCCACAACTGTCATGCGTGGTGCAAGACCAC
AGTAGTGTCGTCTCGGGCGCCGAGAAGGAGATAGAGCTTTCGGAAAATATAACAAATCGCATTTCGTGGGAGGCA
CACGACTTTTGCACTCTGCAGCCTCGGAAGGGAGCTGCTGTCTACCTGTTGAGCCACGTATTGATGGACCACACG
GACAAGAAAGCAGCGCAAATAGTTCAGTCTGTTGTTGACGCTATGGACCCGGCGTCGTCGAAGCTCCTGATCCAC
GACTTCATGGACCCTCCGTCGTTCGGCCAGGACCGTCCGCGCATCTTTGACATGCTCGACCTGCATATGATTGCG
AGCCTGAGCAGACCCTCTCGCAGTGAGGCTGACTGGGACGCTTTAATCGCTCGTGCCGATAAGAGACTTAGGAGG
CATAAGACCTGGGCTGCTAAGGACGGATCTGCAGTGCTTGAGCTTAGGCTTCAGGCGGAGTGA
Gene >Hirsu2|8115
ATGGCTTCATTCCAAATTCCTGATCCCGAAAGCTTGCTGTCTCTGTCGAAGTTGATTACTGAACAAGTCAATAAC
TATGTCGACATGGTTCGCCACTGTGAGAAGAGTCCTGAAGAGGACCTCAAGCTATCTCTGCAGCAGAAGCAGGAG
ATGCGAGATCGAGCTGAAGCTGTCGCAAATACCGGTGGACAGCTTCAGGCCCTTATAACTGACCCAAGTCATTGG
ATGGCTCAGAGCGCGTGGGCGTACTATGACAGTGTGGCGCTCTGTCTCTGCATCGAGATGAAGATCGCCGAGCAC
ATCGAGCCCGGCGAAAAGGGAGCAACGCTCGAAGATCTGGTCAAGAGCACCGGTGCCTCATCAGGCCTTATCAGT
AAGAGGCTCACCGTTTTCGTCCCGAGCTGCAGACTAGGAACATAAAACCTTGCAGAACGAACTATGAGACAGTGC
ATCAATCGATTCATCTTCCAGGAACCTAAGCCGGGGCACTATCAGCACAACCGACATTCCATCTGCTTGCGAGAT
AGGAATCTTGGAAGCTTGATTCATTATTTGCAAGCACTGCCTTTTCAACATCTTGAGTTGCCTGGCTAACAAACC
GAGCAGGACGGACGATGCGCTGCTGTGCGGCGCCTATCTGCCGCGCACAGCGGCTCGGAACCACTTTCAGATTCC
ACAGGATCCGAGAAAGGCGGCCTTTTGCGAAGCCTTCCAGAGTACGTATCAACCAGAGGCGCCGAAGGTTAAGAG
ACTGACAGCGCAAAGCCGACATTTCGCTCTACGACTTCTACCACAGTGTCGACACGAAGCGTGGAGAGCGGTTTG
CCCGCGCCATGGTGGGACACTACGATGGTCAACTAAATCAGCCGTTAGAGACCATCTTTCCCTTCGGAGACTTGG
CGGACGGATCTCTGCTTGTCGACATTGGCGGCGGCACCGGACGACAGGCAATTCGACTGGCAGCCCTGTTTCCAC
AACTGTCATGCGTGGTGCAAGACCACAGTAGTGTCGTCTCGGGCGCCGAGAAGGAGATAGAGCTTTCGGAAAATA
TAACAAATCGCATTTCGTGGGAGGCACACGACTTTTGCACTCTGCAGCCTCGGAAGGGAGCTGCTGTCTACCTGT
TGAGCCACGTATTGATGGACCACACGGACAAGTACGTGGCTGTCTCCATGTCCGCCCCCCATAATCTTTGTCCCT
CTGGTCTTACCATCAGTCTACAGGAAAGCAGCGCAAATAGTTCAGTCTGTTGTTGACGCTATGGACCCGGCGTCG
TCGAAGCTCCTGATCCACGACTTCATGGACCCTCCGTCGTTCGGCCAGGACCGTCCGCGCATCTTTGACATGCTC
GACCTGCATATGATTGCGAGCCTGAGCAGACCCTCTCGCAGTGAGGCTGACTGGGACGCTTTAATCGCTCGTGCC
GATAAGAGACTTAGGAGGCATAAGACCTGGGCTGCTAAGGACGGATCTGCAGTGCTTGAGCTTAGGCTTCAGGCG
GAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail